GenomeNet

Database: RefSeq
Entry: NC_008710
LinkDB: NC_008710
Original site: NC_008710 
LOCUS       NC_008710             917330 bp    DNA     linear   CON 17-DEC-2014
DEFINITION  Borrelia turicatae 91E135 chromosome, complete genome.
ACCESSION   NC_008710
VERSION     NC_008710.1  GI:119952806
DBLINK      BioProject: PRJNA58311
KEYWORDS    RefSeq.
SOURCE      Borrelia turicatae 91E135
  ORGANISM  Borrelia turicatae 91E135
            Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Borrelia.
REFERENCE   1  (bases 1 to 917330)
  AUTHORS   Porcella,S.F., Raffel,S.J., Schrumpf,M.E., Montgomery,B., Smith,T.
            and Schwan,T.G.
  TITLE     The genome sequence of Borrelia hermsii and Borrelia turicatae:
            Comparative analysis of two agents of endemic N. America relapsing
            fever
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 917330)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUL-2008) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 917330)
  AUTHORS   Porcella,S.F., Raffel,S.J., Schrumpf,M.E., Montgomery,B., Smith,T.
            and Schwan,T.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2004) Laboratory of Human Bacterial
            Pathenogenesis, Rocky Mountain Laboratories, National Institutes of
            Allergy and Infectious Disease, National Institutes of Health, 903
            S. 4th Street, Hamilton, MT 59840, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000049.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..917330
                     /organism="Borrelia turicatae 91E135"
                     /mol_type="genomic DNA"
                     /strain="91E135"
                     /db_xref="taxon:314724"
     gene            98..655
                     /locus_tag="BT0001"
                     /db_xref="GeneID:4642299"
     CDS             98..655
                     /locus_tag="BT0001"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945016.1"
                     /db_xref="GI:119952807"
                     /db_xref="GeneID:4642299"
                     /translation="MLQFLTHTMKNLILISLHLLIIYTHAWGEKFNNENIKPLQIGII
                     QHNYINLTPYNQHYKYYAFIGITMTYNEWIDFNIIPIHFYPHVPTLFSNVYFTLSISL
                     YILKYQIHIYSFIINILIGTQLPIALRTSIITGNNISAFLFPAFPFVSVKLNIPITNL
                     FSILSTFSSSLREYFLVDIAITFPI"
     gene            complement(713..1780)
                     /locus_tag="BT0002"
                     /db_xref="GeneID:4642823"
     CDS             complement(713..1780)
                     /locus_tag="BT0002"
                     /EC_number="3.2.1.52"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-hexosaminidase"
                     /protein_id="YP_945017.1"
                     /db_xref="GI:119952808"
                     /db_xref="GeneID:4642823"
                     /translation="MIWYLGKVSGMFRFVLFGLLLSSLVLLGSIPDIDYDYFENDKFD
                     LVDIDKFLGRVNVKNILRERCFFIGIRNVANPSAVQALSKEELGKIREINPVGIILFR
                     ENFKDAQQTKELIEGIKRYLGSDILIAVDEEGGLVSRASENKKLGVYNFPAMESVGKT
                     GDSQLAYKIGEILGKQLRRLGINVNMAPVADAKFVPNSPLGSRTFGYSSYNIGLMVEA
                     FIDGIQREGVFAVVKHFPGLGGTKVDTHKDLALLPYSKNFLMVNNFIPFLFGKEAKFI
                     MLGHVLVPKISGDVSSMSKDIVDIIRHNLNIFSIIMTDAYDMGAIVNNFSLGHAIRKS
                     LNSGIDVVLIPEGFKKLNVEE"
     misc_feature    complement(<734..1540)
                     /locus_tag="BT0002"
                     /note="Beta-glucosidase-related glycosidases [Carbohydrate
                     transport and metabolism]; Region: BglX; COG1472"
                     /db_xref="CDD:224389"
     gene            complement(1743..3197)
                     /locus_tag="BT0003"
                     /db_xref="GeneID:4642700"
     CDS             complement(1743..3197)
                     /locus_tag="BT0003"
                     /EC_number="2.7.7.9"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="YP_945018.1"
                     /db_xref="GI:119952809"
                     /db_xref="GeneID:4642700"
                     /translation="MYEVIDEIFSKKMLDMLNMHKLKTLSISVKNFPDESHGSILSLA
                     NNSVKLKFKKELVEHNLKKYIDDFTKFSVSSESNFYVFTGDDLERLGLLLYPYLSFGI
                     LNGGSATSYFDILKNNDFNEELYSLYADKILEARRLFGHLPKGITPAYVNRDGSYGFS
                     FLALKMRHLLMLSNRYCELYGKSIKPSIFQMTSFKTYKPISNFLDNIFDDNLIKDLNS
                     CGLQRADILTAIQPLVYCYNKLDDGQYEYFSYCTNGKRSFLALPAGHGQNFKVLRDIY
                     FKLYNSGKKFVYIGNVDNIGFTVNLQTLAIMAITNSSSGFEFSVKTPLDTKGGVLVLD
                     DDNHLTCVDIGSVISKEAVLKAECRGSRILFNCATGLFNLEYLIENMDRIISDMPIRI
                     IEQDKEFGRYTAIEQITWEVMRIVDNPLIFEVNREDRFLPAKLFVDTLIMSNYMNDKF
                     SGNISDIARYLNYALNNALKNKYDLVFRQGKWDV"
     misc_feature    complement(1815..3050)
                     /locus_tag="BT0003"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     gene            3262..5145
                     /locus_tag="BT0004"
                     /db_xref="GeneID:4642682"
     CDS             3262..5145
                     /locus_tag="BT0004"
                     /EC_number="5.4.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomannomutase"
                     /protein_id="YP_945019.1"
                     /db_xref="GI:119952810"
                     /db_xref="GeneID:4642682"
                     /translation="MLIIIEYVTIIIVLQIKANIKLKYTNEEENMLKRYILNMTNLSN
                     AINEMILSHSGFRKIFAKSKNENSIEYEINDDDKILVALITLTISNYFKDKPKKYINV
                     GSDSRATGNIISEIIIKTLILNNNSVKFFGILPIPEILAYTKENQNSKGFIYISASHN
                     PTGYNGIKIGLNDGGVLNSNETKKIICQIRSNIENETLINNLITNLQKFNTNALHLKT
                     YETIITSQARHKTQSYNSYKSLMQQIIYSDTHNQKNIDILKKTIKKEPIGIIGEMNGS
                     SRINSIDREMIESLGIKLEFHNTEIGIFKHGMTPEGTSLNMCKQILEQKFKNDNSFKL
                     GYVPDCDGDRGNLVAILKKEQASIITPQKIFALSVLSELSYLYHTGIKDNLAIVVNDA
                     TSLNIEKIASLFNTKVYRVEVGEANLTEMADLLRNKGLIVKILGEGSNGGNITYPSKV
                     RDPLTTLFSIIKLLKIKNLYKIWCSISNNSYNEHYTLGDILKTINFYSNVEVSSEKAM
                     LKIKVENQEILKTNYEKLLDKEFNNNNNTVLHKLPIHNYEIINYEGIKQNISRTGDSS
                     GGLKVLFKNNKHEIIASLWFRGSKTEPIFRVLSEVISEHNDLLYPLLDFHIDLIHSAN
                     SLI"
     misc_feature    3421..5142
                     /locus_tag="BT0004"
                     /note="Phosphomannomutase [Carbohydrate transport and
                     metabolism]; Region: {ManB}; COG1109"
                     /db_xref="CDD:224034"
     misc_feature    3538..5061
                     /locus_tag="BT0004"
                     /note="The alpha-D-phosphohexomutase superfamily includes
                     several related enzymes that catalyze a reversible
                     intramolecular phosphoryl transfer on their sugar
                     substrates. Members of this family include the
                     phosphoglucomutases (PGM1 and PGM2),
                     phosphoglucosamine...; Region: phosphohexomutase; cl03757"
                     /db_xref="CDD:261872"
     misc_feature    order(3733..3741,3763..3765,4276..4278,4282..4284,
                     4288..4293,4435..4437,4498..4506,4570..4572,4579..4581,
                     4585..4587,5020..5022,5026..5034,5047..5049)
                     /locus_tag="BT0004"
                     /note="active site"
                     /db_xref="CDD:100086"
     misc_feature    order(3733..3735,4291..4293,4435..4437,4498..4500,
                     4504..4506,4570..4572,4579..4581,4585..4587,5020..5022,
                     5026..5034,5047..5049)
                     /locus_tag="BT0004"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100086"
     misc_feature    order(3733..3735,4276..4278,4282..4284,4288..4290)
                     /locus_tag="BT0004"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:100086"
     gene            complement(5227..6282)
                     /locus_tag="BT0005"
                     /db_xref="GeneID:4642753"
     CDS             complement(5227..6282)
                     /locus_tag="BT0005"
                     /EC_number="6.1.1.2"
                     /note="catalyzes a two-step reaction, first charging a
                     tryptophan molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthetase"
                     /protein_id="YP_945020.1"
                     /db_xref="GI:119952811"
                     /db_xref="GeneID:4642753"
                     /translation="MQRKVMLTGDRPTGSLHLGHYIGSIVNRLKYQEEYETYIIIADL
                     HTLTTKPDLKSINEISVNVREMVLDYLACGINPEKVNIYLQSAIPELLELNLILSMIV
                     MVNRLQRIPSIKDMSVAAGLSEVPYGLLGYPVLMSADILMTKANLVPVGRDNEAHIEL
                     TRELARKFNYLYGDFFPIPEAIFTDSQALVGIYGKAKMSKSLGNAIFLSDDEKSLRKK
                     VMSMFTDPKRVRADIPGEVDGNPVFIYHDLFNSNVDELYEFKTRYRKGTIGDVEVKER
                     LFEVLNQFLIPIRERRKFFEAKKGYIDEIIFEGTSKTRKVAIEVIKNAKNLMGISRTW
                     NGVRRNVEKILKNNLSI"
     misc_feature    complement(5287..6276)
                     /locus_tag="BT0005"
                     /note="tryptophanyl-tRNA synthetase; Reviewed; Region:
                     PRK00927"
                     /db_xref="CDD:234866"
     misc_feature    complement(5431..6267)
                     /locus_tag="BT0005"
                     /note="catalytic core domain of tryptophanyl-tRNA
                     synthetase; Region: TrpRS_core; cd00806"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(5683..5685,5689..5694,5719..5721,
                     5812..5814,5821..5826,5830..5835,5839..5841,5866..5868,
                     5875..5877,5887..5889,6028..6030,6148..6150,6163..6165,
                     6214..6216,6223..6228,6232..6234,6250..6264))
                     /locus_tag="BT0005"
                     /note="active site"
                     /db_xref="CDD:173903"
     misc_feature    complement(6223..6234)
                     /locus_tag="BT0005"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(order(5878..5883,5890..5895,5899..5901,
                     5959..5964,5968..5979,5983..5988,5995..6003,6007..6012,
                     6139..6144,6151..6153))
                     /locus_tag="BT0005"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173903"
     misc_feature    complement(5680..5694)
                     /locus_tag="BT0005"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173903"
     gene            complement(6285..7358)
                     /locus_tag="BT0006"
                     /db_xref="GeneID:4642740"
     CDS             complement(6285..7358)
                     /locus_tag="BT0006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945021.1"
                     /db_xref="GI:119952812"
                     /db_xref="GeneID:4642740"
                     /translation="MSLELKPTDRLKFVKLQSVFYVIALIVMLIAILKIAQTIFKPLA
                     IAVVLGFLVYPIYTFLKKLKIPRVLIVFVIFFVLFSFSYLVFSFVYYSVTVLIDQLPY
                     YQKQLIFIMVDILEKYKLDSAIISTIDFSKYIYPFLTRISNEIIGFASSLVVLFLLLY
                     FLLSEIHIFDIKVKNAFKQSVSSIFIEALSTINSQISKYLGIKLFVSCLTGFLVFIGL
                     KLFGQDFPRVWAVLTFVFNFIPSIGSILAVFFIMIAALVQFYPNLNLVFYIFIYNTFV
                     QMLIGNILEPKMQGHRLDLSPFLLLCFLFFWGWLWGIVGLLIAYPFTVIIKVIVDNIA
                     CLKPFSVFLSGSKILSVDNNKES"
     misc_feature    complement(6360..7304)
                     /locus_tag="BT0006"
                     /note="Domain of unknown function DUF20; Region: UPF0118;
                     cl00465"
                     /db_xref="CDD:260441"
     gene            complement(7455..8318)
                     /locus_tag="BT0007"
                     /db_xref="GeneID:4642518"
     CDS             complement(7455..8318)
                     /locus_tag="BT0007"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945022.1"
                     /db_xref="GI:119952813"
                     /db_xref="GeneID:4642518"
                     /translation="MFMGKKEKIIALIFDFDDTLIYGNMQQVLFDEYNVNASLFWDEV
                     ENLSITYNKNHCNIIANEMIYLSHFLTYVKEGIFKGLNNKILFELGSKLRFFEGVISL
                     FKEIDEINRSLKKSDTVINIYIVSSGFRQMILGSSIAPYVTKVWACEFIDTYLMPFYQ
                     NLDNKFSENVVLSSVCYFVDHTIKTRVIFELNKGSYDKINKRIPKGRREIPFENMFYI
                     ADGFNDIPAFEILNNSLNHYKNTLTVYHGNDENAKRLVKEKRVGDLAEANYSKGTKLY
                     NWIMEKIHLNI"
     misc_feature    complement(7632..8285)
                     /locus_tag="BT0007"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     pfam12710"
                     /db_xref="CDD:257240"
     gene            8440..9216
                     /locus_tag="BT0008"
                     /db_xref="GeneID:4642178"
     CDS             8440..9216
                     /locus_tag="BT0008"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945023.1"
                     /db_xref="GI:119952814"
                     /db_xref="GeneID:4642178"
                     /translation="MIMIDISSINQIKDIFSKVLDVSLISILVYYIYKNVINSYSVNL
                     LKGMIIITSIGIVSYYFNLYTINWLLNYIANILPIAMLILFHQEIKKIIMQIGNFNLS
                     FKLANNKEETTKTIVEIIKTIKHLSENKSGSLICIEKKIQLDQIINKGIRLDSIVSNE
                     ILISIFDYETPLHDGAVIISNNKIVYAGSFLPLSNVESISKTFGTRHRAGLGISENSD
                     AITIITSEETGSISLTQNGKLEYNLSLNEIKKKLNLALIE"
     misc_feature    8584..9213
                     /locus_tag="BT0008"
                     /note="TIGR00159 family protein; Region: TIGR00159"
                     /db_xref="CDD:129263"
     misc_feature    8794..9159
                     /locus_tag="BT0008"
                     /note="DisA bacterial checkpoint controller
                     nucleotide-binding; Region: DisA_N; pfam02457"
                     /db_xref="CDD:251307"
     gene            9220..10215
                     /locus_tag="BT0009"
                     /db_xref="GeneID:4642713"
     CDS             9220..10215
                     /locus_tag="BT0009"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945024.1"
                     /db_xref="GI:119952815"
                     /db_xref="GeneID:4642713"
                     /translation="MIITKKFMNIIKLLFEDWQNKAISILIAIIMFTTSYFHSIESIT
                     IEKKFNILLEDEVTLGKIPDFNKMLLTVKINKKDLKYLDLDRITLLVEANNIKEAGEY
                     ELPIKIKNFNPIPIVEYKLSKNKITLNLDKKISKLVKVEPKFKLLEKEGKGEYFIAKY
                     NIVPEKLKIHGPEKVIKTINSIKTKIKEFDINTVFISEHLEVISPNPLITLEKNHVIV
                     NITLGKKYIHTTIKNPNLIFNNLKNGLEIKNKEKILDPENEMFIKIRSGLSEKIIKMH
                     IANKNINLNLDLSQIATPGIYNINTDIILKNNTHGIEVYEYEPKTIKIEVISTEQ"
     gene            10217..10594
                     /locus_tag="BT0010"
                     /db_xref="GeneID:4642565"
     CDS             10217..10594
                     /locus_tag="BT0010"
                     /EC_number="2.7.8.7"
                     /codon_start=1
                     /transl_table=11
                     /product="holo-[acyl-carrier protein] synthase"
                     /protein_id="YP_945025.1"
                     /db_xref="GI:119952816"
                     /db_xref="GeneID:4642565"
                     /translation="MTKSIGCDIIKVTRFNSFLQNRKKLERFFTQREIENSAMKGKGV
                     LESLAGKFSAKESLIKALSPLINIKIKYSLKDIEIISLPKGNIIFQLHNDIKTLINQM
                     NLKLYLTISHEREYAIAFVIVEN"
     misc_feature    10217..10591
                     /locus_tag="BT0010"
                     /note="4'-phosphopantetheinyl transferase superfamily;
                     Region: ACPS; cl00500"
                     /db_xref="CDD:260463"
     gene            10598..11446
                     /locus_tag="BT0011"
                     /db_xref="GeneID:4642654"
     CDS             10598..11446
                     /locus_tag="BT0011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945026.1"
                     /db_xref="GI:119952817"
                     /db_xref="GeneID:4642654"
                     /translation="MKKISYLTKYEIECPLCKHKFRKEELLTGSSRLIAGELKVDLKR
                     EYIKNEKYGNIYPRIYSITVCPNCYLAAFPNEFNAIALINNNIKQILIIRTDERKEIK
                     SIFEDNLNFNEPRRLQEGAASYILAIMCYEHLDKTHNPTFNQAKCAIRSAWIFEDLDK
                     EYPNQNYNYLQKIFYHKAAYLYKLTIEKEQNNSEPINAEIVFGPDTDKNYGYDSVLYL
                     SSLLEYFYGNKEDKQYRYNQLVDIKTLLSKITGMGKSSKEKPSILLDKIKEVYFKISN
                     EIKTFK"
     misc_feature    10598..11434
                     /locus_tag="BT0011"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1655"
                     /db_xref="CDD:224569"
     misc_feature    10616..11419
                     /locus_tag="BT0011"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2225); Region: DUF2225; pfam09986"
                     /db_xref="CDD:150637"
     gene            11447..12184
                     /gene="truA"
                     /locus_tag="BT0012"
                     /db_xref="GeneID:4642735"
     CDS             11447..12184
                     /gene="truA"
                     /locus_tag="BT0012"
                     /EC_number="4.2.1.70"
                     /note="mediates pseudouridylation (positions 38, 39, 40)
                     at the tRNA anticodon region which contributes to the
                     structural stability"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="YP_945027.1"
                     /db_xref="GI:119952818"
                     /db_xref="GeneID:4642735"
                     /translation="MKKVLAKITYDGSLYYGFQIQPKKPTIQGEIEKVLEKISKTKIK
                     IHSAGRTDKGVHARGQIISFYIKINIKLKNLKTAINSLLKDDIRIIKLKYVEDKFQPR
                     FDAKRRKYSYYILNNENHYPWEGYRAYYVKKKLNINRLNEMAEMLIGIHDFTTFSCIR
                     DQTNSKLKEIYYARFKKKNKFIIFEIIGSSFLWKMVRSIVGVMIDIEIKNEPVDTFKK
                     ILNSKNRKLTRKTAPAKALFLDKVFYE"
     misc_feature    11447..12178
                     /gene="truA"
                     /locus_tag="BT0012"
                     /note="tRNA pseudouridine synthase A; Validated; Region:
                     truA; PRK00021"
                     /db_xref="CDD:234577"
     misc_feature    11462..12178
                     /gene="truA"
                     /locus_tag="BT0012"
                     /note="Eukaryotic and bacterial pseudouridine synthases
                     similar to E.  coli TruA; Region: PseudoU_synth_EcTruA;
                     cd02570"
                     /db_xref="CDD:211337"
     misc_feature    order(11471..11473,11684..11686,11693..11716)
                     /gene="truA"
                     /locus_tag="BT0012"
                     /note="dimerization interface 3.5A [polypeptide binding];
                     other site"
                     /db_xref="CDD:211337"
     misc_feature    order(11591..11602,12035..12037)
                     /gene="truA"
                     /locus_tag="BT0012"
                     /note="active site"
                     /db_xref="CDD:211337"
     gene            12177..12755
                     /locus_tag="BT0013"
                     /db_xref="GeneID:4642853"
     CDS             12177..12755
                     /locus_tag="BT0013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945028.1"
                     /db_xref="GI:119952819"
                     /db_xref="GeneID:4642853"
                     /translation="MNKSKLLKKLILLRTLKNNISENIYSKQEEFEKLKNQIIKARNI
                     KILKHTEQKDIKENNRLIKSTGYKINKNDKKGLLIVYIDKKYLNQNAKIIVKKWCESI
                     KILNYKIIDNPNTLTFEINNQQPKAILACEEVALFLNQHLRIQIVRGFELNFKGIPIV
                     FTYLPTNQVTNPEIKKEIWQDLKIIKGIIKYG"
     misc_feature    <12531..12734
                     /locus_tag="BT0013"
                     /note="Uracil-DNA glycosylases (UDG) and related enzymes;
                     Region: UDG_like; cl00483"
                     /db_xref="CDD:260455"
     misc_feature    order(12570..12575,12663..12668,12672..12674)
                     /locus_tag="BT0013"
                     /note="active site"
                     /db_xref="CDD:198424"
     gene            12748..14724
                     /locus_tag="BT0014"
                     /db_xref="GeneID:4642672"
     CDS             12748..14724
                     /locus_tag="BT0014"
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="YP_945029.1"
                     /db_xref="GI:119952820"
                     /db_xref="GeneID:4642672"
                     /translation="MDKNSEHNFYYEIAFNIPVNRLFFYKYNLKLETGIRIITNFNGK
                     DTIGIIIKRYAKEELKENFTFEIKDIIKVIDKNAIIIEHNINLAHWISQKTFSGFGET
                     LFCGLPKISTSNKEIKNNDNENLSYKLPIQLNEEQNSIYKEIIESNIQNTFYLFGVPG
                     SGKTEIFIKLCENYLEQKKQIIFLIPEISLGYQIIKRIKSNLSTNKVYEYNSKVSNST
                     KTLIWNKVKNGENLIIIGVKSALMLPFKNLGLIIMDEEHEYTYKSENTPRFHSRHIGF
                     FLQSTFNAKFVMGSATPSLEAYLAMENNQIKKMVLKNKFFERTFKELKIIDMKKERQI
                     ISSELLYSIQKSLIDKRQALIFINKRGYSKTLECKICGHIIYCPHCSFNLIYHKSENK
                     LICHYCNYKTNIINNCPNCNSQDIIYKTYGIQFIERELKNFLPNARIARTDSDLNKKE
                     IIQSINAFENGQLDILIGTQIIAKGFNFKQIKTLGIINADIGMGLPDFRSSERIFAII
                     SQVLGRAARFQSDNTIIIQTKNPDYYPIKYAYEGKYEEFYKEEIKIRKELNYPPFKKI
                     IRIVIRSKKQETARHKCLEFFEISKELLNDKIEYLGPSKAPMSKISKYYRYNIIYLSK
                     SFNLLEKLIRHTKEKIKLTRDTYIEIDYYPISLL"
     misc_feature    13207..14712
                     /locus_tag="BT0014"
                     /note="primosomal protein N'; Region: priA; TIGR00595"
                     /db_xref="CDD:233040"
     misc_feature    13210..13626
                     /locus_tag="BT0014"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    13225..13239
                     /locus_tag="BT0014"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    13507..13518
                     /locus_tag="BT0014"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    14017..14301
                     /locus_tag="BT0014"
                     /note="helicase superfamily c-terminal domain; Region:
                     HELICc; smart00490"
                     /db_xref="CDD:197757"
     gene            complement(14721..15341)
                     /locus_tag="BT0015"
                     /db_xref="GeneID:4642818"
     CDS             complement(14721..15341)
                     /locus_tag="BT0015"
                     /EC_number="2.7.1.48"
                     /note="functions in pyrimidine salvage; pyrimidine
                     ribonucleoside kinase; phosphorylates nucleosides or
                     dinucleosides to make UMP or CMP using ATP or GTP as the
                     donor"
                     /codon_start=1
                     /transl_table=11
                     /product="uridine kinase"
                     /protein_id="YP_945030.1"
                     /db_xref="GI:119952821"
                     /db_xref="GeneID:4642818"
                     /translation="MVKIIGITGGSGSGKTTVVNKISEVIPEFVLISQDNYYKSVGDY
                     EYEFLDVNFDHPDAFDNNLFYKHLKKLKENKLIHMPLYDFINHKRKDETVEIVPTPVV
                     IVEGIMIFVEERVRNLIDLKIYIDTPNDIRFIRRLERDMSKRGRTLESVIEQYLSTTR
                     AGYYRFIEPTKEYADLIIPEGGHNDKALYVLSSFLRTLGQESSVFF"
     misc_feature    complement(14748..15299)
                     /locus_tag="BT0015"
                     /note="Uridine monophosphate kinase (UMPK, EC 2.7.1.48),
                     also known as uridine kinase or uridine-cytidine kinase
                     (UCK), catalyzes the reversible phosphoryl transfer from
                     ATP to uridine or cytidine to yield UMP or CMP. In the
                     primidine nucleotide-salvage pathway; Region: UMPK;
                     cd02023"
                     /db_xref="CDD:238981"
     misc_feature    complement(order(14793..14795,14937..14939,15294..15296))
                     /locus_tag="BT0015"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238981"
     misc_feature    complement(order(14934..14936,15174..15176,15237..15239))
                     /locus_tag="BT0015"
                     /note="Sugar specificity; other site"
                     /db_xref="CDD:238981"
     misc_feature    complement(order(14910..14912,15081..15083,15090..15092,
                     15096..15098,15183..15185,15228..15230))
                     /locus_tag="BT0015"
                     /note="Pyrimidine base specificity; other site"
                     /db_xref="CDD:238981"
     gene            complement(15334..15723)
                     /locus_tag="BT0016"
                     /db_xref="GeneID:4642828"
     CDS             complement(15334..15723)
                     /locus_tag="BT0016"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-related sulfurtransferases"
                     /protein_id="YP_945031.1"
                     /db_xref="GI:119952822"
                     /db_xref="GeneID:4642828"
                     /translation="MIVSYIKLICLIVFLFFYIWFFIVLKMKRTNLVLLEKIKNGAKI
                     LDIRSPKEYSKSHYAKSINIPFKDLFAKKDKLGNVETQIIIYGKTFNKSIEAKKILKG
                     LGFNNVFVAGTLKNMPKLPSSKEEVNG"
     misc_feature    complement(15394..15624)
                     /locus_tag="BT0016"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    complement(15463..15465)
                     /locus_tag="BT0016"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            15852..16820
                     /locus_tag="BT0017"
                     /db_xref="GeneID:4642734"
     CDS             15852..16820
                     /locus_tag="BT0017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945032.1"
                     /db_xref="GI:119952823"
                     /db_xref="GeneID:4642734"
                     /translation="MKKKRNKWTRIKQKIKFIILKILRKQLKNILKDPKLILISTLQI
                     TTGSLLMAISTNILYIPHGLLSGGIAGIALMMHYLLNFNLGLTIFILNIPLFIIGIKF
                     LNITFVIQSWIAMALYSLIVNYSQFLQYKMQINDMILVSILAGLISGLGLGLIFRAKG
                     SSGGTDIVSMIIKEKYSISIGTTNFLFNLAVLLIAAAFFNIEIALYTLIASFVTAIMT
                     DKTSTGFGNQKAILIISDKGKEISYLLTNKLKVAATLLEGKGAWAGNDKTIVFIVVPT
                     MRMSRIKYISQKIDPNCFITVLNTNEITGGKKIIESPITNKYDTTT"
     misc_feature    15927..16775
                     /locus_tag="BT0017"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1284"
                     /db_xref="CDD:224203"
     misc_feature    15975..16217
                     /locus_tag="BT0017"
                     /note="Uncharacterized BCR, YitT family COG1284; Region:
                     DUF161; pfam02588"
                     /db_xref="CDD:251396"
     misc_feature    <16317..16505
                     /locus_tag="BT0017"
                     /note="Uncharacterized BCR, YitT family COG1284; Region:
                     DUF161; pfam02588"
                     /db_xref="CDD:251396"
     misc_feature    16608..16766
                     /locus_tag="BT0017"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2179); Region: DUF2179; pfam10035"
                     /db_xref="CDD:255714"
     gene            complement(16817..17797)
                     /locus_tag="BT0018"
                     /db_xref="GeneID:4642871"
     CDS             complement(16817..17797)
                     /locus_tag="BT0018"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     D"
                     /protein_id="YP_945033.1"
                     /db_xref="GI:119952824"
                     /db_xref="GeneID:4642871"
                     /translation="MKKFQKEFIVRKDSQRLDIYLSEDLCLFTRSQIKKREVKAFKYH
                     DGVFVAIKLSRPVFVDDKILIEFNEEINLREYVRPLNLPISILYEDINVIVVDKPQGI
                     LSHPGISNLENTIVNFLLYHISGLRDSFQEDKLRPGIVHRLDKETSGVMICAKNLKTL
                     NFLSRQFKERFVKKVYIAVVKGNFKIDSGIIETFIDRDRHDRKRFSVHENRGKRALTE
                     YRVLASIGNYSLVALKPKTGRTHQLRVHMKHLNHPILGDSIYARLDKEFKEMSLMLHA
                     FKLEINIKEGSLKKFISVFPQRFINFLSIFYDKETLSILVNDFIVFLDKF"
     misc_feature    complement(16952..17785)
                     /locus_tag="BT0018"
                     /note="Pseudouridylate synthases, 23S RNA-specific
                     [Translation, ribosomal structure and biogenesis]; Region:
                     RluA; COG0564"
                     /db_xref="CDD:223638"
     misc_feature    complement(16955..17521)
                     /locus_tag="BT0018"
                     /note="Pseudouridine synthase, RsuA/RluD family; Region:
                     PseudoU_synth_RluCD_like; cd02869"
                     /db_xref="CDD:211346"
     misc_feature    complement(order(17066..17068,17366..17377))
                     /locus_tag="BT0018"
                     /note="active site"
                     /db_xref="CDD:211346"
     gene            complement(17798..18295)
                     /locus_tag="BT0019"
                     /db_xref="GeneID:4642869"
     CDS             complement(17798..18295)
                     /locus_tag="BT0019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945034.1"
                     /db_xref="GI:119952825"
                     /db_xref="GeneID:4642869"
                     /translation="MMIRFLLLLFNVFILYSNSLDYFKFELEYLNYKFSLRDKISSSE
                     NNIDFGSEFFVRLESNDDFFYKDVQENKDLNIEKTINSNWGKKLFRFSAISVGTFPIA
                     LFVGLYCFDLSYYFNNMDGKNFPYPFSSGFELSKDETFKKFMISASAGLAISLIIALI
                     DCFSY"
     gene            complement(18300..19964)
                     /locus_tag="BT0020"
                     /db_xref="GeneID:4642233"
     CDS             complement(18300..19964)
                     /locus_tag="BT0020"
                     /EC_number="2.7.1.90"
                     /note="catalyzes the formation of fructose
                     1,6-bisphosphate from fructose 6-phosphate and
                     diphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="diphosphate--fructose-6-phosphate
                     1-phosphotransferase"
                     /protein_id="YP_945035.1"
                     /db_xref="GI:119952826"
                     /db_xref="GeneID:4642233"
                     /translation="MVSVFQKERYKYIPKLPKILENDFQNISVVFGEKTEALGDRDAL
                     REIFKNTYGLPVVNFTQGSSNVDFTRVLNVGIILSGGPAPGGHNVVAGIFDAIKKSNP
                     NSKIFGFKGGPSGLLEDKKIEITQELIDSYRNTGGFDIVSSGRTKIETDAQYEQALSV
                     ILKNNLNALIVIGGDDSNTNAALLAEFFKKKHHDIQVIGVPKTIDADLRNAHIQISFG
                     FDSATKTYSEMIGNLCRDAMSTRKYWHFVKLMGRSASHVALECALKTHPNICIISEEI
                     LAKKKTLSELVRDITSVVVKRSLKGYDFGVVIVPEGVIEFIPEVKSLMIELCSIFDSN
                     ESEFKGLDVEDIRKIFISKLSGYMREVYVSLPLFIQIELVNSVLERDPHGNFNVSRVP
                     TEKLFMEMVNVRLEELRKLGEYSGKFVPIDHFFGYEGRSVAPSNFDSDYCYSLGYNAA
                     ILVLNGLTGYMSSVKNLNKNATEWLAGGVPLTMMMNMEERYGVAKPVIKKALVDLKGA
                     PFNEFVKNREEWAVNNLYVSPGPIQYFGVSELVDEVTLTLKLELEN"
     misc_feature    complement(18303..19964)
                     /locus_tag="BT0020"
                     /note="diphosphate--fructose-6-phosphate
                     1-phosphotransferase; Provisional; Region: PRK07085"
                     /db_xref="CDD:235930"
     misc_feature    complement(order(18675..18677,18684..18686,19032..19034,
                     19209..19217,19344..19346,19350..19352,19356..19358,
                     19425..19430,19434..19442,19530..19532,19626..19628,
                     19722..19724))
                     /locus_tag="BT0020"
                     /note="active site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(19425..19430,19434..19442,19530..19532,
                     19626..19628,19722..19724))
                     /locus_tag="BT0020"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(18420..18422,18567..18569,18612..18614,
                     18633..18635,18645..18650,19059..19061,19167..19169,
                     19173..19178,19263..19265,19272..19274,19284..19286,
                     19320..19322,19563..19565,19572..19574,19587..19589,
                     19680..19682,19692..19694))
                     /locus_tag="BT0020"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(19053..19061,19065..19067,19161..19163,
                     19167..19169,19263..19265,19572..19577,19584..19589,
                     19680..19682,19692..19694))
                     /locus_tag="BT0020"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238216"
     misc_feature    complement(order(18675..18677,18684..18686,18702..18704,
                     19032..19034,19209..19217,19236..19238,19344..19346,
                     19350..19352,19356..19358))
                     /locus_tag="BT0020"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238216"
     gene            complement(20033..21070)
                     /locus_tag="BT0021"
                     /db_xref="GeneID:4642872"
     CDS             complement(20033..21070)
                     /locus_tag="BT0021"
                     /EC_number="5.-.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="putative S-adenosylmethionine:tRNA
                     ribosyltransferase-isomerase"
                     /protein_id="YP_945036.1"
                     /db_xref="GI:119952827"
                     /db_xref="GeneID:4642872"
                     /translation="MDTKEFYFDLPCKLIAQYPSEKRGLSRLMVLDSGNQKIYHNDSI
                     NDIFKYINSNTFLVFNDSRVRKSRIYAKTEHGGSIEFLILDRLAGDEFTSLISKAKKQ
                     NIGKVYMFPQGLLAQIISKTDNEFIIKFNKCVSESYFEQHGLIPLPPYIKRNYDRADE
                     ERYRTIYSKYIGSSASATAGLHFSEELFSKLDENNIEYDFITLHVGLGTFLPVRTKTI
                     EEHKMHFESFSIKNSVALRLEESKALGKKILAIGTTTLRALESAYDKQKGFVRGEQKT
                     NLFIYPGKGYEFKFVDMLFTNFHTPESTLLMLVSSFGGKDFVFSAYREAVKMNYKFFS
                     YGDATLFLNHM"
     misc_feature    complement(20051..21067)
                     /locus_tag="BT0021"
                     /note="Queuosine biosynthesis protein; Region:
                     Queuosine_synth; pfam02547"
                     /db_xref="CDD:251365"
     gene            complement(21060..22103)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /db_xref="GeneID:4642231"
     CDS             complement(21060..22103)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="promotes strand exchange during homologous
                     recombination; RuvAB complex promotes branch migration;
                     RuvABC complex scans the DNA during branch migration and
                     resolves Holliday junctions at consensus sequences; forms
                     hexameric rings around opposite DNA arms; requires ATP for
                     branch migration and orientation of RuvAB complex
                     determines direction of migration"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="YP_945037.1"
                     /db_xref="GI:119952828"
                     /db_xref="GeneID:4642231"
                     /translation="MDFGGGSKFLSSDKNFLYDRNESELRPKSLKDFVRQSHIKENLN
                     IFIKASRDRNEALDHVFLSGPPGLGKTTLASIIAFEMNTTIKMTSAPALDKPKDIVGI
                     LTTLDDKSILFIDEIHRLKPVIEEMLYIAMEDYKIDWIIGQGPAARTVRMPIPKFTLI
                     GATTKPGKVASPLYARFGIVFRFDLYNEDELVKIIQRNSIILNVKLEDKAAWLLARSS
                     RGTPRVANRLLRRMRDFAQVGGYGLITESIVSSGLEMLKIDHKGLDEQDRNILRSLIL
                     KFKGGPVGVETLAISVGETADSLEDFYEPYLILKGLIERTSRGRKATDFAYFHLNLNK
                     NNHDDLNTGEYGY"
     misc_feature    complement(21102..22049)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="Holliday junction DNA helicase RuvB; Reviewed;
                     Region: ruvB; PRK00080"
                     /db_xref="CDD:234619"
     misc_feature    complement(21549..21959)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(21891..21914)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(21612..21614,21759..21761,21888..21911))
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(21756..21773)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(21576..21578)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(21105..21329)
                     /gene="ruvB"
                     /locus_tag="BT0022"
                     /note="Holliday junction DNA helicase ruvB C-terminus;
                     Region: RuvB_C; pfam05491"
                     /db_xref="CDD:253217"
     gene            complement(22158..22748)
                     /gene="ruvA"
                     /locus_tag="BT0023"
                     /db_xref="GeneID:4642235"
     CDS             complement(22158..22748)
                     /gene="ruvA"
                     /locus_tag="BT0023"
                     /note="plays an essential role in ATP-dependent branch
                     migration of the Holliday junction"
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvA"
                     /protein_id="YP_945038.1"
                     /db_xref="GI:119952829"
                     /db_xref="GeneID:4642235"
                     /translation="MINKICGKIVEKRESSIVIVALPFEFEILVSSFCNAELGLQEDV
                     EILTYLHLREDEIRLFGFLNVSEREVFEKLISVDGIGPKAALRILSGIKYNEFRDAVE
                     REDVKLISNVKGIGNKMAGKIFLKLRGKLVKVNEASSGVLKFKELEQSIVNMGFDRKL
                     VAAAIKEIMLIDEFLMLRQVDQEQFLFREILRKLSG"
     misc_feature    complement(22161..22748)
                     /gene="ruvA"
                     /locus_tag="BT0023"
                     /note="Holliday junction DNA helicase RuvA; Provisional;
                     Region: ruvA; PRK13901"
                     /db_xref="CDD:139961"
     misc_feature    complement(22566..22748)
                     /gene="ruvA"
                     /locus_tag="BT0023"
                     /note="RuvA N terminal domain; Region: RuvA_N; pfam01330"
                     /db_xref="CDD:250538"
     misc_feature    complement(22365..22547)
                     /gene="ruvA"
                     /locus_tag="BT0023"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     gene            complement(22836..23321)
                     /locus_tag="BT0023A"
                     /db_xref="GeneID:4642867"
     CDS             complement(22836..23321)
                     /locus_tag="BT0023A"
                     /EC_number="3.1.22.4"
                     /codon_start=1
                     /transl_table=11
                     /product="crossover junction endodeoxyribonuclease RuvC"
                     /protein_id="YP_945039.1"
                     /db_xref="GI:119952830"
                     /db_xref="GeneID:4642867"
                     /translation="MIMRILGIDPGLANVGWGILDRKGSKYMYVQDGTVITHPFMSLK
                     DRLKLISDEIILIIDNFKPDVASIENIYFAKNKKTAISVSEARGAIILTFALKNLDFY
                     EYTPIQVKNSISGFGRIEKVQVKYVIRILLGMKPDFIFTSDHSSDALALAICHGNYHI
                     L"
     misc_feature    complement(22857..23312)
                     /locus_tag="BT0023A"
                     /note="Holliday junction resolvases (HJRs) are
                     endonucleases that specifically resolve Holliday junction
                     DNA intermediates during homologous recombination.  HJR's
                     occur in archaea, bacteria, and in the mitochondria of
                     certain fungi, however this CD...; Region: RuvC_resolvase;
                     cd00529"
                     /db_xref="CDD:238294"
     misc_feature    complement(order(22881..22883,22890..22892,23115..23117,
                     23295..23297))
                     /locus_tag="BT0023A"
                     /note="active site"
                     /db_xref="CDD:238294"
     misc_feature    complement(order(22959..22961,22992..22994,23001..23003,
                     23076..23078,23097..23099,23214..23216,23283..23285))
                     /locus_tag="BT0023A"
                     /note="putative DNA-binding cleft [nucleotide binding];
                     other site"
                     /db_xref="CDD:238294"
     misc_feature    complement(order(23034..23039,23049..23051,23058..23063,
                     23067..23072,23079..23084,23091..23093,23106..23108,
                     23169..23171,23178..23180))
                     /locus_tag="BT0023A"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238294"
     gene            complement(23347..24081)
                     /locus_tag="BT0025"
                     /db_xref="GeneID:4642652"
     CDS             complement(23347..24081)
                     /locus_tag="BT0025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945040.1"
                     /db_xref="GI:119952831"
                     /db_xref="GeneID:4642652"
                     /translation="MSGHSKWSTIKRKKGALDAKRNKIFTKLIREISIAAKMGGGDIE
                     SNSRLRLAVNKARVSNMPKDNIEKAIKKGSGDDNIGSEYFELTYEAYAPHGVALIIKC
                     LTDNKNRTASEVRSVLSKSGGSLGAPGSVSYMFHKKGLISYSLDKYPEDEIIELALEA
                     GAEDIYSEGSQIEVITSAENFEAISSFLRTKFEEDIAEIALIPGNKLSLNKEQMDKVL
                     ALIEKLEDFDDVQEVVHNLEIIDEIN"
     misc_feature    complement(23353..24081)
                     /locus_tag="BT0025"
                     /note="hypothetical protein; Validated; Region: PRK00110"
                     /db_xref="CDD:234640"
     gene            complement(24082..24987)
                     /locus_tag="BT0026"
                     /db_xref="GeneID:4642564"
     CDS             complement(24082..24987)
                     /locus_tag="BT0026"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /note="methylenetetrahydrofolate dehydrogenase (NADP+)"
                     /codon_start=1
                     /transl_table=11
                     /product="methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="YP_945041.1"
                     /db_xref="GI:119952832"
                     /db_xref="GeneID:4642564"
                     /translation="MNNVFDGKLFANQYYLLLKEFLIHHDLVDKVSLKVILANDNPAS
                     KLYVAVKERVSREIGINFHVIKLAGNSEQDNILTLIEAENINEYTDGIIVQLPLASEI
                     DVNMVLNSIMSTKDVDGLSAINLGKLISGDRKGFIPCTAFAVLKVLFDKGIEISGKTV
                     VVIGRSSLVGRPISILLSSKPYDATVITCHSKSTNLDVYVRQSDIIISAVGKPKLIKA
                     SMIDGYPYVIDIGISRVEIDGNSVLIGDVDFESVKEKVKFITPVVGGIGPVTVLMLMF
                     NTIKAHLIRYNKFDILEKLEKLVEV"
     misc_feature    complement(24133..24978)
                     /locus_tag="BT0026"
                     /note="5,10-methylene-tetrahydrofolate
                     dehydrogenase/Methenyl tetrahydrofolate cyclohydrolase
                     [Coenzyme metabolism]; Region: FolD; COG0190"
                     /db_xref="CDD:223268"
     misc_feature    complement(24634..>24891)
                     /locus_tag="BT0026"
                     /note="Tetrahydrofolate dehydrogenase/cyclohydrolase,
                     catalytic domain; Region: THF_DHG_CYH; pfam00763"
                     /db_xref="CDD:250116"
     misc_feature    complement(24142..24645)
                     /locus_tag="BT0026"
                     /note="NADP binding domain of methylene-tetrahydrofolate
                     dehydrogenase/cyclohydrolase; Region:
                     NAD_bind_m-THF_DH_Cyclohyd; cd01080"
                     /db_xref="CDD:133448"
     misc_feature    complement(order(24382..24384,24409..24414,24418..24420,
                     24424..24441,24454..24456,24463..24468,24493..24495,
                     24511..24513,24517..24519,24610..24612,24619..24624))
                     /locus_tag="BT0026"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:133448"
     misc_feature    complement(order(24178..24180,24187..24189,24292..24294,
                     24298..24300,24343..24345,24352..24354,24358..24360,
                     24415..24420,24490..24495,24568..24570))
                     /locus_tag="BT0026"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:133448"
     misc_feature    complement(order(24175..24177,24196..24201))
                     /locus_tag="BT0026"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133448"
     gene            25147..25782
                     /locus_tag="BT0027"
                     /db_xref="GeneID:4642566"
     CDS             25147..25782
                     /locus_tag="BT0027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945042.1"
                     /db_xref="GI:119952833"
                     /db_xref="GeneID:4642566"
                     /translation="MKKNFLVGLTLLFLLHANVNRIEAYSIDRNGNSIIEVDLSLGIP
                     LFYHSLSKVFSSNLYPGGIGALKYKYHILSNLAIGFELRYMFNFDINHSFNLLNPDSG
                     IGKTFSTVPITFLTAYVFDIGEIFQIPIFSNIGFSLSSYGDKSDNISNLRTFDAMPVM
                     SIGSGILWNFNYQWALGITTAWWTMFELGNMAKIGHFLLISLSVIVNINKL"
     gene            25789..26820
                     /locus_tag="BT0028"
                     /db_xref="GeneID:4642646"
     CDS             25789..26820
                     /locus_tag="BT0028"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945043.1"
                     /db_xref="GI:119952834"
                     /db_xref="GeneID:4642646"
                     /translation="MDKKGYKKFMIIILIMLVLSCSSESIFSQLSKLQKINSNNNILD
                     TSSPSGISLVNDTLYVAAMHLFKKSNGNVERVNFSNSYEFVIDLVNISGKTYLLVQNK
                     NGQLELYSLESNNWKLLFQKNLIPIKFLKSIGTSGITSAFILALGENGNQTILDTNGN
                     NQTPNSTTNNDKFYQISNDQQSITGKSAKIWKLKGGGVINVKSTNEIMAIIETSIRGS
                     KETLVFTGRNHDTSDHKFKIYSSTNNYQDPIFNRDGIGEFIAYFAREVDGIILIGSNN
                     GFVELVRDKNTFDLQPPSQSVLPGSYNGSQLSKTRLNDIIPTSNKTIYILTQGKGLWK
                     IENKKLIKE"
     gene            complement(26806..27237)
                     /locus_tag="BT0029"
                     /db_xref="GeneID:4642650"
     CDS             complement(26806..27237)
                     /locus_tag="BT0029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical cytosolic protein"
                     /protein_id="YP_945044.1"
                     /db_xref="GI:119952835"
                     /db_xref="GeneID:4642650"
                     /translation="MLNKIFVDADSCNLQVIKFLQNFVSNRNVRLILVANRHLNLEMS
                     KNTSVKIARDVDSLILELIDKNSMVVTRDILFVKNLLNLQIKVMNDEGQIFDTNNINY
                     LYFRSKLNINLGIKVKKYFHEETNKVRYSNFAMNFYRLFFN"
     misc_feature    complement(26812..27228)
                     /locus_tag="BT0029"
                     /note="Uncharacterized BCR, YaiI/YqxD family COG1671;
                     Region: DUF188; cl00727"
                     /db_xref="CDD:260591"
     gene            complement(27227..27862)
                     /locus_tag="BT0030"
                     /db_xref="GeneID:4642854"
     CDS             complement(27227..27862)
                     /locus_tag="BT0030"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="YP_945045.1"
                     /db_xref="GI:119952836"
                     /db_xref="GeneID:4642854"
                     /translation="MAAYLTFEQRLLRKKRRQNFLKIILLFLVLNYFFTKFVLQIFIF
                     QGDEMLPLITKNDSLIFISKYMRSFFVPLKVNDVVLYEDSNLRRNFILNFFRDLFFLN
                     KIFNTRSYKIAKIVATQGDLVYVKGFDILVHRRDDNSYYLNGNFMSGYRLNDFFNFNE
                     VIRCFALKKNEFFLLNENLKILNDSRVFGPVEQSHILSFLVLRIMDYKFVK"
     misc_feature    complement(27272..27805)
                     /locus_tag="BT0030"
                     /note="signal peptidase I, bacterial type; Region:
                     sigpep_I_bact; TIGR02227"
                     /db_xref="CDD:233790"
     gene            complement(27865..28845)
                     /locus_tag="BT0031"
                     /db_xref="GeneID:4642203"
     CDS             complement(27865..28845)
                     /locus_tag="BT0031"
                     /EC_number="3.4.21.89"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="YP_945046.1"
                     /db_xref="GI:119952837"
                     /db_xref="GeneID:4642203"
                     /translation="MYLEKLDKFANFLVKIIEKYLTYRKKRKYFYKLKAKRRGFMLNF
                     LLELLGASIFVLGINQYFLQAYRIPSGSMENTLQIGDLLFVDKFSYGPELLPGVCKIN
                     GVKEPNEAEIVIFENVEYESKGLFFDILHRLLYMLSFSFVDLDRDENGNPSVRFLVKR
                     ALFADGKLVRFRNGTVFVRKEGEESFIEENSYKASLGYNFGIKKVIEDVDYKVYDNLA
                     MFIALNQLSVDLENISDFSFFNVREVDRFEIERLEYRYLVAFMPYVDYYMEKAIMRDY
                     GIYVPYGYVLPIGDNRDNSYDGRFFGVINKSKILGRAFFMYFPFSRIGLI"
     misc_feature    complement(27883..28716)
                     /locus_tag="BT0031"
                     /note="signal peptidase I, bacterial type; Region:
                     sigpep_I_bact; TIGR02227"
                     /db_xref="CDD:233790"
     misc_feature    complement(<28447..28656)
                     /locus_tag="BT0031"
                     /note="The S26 Type I signal peptidase (SPase; LepB;
                     leader peptidase B; leader peptidase I; EC 3.4.21.89)
                     family members are essential membrane-bound serine
                     proteases that function to cleave the amino-terminal
                     signal peptide extension from proteins that are...;
                     Region: S26_SPase_I; cd06530"
                     /db_xref="CDD:119398"
     misc_feature    complement(order(28453..28455,28630..28632))
                     /locus_tag="BT0031"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119398"
     misc_feature    complement(27907..>27981)
                     /locus_tag="BT0031"
                     /note="The S26 Type I signal peptidase (SPase; LepB;
                     leader peptidase B; leader peptidase I; EC 3.4.21.89)
                     family members are essential membrane-bound serine
                     proteases that function to cleave the amino-terminal
                     signal peptide extension from proteins that are...;
                     Region: S26_SPase_I; cd06530"
                     /db_xref="CDD:119398"
     gene            29037..30506
                     /locus_tag="BT0032"
                     /db_xref="GeneID:4642196"
     CDS             29037..30506
                     /locus_tag="BT0032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945047.1"
                     /db_xref="GI:119952838"
                     /db_xref="GeneID:4642196"
                     /translation="MLKENDRLDINEELLTVKLKPILGITPKIYVFFTIIILPLILVF
                     SLIINTKLNNPGAYLKIKTNVNNAHVYLDEKYIGRTPLKKYINTTKGTLKIQRLGFET
                     YEKKIDIQNKFFTSYQFNIDLRLKNPDKIIAQRQKELSVMTKIKNNNDNIQLIPVFSL
                     IVNDLPNSPEHIKKFFKTSIPHIHSNTMFKDFLIAYKDMYSINNNNSKEIWKSLQQNF
                     NLENRTIIWFFENLDKEQQKQISNETWFKTLIEKLKNENKILNFETKNINLHLKDFKK
                     IAPQNIESTQNYKLYSQNLTLKTTYKLKEFLIQNRNVTKTEYQKFLNENPKWTLNNKD
                     NLIKEELVDESYLKTFKQMPSNEDITHISYHAATEYAKWYSSNLPKGFKARLPISQEW
                     EVYQKEVPKAIESLNTNEISKKVGFWNLMQNPNINDSILFQDENDIYYAHSNFNSLIT
                     EIRTYNYNNNSTLKPSTQASFLKHWCSPNIGFRLVIEKE"
     misc_feature    29205..29417
                     /locus_tag="BT0032"
                     /note="PEGA domain; Region: PEGA; pfam08308"
                     /db_xref="CDD:116891"
     misc_feature    29931..>30218
                     /locus_tag="BT0032"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; cl19582"
                     /db_xref="CDD:267935"
     gene            30509..30958
                     /gene="smpB"
                     /locus_tag="BT0033"
                     /db_xref="GeneID:4642175"
     CDS             30509..30958
                     /gene="smpB"
                     /locus_tag="BT0033"
                     /note="binds to ssrA RNA (tmRNA) and is required for its
                     successful binding to ribosomes; also appears to function
                     in the trans-translation step by promoting accommodation
                     of tmRNA into the ribosomal A site; SmpB protects the
                     tmRNA from RNase R degradation in Caulobacter crescentus;
                     both the tmRNA and SmpB are regulated in cell
                     cycle-dependent manner; functions in release of stalled
                     ribosomes from damaged mRNAs and targeting proteins for
                     degradation"
                     /codon_start=1
                     /transl_table=11
                     /product="SsrA-binding protein"
                     /protein_id="YP_945048.1"
                     /db_xref="GI:119952839"
                     /db_xref="GeneID:4642175"
                     /translation="MSILLLENKKARFNYFIEDKINCGIILKGTEVKSIKLKKFSFND
                     SFASIKKDEVWLENLHIAKYKEGNIFNHEEIRRRKLLLTKKEIQKLKKFKEKEGYTLV
                     PISIYLKNSLIKVELGVCKGKKLFDKREVLKQKSIKKDLNREIKQYR"
     misc_feature    30530..30877
                     /gene="smpB"
                     /locus_tag="BT0033"
                     /note="Small protein B (SmpB) is a component of the
                     trans-translation system in prokaryotes for releasing
                     stalled ribosome from damaged messenger RNAs; Region:
                     SmpB; cd09294"
                     /db_xref="CDD:187755"
     misc_feature    order(30572..30589,30593..30598,30602..30607,30614..30616,
                     30665..30667,30749..30766,30848..30850)
                     /gene="smpB"
                     /locus_tag="BT0033"
                     /note="SmpB-tmRNA interface; other site"
                     /db_xref="CDD:187755"
     gene            complement(31174..31698)
                     /locus_tag="BT0034"
                     /db_xref="GeneID:4642170"
     CDS             complement(31174..31698)
                     /locus_tag="BT0034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945049.1"
                     /db_xref="GI:119952840"
                     /db_xref="GeneID:4642170"
                     /translation="MKKILILMLVFFCAFVSFAQNHDELVGSGGNVEKMLLYETYKKD
                     AVVPCLLNLFVGFGIGSLVQGDITGGLLSLGFDVVSIGLLSYGTYSIIESHYEKKEKP
                     TVLALSLAAVGGATLVLTRIIEAVLPFTYASSYNRKLQENLGITLGGLQPEVDMNFNE
                     DARLMLEVSFTKRY"
     misc_feature    complement(31177..31599)
                     /locus_tag="BT0034"
                     /note="Borrelia membrane protein P13; Region:
                     Borrelia_P13; pfam05628"
                     /db_xref="CDD:253288"
     gene            complement(31829..33715)
                     /locus_tag="BT0035"
                     /db_xref="GeneID:4642741"
     CDS             complement(31829..33715)
                     /locus_tag="BT0035"
                     /EC_number="5.99.1.-"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="YP_945050.1"
                     /db_xref="GI:119952841"
                     /db_xref="GeneID:4642741"
                     /translation="MDIKTLLKDNFLQYSSYVIKDRAIASVIDGFKPVQRRIIHSLFE
                     MNDGNFHKVANVVGNTMKYHPHGDTSIYEALVNMANKDLFIEKQGNFGNLLTGDPASA
                     SRYIECRLTPLAFEVLYSKEITSYEPSYDGRNDEPLIFPAKIPVILVQGSEGIAVGMA
                     AKILPHNFNEILSAVKSELLGESYELYPDFPTGGIVDVNEYADGNGKVLVRARIEPTD
                     DNKAILIKELPFGETTESLIASIERAIRKNYIKVSSINDFTTENVEIELTLPRGVYAS
                     EVIEKLYHYTNCQVSISVNLLLLSDRYPVIYTVTDIIKFHAEHLQKILKMELELERNK
                     ILEKIFSKTLEQMFIEKKIYKILETISKESDVVNIVLSEILKYKDSFLYRDIVLDDIE
                     NLLKIPIRKISMFDIDKNNKDIRNLSKELKSVESNIKSIRGFSINFIDTLLEKYSKVY
                     RRKTEISLIKSKNVKEIATKNMKVYLNLKAGFVGTSLIDGEFIGNASYYDKILIFKKN
                     SYVLKNIEDKTFIDKNNVNVLVYDINNSKDQVFSIIYLNKADNFYYVKRFKIDKFITD
                     KIYEFLNDGDEFIDFALNPEFVEFSTSKDIVRMISIDDFMIKSRISVGKRISSSIIKK
                     VKFK"
     misc_feature    complement(31832..33715)
                     /locus_tag="BT0035"
                     /note="DNA topoisomerase IV subunit A; Provisional;
                     Region: PRK09631"
                     /db_xref="CDD:236598"
     misc_feature    complement(32426..33655)
                     /locus_tag="BT0035"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    complement(order(33296..33298,33305..33361,33362..33370,
                     33374..33427,33431..33433,33437..33478,33479..33532,
                     33533..33571,33578..33655))
                     /locus_tag="BT0035"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    complement(33401..33403)
                     /locus_tag="BT0035"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    complement(order(32492..32542,32609..32614,32636..32647,
                     32660..32668))
                     /locus_tag="BT0035"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     gene            complement(33715..35511)
                     /locus_tag="BT0036"
                     /db_xref="GeneID:4642724"
     CDS             complement(33715..35511)
                     /locus_tag="BT0036"
                     /EC_number="5.99.1.3"
                     /note="decatenates newly replicated chromosomal DNA and
                     relaxes positive and negative DNA supercoiling"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="YP_945051.1"
                     /db_xref="GI:119952842"
                     /db_xref="GeneID:4642724"
                     /translation="MNTNSYDESKIVTLSSLEHIRLRSGMYIGRLGDGSNIDDGIYIL
                     VKEIIDNSIDEFIMGHGKEILIKKENNIISVRDYGRGIPLGKVVESVSVINTGAKYND
                     DVFQFSVGLNGVGTKAVNALSSNFLVRSIRDGNFFEAIFSKGNLINTIEGKSNEQNGT
                     YIEFLADTEIFGKYKYSEDFLRRRFFHYACLNKGLKINYNDQIFQSDNGLLDFINAEI
                     KGEDLLYDFVYYSSKTLEFAFSHTNNYGETYFSFVNGQYTSDGGTHQTGFREGFARAI
                     NDFLKKTYSSTDIREGLIATLSVKIKDPIFESQTKNKLGNIETRSSVAKEVQRIILEI
                     LYKDKTLAKAIENKVVDNERLRKELSSVRKEAKERAKKISFKIPKLKDCKFHFNEKSM
                     HSDSTMIFLTEGDSATGSMVSCRDVYTQAIFSLRGKPQNMFEKNKSEIYKNEELYNMM
                     VALGIEESIENLRYNKIVIATDADFDGFHIRNLLLTFFLTYFEDLVLNGHMYILETPL
                     FRVRNKSSTIYCYFEEEKQKAVRELKNPEVTRFKGLGEISPSEFRSFIDVSNIRLTKV
                     DLVNIKEIKEHLGFYMGPNTPERRNFIMENLI"
     misc_feature    complement(33721..35511)
                     /locus_tag="BT0036"
                     /note="DNA topoisomerase IV subunit B; Reviewed; Region:
                     PRK05559"
                     /db_xref="CDD:235501"
     misc_feature    complement(<35143..35391)
                     /locus_tag="BT0036"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(35164..35175,35266..35271,35275..35277,
                     35281..35283,35287..35289,35350..35352,35359..35361,
                     35371..35373))
                     /locus_tag="BT0036"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(35359..35361)
                     /locus_tag="BT0036"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(35167..35169,35173..35175,35269..35271,
                     35275..35277))
                     /locus_tag="BT0036"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(34417..34890)
                     /locus_tag="BT0036"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    complement(34750..34752)
                     /locus_tag="BT0036"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(34423..34425,34435..34437,34447..34452,
                     34585..34587,34591..34596,34603..34605))
                     /locus_tag="BT0036"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(34579..34581,34585..34587))
                     /locus_tag="BT0036"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(33994..34323)
                     /locus_tag="BT0036"
                     /note="TOPRIM_TopoIIA_like: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to Saccharomyces cerevisiae Topoisomerase II.
                     TopoIIA enzymes cut both strands...; Region:
                     TOPRIM_TopoIIA_like; cd01030"
                     /db_xref="CDD:173780"
     misc_feature    complement(order(34084..34086,34090..34092,34096..34098,
                     34291..34293,34300..34305))
                     /locus_tag="BT0036"
                     /note="active site"
                     /db_xref="CDD:173780"
     misc_feature    complement(order(34096..34098,34303..34305))
                     /locus_tag="BT0036"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173780"
     misc_feature    complement(33730..33912)
                     /locus_tag="BT0036"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            complement(35498..36271)
                     /locus_tag="BT0037"
                     /db_xref="GeneID:4642712"
     CDS             complement(35498..36271)
                     /locus_tag="BT0037"
                     /EC_number="2.3.1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_945052.1"
                     /db_xref="GI:119952843"
                     /db_xref="GeneID:4642712"
                     /translation="MKILRSIVTYINFFFFVLVFTVLFPVFLIFKIFRFENYFIKFSF
                     ILVRFAIKISLWFAGIKVIVTKDDDCSLPEDGVVIMANHIASMDPLFLIYVFMKPFVI
                     VAKKSLLKIPLINFLLISMGSIFINRNSIKSSAITQRKAAKVIQEGGAIGIFPEGTRN
                     RGGSTRDFKRGSVNLALRTNSSIIPVTLFNTHKVFVKNLILNSGLSIYVHVHSLIDVS
                     NLTDDDKAQLHIIVRDKIIKKLEKMKIQYNVDRNLNEYK"
     misc_feature    complement(35594..36121)
                     /locus_tag="BT0037"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    complement(order(35795..35803,35951..35962,36008..36010,
                     36014..36016,36023..36025))
                     /locus_tag="BT0037"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            complement(36277..37728)
                     /locus_tag="BT0038"
                     /db_xref="GeneID:4642705"
     CDS             complement(36277..37728)
                     /locus_tag="BT0038"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945053.1"
                     /db_xref="GI:119952844"
                     /db_xref="GeneID:4642705"
                     /translation="MCFKKWIIFLFVTLFSCVKGSKDFIVFNKEMKKISEISYSDTGL
                     SGDTGEDVFGSLIDLKGYKILSVHQENLNLDVYFEQVVLAQNFADLKTYLFIIGFDPK
                     SHEAVVLFKTQVNIDSKNSYNMYLEDITGDYNFDIVIQGFLDEDSVLYIFQRAVANDV
                     ASYRPIFFDKVNGSIIINKYDRSSAYDDKKSRESYSISLERYEKQGEDMIVSKIEKYE
                     YSQLQGKYYPLSASEKVRRIDNDVYQTLKNLPKEEVYKFLYGVWYDSNAHQRLRKSNF
                     EDALFLSFNRHLNEISIFKNNAQEIAHIEYISRPAYNTLNISTKSIFSDLIVYNFWIK
                     IIDIDNIEIKIDTGTDAYDKYGFSGVFKRFNDSVLVEDDKDSLFIPNGNYVCKDIIYD
                     FSYPNLTYIVGDNIYYGIFNVFSLNNNLVLEYEISMDENKISEAFIIEYSERIVQKQK
                     FSTILLNPIKILKDEVSLVKGQKLKLERIEKLG"
     gene            complement(37793..39286)
                     /locus_tag="BT0039"
                     /db_xref="GeneID:4642668"
     CDS             complement(37793..39286)
                     /locus_tag="BT0039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945054.1"
                     /db_xref="GI:119952845"
                     /db_xref="GeneID:4642668"
                     /translation="MRKRVNQAKEVISKVDFNDKKVGTWGLLALIVIVFGFIIAPLMP
                     GLFDTTDSSSLKFGSYKGQPVYYEKDNKFAQYVKSYSNFYSKLKKNNSLDIEYFIWNL
                     AFMKYVEDIAFIDLAKTNSFYVSKNILNKNLMNSPVYLDSSGNFSPKRYNKVSDYQKF
                     KIHNETVDNLLSSNIQVLLSSSFILPDSLLNAIKSMNEIRRNIVYVSLSYQDFPKDKV
                     ISYADQNQKLFKSLDIVSIRFKNLSDAGGAYEKLSKGMPFEEVAKFYSEDVTNFKGIA
                     SSKKYYFDLDLVLEKKEDLAAIFSLKMNEFTSPIKSKNGNGYDIYKALSNIGDFDKNS
                     EHDISSVRNYIETYEPSVIETFLEKKLNDILTEVNFDGPQQVFKKHNLVLKKDVVNLA
                     YNMNIYPSTLRELSVFSNSKDFYDVIFDLKEGQWSKPFLADQRVYLFSFSSSVNDSVN
                     SDNLIKEDRMLDILYQANNKLVLDYILNKNNFKENFNEAFFSLQDFS"
     misc_feature    complement(38126..>38728)
                     /locus_tag="BT0039"
                     /note="peptidylprolyl isomerase; Reviewed; Region: prsA;
                     PRK03095"
                     /db_xref="CDD:179537"
     misc_feature    complement(38321..>38545)
                     /locus_tag="BT0039"
                     /note="PPIC-type PPIASE domain; Region: Rotamase_2;
                     cl08278"
                     /db_xref="CDD:263564"
     gene            39488..40327
                     /locus_tag="BT0040"
                     /db_xref="GeneID:4642664"
     CDS             39488..40327
                     /locus_tag="BT0040"
                     /EC_number="2.1.1.80"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein methyltransferase"
                     /protein_id="YP_945055.1"
                     /db_xref="GI:119952846"
                     /db_xref="GeneID:4642664"
                     /translation="MNNEFNIKINQEEFNRLTKIIYNNFGINLNDKKKLLIESRLSST
                     IRAKNLSNFTEYINYLEKQNNQISLIELVDKISTNHTYFFREPNHFEFLEKKLLPKML
                     KQMAQSREEEIRIWSAGCSSGEEPYTIAMILNEYINNNKIHCKAKILATDISITVLNE
                     AKMGIYSEDRVKTLPNHLKIKYLNKITNDKFEVKDILKKMIQFKKLNLMNAIFPFKKK
                     FDLIFCRNVMIYFDEKTRNKLAEKFTQHLKDDSYLLIGHSEAIRDSKNLEYIMPATYK
                     KIN"
     misc_feature    39518..40318
                     /locus_tag="BT0040"
                     /note="Methyltransferase, chemotaxis proteins; Region:
                     MeTrc; smart00138"
                     /db_xref="CDD:214534"
     misc_feature    39518..39673
                     /locus_tag="BT0040"
                     /note="CheR methyltransferase, all-alpha domain; Region:
                     CheR_N; pfam03705"
                     /db_xref="CDD:202731"
     misc_feature    39722..40321
                     /locus_tag="BT0040"
                     /note="CheR methyltransferase, SAM binding domain; Region:
                     CheR; pfam01739"
                     /db_xref="CDD:250828"
     gene            complement(40375..41046)
                     /locus_tag="BT0042"
                     /db_xref="GeneID:4642619"
     CDS             complement(40375..41046)
                     /locus_tag="BT0042"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system protein PhoU-like"
                     /protein_id="YP_945056.1"
                     /db_xref="GI:119952847"
                     /db_xref="GeneID:4642619"
                     /translation="MIRRRLTKQLEVIKDYLWDMKECVLKIIENSLIALESRDKNLAK
                     KIINEDEKMIDDYQYDIEDLCGRIIATEHPVATELREILAIIKIISSLERIADHSTKI
                     VKVVLLLESNVGDFSSVDIYQKPLREMADTAKDMLANIFDAYFDGDFVKILKIVKYDN
                     IIDKLFSKQKTIVIDAMKNNPENLDYLLNILFLNSFLERVGDHVATIGELLYFVKVGE
                     KVNLT"
     misc_feature    complement(40387..41037)
                     /locus_tag="BT0042"
                     /note="phosphate transport system regulatory protein PhoU;
                     Region: phoU_full; TIGR02135"
                     /db_xref="CDD:233742"
     misc_feature    complement(40729..40998)
                     /locus_tag="BT0042"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     misc_feature    complement(40414..40671)
                     /locus_tag="BT0042"
                     /note="PhoU domain; Region: PhoU; pfam01895"
                     /db_xref="CDD:250948"
     gene            complement(41058..42083)
                     /locus_tag="BT0043"
                     /db_xref="GeneID:4642604"
     CDS             complement(41058..42083)
                     /locus_tag="BT0043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945057.1"
                     /db_xref="GI:119952848"
                     /db_xref="GeneID:4642604"
                     /translation="MSKECFIYFNFLFFIINIIPSLAFENRYSTYELDFSSEKQEFLV
                     NTNSKFNFFFKDSTWIYIKNVKNNAFIRLVSESYQNGAMFTFQTSKNIGIIILTFKYQ
                     NVKDSREFTKNVILKIAKREESSNLNEMNPKGNLSLDKFIKTDKSNNNLSLRDIMKRA
                     LNLSYINDYKGAIALLNKYDFDDNEYTLLKAELYYKSGDYLNSYLNYLSLRDVYFNKI
                     FLNLIDLGIKLSKVENVLRDVRFLVENNIDFSENTYLDILEFLLMNGEYEFFLNLSLL
                     YYPKYLNSRFPDRYNYLLGKLYETESKYKDFIKSLSYYKRVIDSYPFSSYYELSKLRF
                     LFLKRFF"
     gene            complement(42080..42466)
                     /locus_tag="BT0044"
                     /db_xref="GeneID:4642600"
     CDS             complement(42080..42466)
                     /locus_tag="BT0044"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945058.1"
                     /db_xref="GI:119952849"
                     /db_xref="GeneID:4642600"
                     /translation="MREKKFRFQKYFLILILLSIIVSFFTYFYSYRMIEKTRSNTEEH
                     LNQKLKLLNIEDFYFDLNSSLNMDDFFFPKPNLPDGKLGDSVMHHQSISEELLKSLWV
                     KSDNLFNIDLEKENESLVDKILENYK"
     gene            complement(42494..44959)
                     /locus_tag="BT0045"
                     /db_xref="GeneID:4642574"
     CDS             complement(42494..44959)
                     /locus_tag="BT0045"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partition protein Smc"
                     /protein_id="YP_945059.1"
                     /db_xref="GI:119952850"
                     /db_xref="GeneID:4642574"
                     /translation="MGVALFLEKIGLLGFKSFVKMQELKLNSSLNFIVGPNGCGKSNL
                     LDAIRFCIGEDNLSVLRVKYITDLISDVKSGESNFAEVTLFFNNEDLSVSDFRDRFYI
                     RRRLYKDGTSEYFLNNDTLNLKSYESLINKLRLKNSPYMFINQGKIEKISSSGSINLK
                     SLIEEASGIDMLRVEEEQAYKRLEKSKENLNSLWTLRDELNEKYEKIKNDFFLKGKYQ
                     KLKMDLEILEKNLRLKKLFNINFELNELKSKLDIKDIDKILSLNSFSIESVKEKLEFY
                     SFREKNVIKNIEVIKKEIETLKSKLLEIEIKIQKLEHDRKGKLNLADIFMSNKVQIES
                     VKVGINEELVDLNNSLQSKKKDFFTVTDEINRYTRSFFELVDLVLSISKESNIEEFEL
                     LKKNILNSLKYFEDTLSIKYIKEIRENLLKYIVKEDKLLNLLKEKIEPIFEQNVDLRK
                     FLLAKNNSKTSLAKEITTIEGLVSNKTAKLNEILGEIEYTELSRLKNEDEIKLIDSNL
                     RFLFETRDELRERLNNLNLKLDELSLERSDINVNLDKFLSEAKGSELVASNEINSLNL
                     LDAFKNSSYYEYMKKQAEYDILFNSSLDIADEIKDFNLVNKNLEKFEFTEDMAKIGAL
                     QKEINMIEHNNYIFFNVEREYNEIKEKVERISSQIDDLNSTKESLNKLRKKIKREIDK
                     RFNDAFNEINNHFVYFFNRMFTGNGSLFYGKDSGEIEIKIDFKDKLAKGNKMLSGGEH
                     SLISIAFLFALYYYSPASFCVLDEIDASLDFENSNKLSVLLKELGQRVQLFIITHNMY
                     VAQGSKNLIGVTSDNGESVIFNI"
     misc_feature    complement(42497..44947)
                     /locus_tag="BT0045"
                     /note="Chromosome segregation ATPases [Cell division and
                     chromosome partitioning]; Region: Smc; COG1196"
                     /db_xref="CDD:224117"
     misc_feature    complement(<44690..44941)
                     /locus_tag="BT0045"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(44834..44857)
                     /locus_tag="BT0045"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(44831..44839,44843..44848))
                     /locus_tag="BT0045"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(42512..>42814)
                     /locus_tag="BT0045"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(42728..42757)
                     /locus_tag="BT0045"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(42668..42685)
                     /locus_tag="BT0045"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(42650..42661)
                     /locus_tag="BT0045"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(42569..42589)
                     /locus_tag="BT0045"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            45014..45562
                     /gene="rnhB"
                     /locus_tag="BT0046"
                     /db_xref="GeneID:4642562"
     CDS             45014..45562
                     /gene="rnhB"
                     /locus_tag="BT0046"
                     /EC_number="3.1.26.4"
                     /note="RNH2; RNase HII; binds manganese; endonuclease
                     which specifically degrades the RNA of RNA-DNA hybrids"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="YP_945060.1"
                     /db_xref="GI:119952851"
                     /db_xref="GeneID:4642562"
                     /translation="MMICGIDEVGRGCIFGPVLSAAVIFKGNPKFLNALDDSKKLNKS
                     KREYLSSLILENSYYAFAEVPNEIIDKINIHHASLLAMQIAYEKLNIECNLVLVDGKF
                     IPKIKAKKIQAIIKGDSIINEIKAASIIAKVQRDKLMDEYDKIYPLYALKKNKGYPTK
                     EHKDAIKKYGISRLHRRSFQLI"
     misc_feature    45023..45550
                     /gene="rnhB"
                     /locus_tag="BT0046"
                     /note="Bacterial Ribonuclease HII-like; Region:
                     RNase_HII_bacteria_HII_like; cd07182"
                     /db_xref="CDD:260003"
     misc_feature    order(45032..45049,45128..45130,45230..45238,45308..45316,
                     45356..45361,45365..45367,45407..45409,45470..45478,
                     45482..45490,45548..45550)
                     /gene="rnhB"
                     /locus_tag="BT0046"
                     /note="RNA/DNA hybrid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:260003"
     misc_feature    order(45032..45037,45308..45310,45365..45367)
                     /gene="rnhB"
                     /locus_tag="BT0046"
                     /note="active site"
                     /db_xref="CDD:260003"
     gene            complement(45571..45945)
                     /locus_tag="BT0047"
                     /db_xref="GeneID:4642531"
     CDS             complement(45571..45945)
                     /locus_tag="BT0047"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945061.1"
                     /db_xref="GI:119952852"
                     /db_xref="GeneID:4642531"
                     /translation="MEDLMGERGEVYSDKLFTNSDRTYFFNVKENRKGDYFLNIVESK
                     RNVNGDFERHSVFVYEENIEEFESNLLRAISVVKKKISKNSVTRGDYHNDFDRHRERS
                     KNGNLSFDRNYRFSDKSRDENN"
     misc_feature    complement(45589..45945)
                     /locus_tag="BT0047"
                     /note="Protein of unknown function (DUF3276); Region:
                     DUF3276; pfam11680"
                     /db_xref="CDD:256547"
     gene            46089..46161
                     /locus_tag="BTT0001"
                     /db_xref="GeneID:4642456"
     tRNA            46089..46161
                     /locus_tag="BTT0001"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:4642456"
     gene            46726..47412
                     /locus_tag="BT0050"
                     /db_xref="GeneID:4642520"
     CDS             46726..47412
                     /locus_tag="BT0050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane associated protein"
                     /protein_id="YP_945062.1"
                     /db_xref="GI:119952853"
                     /db_xref="GeneID:4642520"
                     /translation="MNNEILWFIMLICTYSSLIIIYKLFGKKGLFAWVTSSVIIANIQ
                     VLKQITIFGFNATLGNIIYASSYVATDILSEFYGRKISKKAVYIGFISFIAFAFITNI
                     QLYFSTSSSDIYLKSLESIFSSIPILLVASIIAYIISQLNDIYLYQFIKDKFPKFLFI
                     RSNGSTLVSELIDTIIFVSIATYFNIFPKEAYLDIVISTYFIKGFAGILGTPFIYIAK
                     CVYQNKKNSI"
     misc_feature    46798..47397
                     /locus_tag="BT0050"
                     /note="Uncharacterized ACR, YhhQ family COG1738; Region:
                     DUF165; cl00756"
                     /db_xref="CDD:260608"
     gene            47464..48147
                     /locus_tag="BT0051"
                     /db_xref="GeneID:4642504"
     CDS             47464..48147
                     /locus_tag="BT0051"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_945063.1"
                     /db_xref="GI:119952854"
                     /db_xref="GeneID:4642504"
                     /translation="MMDMILWMTLLVFVYLQLTLLYYLFGKSGLFCFNIIMTILSNLI
                     ILKKVFIFEQQISLAGIIFLSILCSLNLITEKYNDKLAIESTTLNMFIHITFVIMIHF
                     TLYFQQNEFDTSNIHLKVLFNNASYTAIIFTGTYIIYLCNYVNIKIYSILQKNNISNK
                     LINHNLSRLCSACIAYILANISMHVIAQLYPGNNINMVESSWIFTITIMIIDTFIYYF
                     LNALKVRKA"
     misc_feature    47467..48141
                     /locus_tag="BT0051"
                     /note="Uncharacterized ACR, YhhQ family COG1738; Region:
                     DUF165; cl00756"
                     /db_xref="CDD:260608"
     gene            complement(48134..48832)
                     /locus_tag="BT0052"
                     /db_xref="GeneID:4642131"
     CDS             complement(48134..48832)
                     /locus_tag="BT0052"
                     /EC_number="2.1.1.34"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanosine-2'-O-)-methyltransferase"
                     /protein_id="YP_945064.1"
                     /db_xref="GI:119952855"
                     /db_xref="GeneID:4642131"
                     /translation="MNWILLFFYIKLYFVSNEILKRIEILSEFITQRRRERIDEVLSN
                     RTNYLTLVLEDIFQPQNASATMRTIEILGLSNIHIIETNNTYTLNPGVVLGASKWIDI
                     IKYQCVESAFDNLKGNGYKIVATSLDNEAIFLDDFPIDDKMAIFFGTELTGLSNTVLE
                     NADLHLKIPMYGFTQSYNLSVAVSIVFYSLISRLRKSSIKYLLNEDEKLVLKLDYYRK
                     IVKKYQTIEKLKLF"
     misc_feature    complement(48245..>48805)
                     /locus_tag="BT0052"
                     /note="rRNA methylases [Translation, ribosomal structure
                     and biogenesis]; Region: SpoU; COG0566"
                     /db_xref="CDD:223640"
     misc_feature    complement(48269..48688)
                     /locus_tag="BT0052"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:249983"
     gene            48870..49541
                     /locus_tag="BT0053"
                     /db_xref="GeneID:4642118"
     CDS             48870..49541
                     /locus_tag="BT0053"
                     /EC_number="3.2.2.-"
                     /note="Excises uracil residues from the DNA which can
                     arise as a result of misincorporation of dUMP residues by
                     DNA polymerase or due to deamination of cytosine"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="YP_945065.1"
                     /db_xref="GI:119952856"
                     /db_xref="GeneID:4642118"
                     /translation="MEVKIEESWKEMLKGEFCKSYFKRLVNFIKNEYKTKKDKIFPSP
                     KLIFNAFDSLPFKDIKIVILGQDPYHGKGQANGLAFSVNSDIKIPPSLQNIFKEIERS
                     LKIKTIPNGDLTRWATQGVFLLNSILTVEEGRPSSHKDIGWEIFTNEVIKIISKNLNN
                     VVFMLWGNFARGKKELIDASKHLILETSHPSPYSAHNGFLGSNHFSQTLKYLKEHNKI
                     SIDFQ"
     misc_feature    48930..49532
                     /locus_tag="BT0053"
                     /note="Family 1 of Uracil-DNA glycosylase (UDG) enzymes;
                     Region: UDG_F1; cd10027"
                     /db_xref="CDD:198425"
     misc_feature    order(49062..49076,49104..49109,49140..49142,49242..49244,
                     49434..49436)
                     /locus_tag="BT0053"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    order(49065..49070,49074..49079,49134..49142,49368..49373,
                     49431..49436,49440..49451)
                     /locus_tag="BT0053"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    order(49065..49067,49074..49082,49134..49142,49269..49274,
                     49368..49373,49434..49436,49440..49448)
                     /locus_tag="BT0053"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    order(49068..49070,49434..49436)
                     /locus_tag="BT0053"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            complement(49605..49967)
                     /gene="secG"
                     /locus_tag="BT0054"
                     /db_xref="GeneID:4642500"
     CDS             complement(49605..49967)
                     /gene="secG"
                     /locus_tag="BT0054"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="YP_945066.1"
                     /db_xref="GI:119952857"
                     /db_xref="GeneID:4642500"
                     /translation="MELFRLLIFVFFIITSFMIVLLVLFQDEQGDSIGGVFGGGSSSI
                     FGAKSSNIAIRITAFFITLFFIFVIALSFINTRRVDNSLLKDVKTNEKSSTFWNDDTN
                     QNEENEDVVNEDTLKKEK"
     misc_feature    complement(49734..49949)
                     /gene="secG"
                     /locus_tag="BT0054"
                     /note="Preprotein translocase subunit SecG [Intracellular
                     trafficking and secretion]; Region: SecG; COG1314"
                     /db_xref="CDD:224233"
     gene            complement(49979..50743)
                     /gene="tpiA"
                     /locus_tag="BT0055"
                     /db_xref="GeneID:4642838"
     CDS             complement(49979..50743)
                     /gene="tpiA"
                     /locus_tag="BT0055"
                     /EC_number="5.3.1.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="YP_945067.1"
                     /db_xref="GI:119952858"
                     /db_xref="GeneID:4642838"
                     /translation="MRKIFLAGNWKMHYTSMEAAGVAKQIVDGVKNIKDDVVVMITPP
                     FTSLCKVCEVTRGSNVLLGAQNMSYEDSGARTSEISPSMLLEFGVDYVILGHSECRTY
                     LGDTDEVVNKKVLAGLKHPFKYLILCIGETLEERENNKTLDVVLNQIRKGLISVSESD
                     LKRIILAYEPVWAIGTGKTATKEEAQEVHRAIRHEVELLYSVSAANNIIIQYGGSVNI
                     DNVKGLMGESDIDGALIGGASLKADSFLNIVNKVAK"
     misc_feature    complement(49994..50731)
                     /gene="tpiA"
                     /locus_tag="BT0055"
                     /note="Triosephosphate isomerase (TIM) is a glycolytic
                     enzyme that catalyzes the interconversion of
                     dihydroxyacetone phosphate and
                     D-glyceraldehyde-3-phosphate. The reaction is very
                     efficient and requires neither cofactors nor metal ions.
                     TIM, usually...; Region: TIM; cd00311"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(50033..50038,50042..50044,50099..50101,
                     50219..50221,50237..50239,50456..50458,50711..50713,
                     50717..50719))
                     /gene="tpiA"
                     /locus_tag="BT0055"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(50447..50452,50483..50488,50495..50497,
                     50549..50551,50588..50590,50597..50599,50603..50611,
                     50708..50710,50717..50719))
                     /gene="tpiA"
                     /locus_tag="BT0055"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238190"
     misc_feature    complement(order(50237..50239,50456..50458,50711..50713))
                     /gene="tpiA"
                     /locus_tag="BT0055"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238190"
     gene            complement(50745..51923)
                     /gene="pgk"
                     /locus_tag="BT0056"
                     /db_xref="GeneID:4642886"
     CDS             complement(50745..51923)
                     /gene="pgk"
                     /locus_tag="BT0056"
                     /EC_number="2.7.2.3"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="YP_945068.1"
                     /db_xref="GI:119952859"
                     /db_xref="GeneID:4642886"
                     /translation="MSIKTIKDCDFAGKRALVRCDFNVPLKEGNITDDTRIRAALPTI
                     EYLKSQGARVILMSHLGRPKGEKNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATT
                     VSCMKNGDIVLLENLRFYKEEEENCDAFVRKLSQNGDIFVNDAFGTAHRAHASTAGLA
                     AYLPAVGGFLMEKEDEFLGKILRNPESPFVAIIGGSKVSSKIAVLESLLPKSNVMVIG
                     GGMAYTFLKVEGYSIGQSLLENEYIDVASSFLKKAKELDVKVILPLDHVVASEFREDS
                     IPEYVDSVDIPNDKVGMDIGEKTLRKIEEVLVSAKTVIWNGPLGVFEFNSFSKGTAKV
                     AEYVASCSGITVVGGGDSVAAVNKFNLSEKITHVSTGGGASLEYLEGKVLPGIKVLEK
                     "
     misc_feature    complement(50751..51908)
                     /gene="pgk"
                     /locus_tag="BT0056"
                     /note="Phosphoglycerate kinase (PGK) is a monomeric enzyme
                     which catalyzes the transfer of the high-energy phosphate
                     group of 1,3-bisphosphoglycerate to ADP, forming ATP and
                     3-phosphoglycerate. This reaction represents the first of
                     the two substrate-level...; Region:
                     Phosphoglycerate_kinase; cd00318"
                     /db_xref="CDD:238195"
     misc_feature    complement(order(51570..51572,51747..51749,51816..51818,
                     51855..51857,51861..51863))
                     /gene="pgk"
                     /locus_tag="BT0056"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238195"
     misc_feature    complement(order(50814..50822,51369..51380))
                     /gene="pgk"
                     /locus_tag="BT0056"
                     /note="hinge regions; other site"
                     /db_xref="CDD:238195"
     misc_feature    complement(order(50868..50876,50955..50966,50970..50972,
                     50976..50978,51048..51050,51264..51266))
                     /gene="pgk"
                     /locus_tag="BT0056"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:238195"
     misc_feature    complement(50871..50873)
                     /gene="pgk"
                     /locus_tag="BT0056"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238195"
     gene            complement(51952..52959)
                     /locus_tag="BT0057"
                     /db_xref="GeneID:4642451"
     CDS             complement(51952..52959)
                     /locus_tag="BT0057"
                     /EC_number="1.2.1.12"
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde 3-phosphate dehydrogenase"
                     /protein_id="YP_945069.1"
                     /db_xref="GI:119952860"
                     /db_xref="GeneID:4642451"
                     /translation="MKLAINGFGRIGRNVFKIAFERGIEVIAINDLTDPKTLAHLLKY
                     DSTFGIYNKKVEARDGAIIVDGKEIKIIAERDPKNLPWGKLGVDVVIESTGVFSSATS
                     DRGGYLDHVEHAGAKKVILTVPAKDEIKTIVLGVNDHEITSDLKAVSNASCTTNCLAP
                     LAKVLHETFGIEQGLMTTVHAYTNDQKILDLPHADLRRARAAALSIIPTSTGAAKAVG
                     LVLPELKGKLNGTSMRVPVPTGSIVDFTVQLKKKDVTKEEINSALKKASESRELSGIL
                     GYTEDPIVSSDIKGNSHSSIVDGLETMVLLNGFVKVLSWYDNEFGYSTRVVDLAQKLV
                     K"
     misc_feature    complement(51955..52959)
                     /locus_tag="BT0057"
                     /note="Glyceraldehyde-3-phosphate
                     dehydrogenase/erythrose-4-phosphate dehydrogenase
                     [Carbohydrate transport and metabolism]; Region: GapA;
                     COG0057"
                     /db_xref="CDD:223135"
     misc_feature    complement(52501..52959)
                     /locus_tag="BT0057"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase, NAD
                     binding domain; Region: Gp_dh_N; smart00846"
                     /db_xref="CDD:214851"
     misc_feature    complement(52012..52488)
                     /locus_tag="BT0057"
                     /note="Glyceraldehyde 3-phosphate dehydrogenase,
                     C-terminal domain; Region: Gp_dh_C; pfam02800"
                     /db_xref="CDD:251539"
     gene            complement(53033..55018)
                     /locus_tag="BT0058"
                     /db_xref="GeneID:4642515"
     CDS             complement(53033..55018)
                     /locus_tag="BT0058"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat family protein"
                     /protein_id="YP_945070.1"
                     /db_xref="GI:119952861"
                     /db_xref="GeneID:4642515"
                     /translation="MNLKRFLTMLLIFNLNFGSLIGDTTTAIKYYQKAQTYYLMQKYY
                     DAIDELLEAVKINPNYYEAYKFIAEIYYLLKIYNQAQFFIEKAYKMSNGDTKYKILYA
                     NILLKNNRTAQAKKFYSEVLAKQKNNIDALVGLASIFEEEGLLIAAANYYLSILEYNQ
                     TNYNAFERLMSIYEKLNMNDKAQHLINKVRGNFTSLPDFHKRVAEFSIKTNSLGVAEK
                     YAQNYLMLVRTTYRDFGLVDAYRLLALVYLYQSKYEDATDFLQKAILVDQNSDELYYL
                     LGYSYLKLERVDKAVLNFERAKSMKKDLEFYDIALEESFFVSNFRSSFQKNNGTNIGI
                     SKRYENEGLKAFKNLNLDRAVFNVRNAIDIYPDNDSARFLLAKIYKFMKLDVMAYEEL
                     YYLIEHRKVTDTKILDFYDVVAFDIRSSLFFKYGYKTIGDLNRLYNNQTVYRVGIFTQ
                     NENKVFGANDLILKYAERILDRNLNIEVVNYRFDYNKDKDYLVSSFSEEFSYARNNNL
                     DLFLMFDLDVDVFKNSANLRVDIFSGKTGVKVKTFDYNSGGVLYLSDILSSFSRDFND
                     YLPKKGEILQIKRDDVLINLGHVNDVKKGDVFLVLKEGALKYNSDSSSFMSYSKSDIL
                     GEISIEEIGDYISRGILKAPTLLRDYIQEGYTVFIKK"
     misc_feature    complement(54746..54940)
                     /locus_tag="BT0058"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(54638..54934)
                     /locus_tag="BT0058"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(54695..54700,54707..54712,54719..54724,
                     54800..54805,54812..54817,54821..54826,54911..54916,
                     54923..54928,54932..54934))
                     /locus_tag="BT0058"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(54656..54658,54665..54667,54677..54679,
                     54713..54715,54758..54760,54767..54769,54779..54781,
                     54815..54817,54860..54862,54869..54871,54881..54883,
                     54917..54919))
                     /locus_tag="BT0058"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(54452..54715)
                     /locus_tag="BT0058"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(54452..54454,54461..54463,54473..54475,
                     54509..54511,54554..54556,54563..54565,54575..54577,
                     54611..54613,54656..54658,54665..54667,54677..54679,
                     54713..54715))
                     /locus_tag="BT0058"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(54491..54496,54503..54508,54515..54520,
                     54596..54601,54608..54613,54617..54622,54707..54712))
                     /locus_tag="BT0058"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(55015..55794)
                     /locus_tag="BT0059"
                     /db_xref="GeneID:4642129"
     CDS             complement(55015..55794)
                     /locus_tag="BT0059"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt efflux protein CorC"
                     /protein_id="YP_945071.1"
                     /db_xref="GI:119952862"
                     /db_xref="GeneID:4642129"
                     /translation="MMFKFLSFKNKKIRDDDCKNIEEKSKFETSLLKNFNSLKETIVK
                     EIMIPRISVVFVDYSWSKDEILKVVTSSNHSRFPVYRETIDDIIGIIHTKDILLHMWK
                     RDFYEIDLRDIMRKVMFVPESKKIDSLLKEFQENHVHIAIVVDEYGGVAGLVTLEDIL
                     EEIVGDIQDEFDNELDEIVPLDDGSYLCTARVLIEDLNEKLGLSLPDGDFDTLGGFVY
                     DLFGRIPLKNEKIKYNNLTFTIKNMHQRNIKVIKISQKEGL"
     misc_feature    complement(55315..55668)
                     /locus_tag="BT0059"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    complement(55309..55638)
                     /locus_tag="BT0059"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    complement(55033..55260)
                     /locus_tag="BT0059"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     smart01091"
                     /db_xref="CDD:215020"
     gene            complement(55791..56237)
                     /locus_tag="BT0060"
                     /db_xref="GeneID:4642123"
     CDS             complement(55791..56237)
                     /locus_tag="BT0060"
                     /codon_start=1
                     /transl_table=11
                     /product="putative metalloprotease"
                     /protein_id="YP_945072.1"
                     /db_xref="GI:119952863"
                     /db_xref="GeneID:4642123"
                     /translation="MIKEELNLWAEGVEFKHWDAYYNFILSVLDFLCIKEYELSVILC
                     NNEYIQKLNSQFRQKSEPTDVLSFNYLEESGQIDHKIQGDLIISLEYLEFSSLEFNVE
                     LYDELQRNTIHGILHLIGYTHKTNDFQNEEMLIIQEKVLRETRRVF"
     misc_feature    complement(55809..56213)
                     /locus_tag="BT0060"
                     /note="metal-binding heat shock protein; Provisional;
                     Region: PRK00016"
                     /db_xref="CDD:234575"
     gene            complement(56326..56679)
                     /locus_tag="BT0061"
                     /db_xref="GeneID:4642329"
     CDS             complement(56326..56679)
                     /locus_tag="BT0061"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_945073.1"
                     /db_xref="GI:119952864"
                     /db_xref="GeneID:4642329"
                     /translation="MAISLTKQEFIDKVFDYKNNKEWDFKGKKPAIIDFYADWCGPCK
                     MLAPIYDELSKEYGDRIDFYKVNTDKEQEISMALGVQSLPTIIFVPVGEKPRVSVGFI
                     QKDSFEDAIKDLFKV"
     misc_feature    complement(56344..56604)
                     /locus_tag="BT0061"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    complement(order(56551..56553,56560..56562))
                     /locus_tag="BT0061"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            56753..57475
                     /locus_tag="BT0062"
                     /db_xref="GeneID:4642413"
     CDS             56753..57475
                     /locus_tag="BT0062"
                     /note="in Escherichia coli RsmE methylates the N3 position
                     of the U1498 base in 16S rRNA; cells lacking this function
                     can grow, but are outcompeted by wild-type; SAM-dependent
                     m(3)U1498 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="16S ribosomal RNA methyltransferase RsmE"
                     /protein_id="YP_945074.1"
                     /db_xref="GI:119952865"
                     /db_xref="GeneID:4642413"
                     /translation="MNLILINPDELKNGLILNDSRVKHINEILKLKNNETFKFGIIGE
                     EHIYSCVYQKDVKLFFRKNHKIAKSNKLKKLKVIIGLVRPIAAKRIITHLGSMGISEL
                     IFFNALLSEKSYSCSKLFKEREYEKYLIEGAMQGGITYIPKVNILNNLREVLKNTEYE
                     GSNTTKILLERESKNKLVDLNIKTKNTVVIIGPERGFITKEINLIKEYNFNAYNISSN
                     ILRTETATIVASAIITSKMNSK"
     misc_feature    56753..57463
                     /locus_tag="BT0062"
                     /note="Diacylglycerol kinase catalytic domain; Region:
                     DAGK_cat; cl17465"
                     /db_xref="CDD:266706"
     gene            complement(57596..58636)
                     /locus_tag="BT0063"
                     /db_xref="GeneID:4642377"
     CDS             complement(57596..58636)
                     /locus_tag="BT0063"
                     /EC_number="2.7.11.1"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_945075.1"
                     /db_xref="GI:119952866"
                     /db_xref="GeneID:4642377"
                     /translation="MSDNRPPHNKNLSSSNNLCEYNENFDSKVLTLPKHVAKGLILTI
                     FGSLIISCAIFFIFLKSNDIVVVPNLSELYLEDAITELQNKELIPYVELKFSSTSLDK
                     GKVIDQNPKAGTVLRLDSKVKIFISKGAVINKVDSFIGKNIDDVLINLKANSINNNRM
                     FYHLLKPIEIESTLPKGTIIRQEPSPGTKISSLVDLQFLVSKGQGDPPVKYVKNYIGL
                     YYKDAIISLLNDEIDFDVNLSSGNDFGSVIFQSLSPGSKIENLDKLTITINEPRSNDT
                     GVFGFLTYKLDMYPSSVDIMVKIKDPNGSSSLLYSFRSKGGLIKLPYEALKGSIIELY
                     IYDRLVNQTVVN"
     misc_feature    complement(57599..58519)
                     /locus_tag="BT0063"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2815"
                     /db_xref="CDD:225372"
     misc_feature    complement(58256..58441)
                     /locus_tag="BT0063"
                     /note="PASTA domain of bacterial serine/threonine kinase
                     pknB-like proteins. PknB is a member of a group of related
                     transmembrane sensor kinases present in many gram positive
                     bacteria, which has been shown to regulate cell shape in
                     Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577"
                     /db_xref="CDD:119328"
     misc_feature    complement(58067..58237)
                     /locus_tag="BT0063"
                     /note="PASTA domain of bacterial serine/threonine kinase
                     pknB-like proteins. PknB is a member of a group of related
                     transmembrane sensor kinases present in many gram positive
                     bacteria, which has been shown to regulate cell shape in
                     Mycobacterium tubercolosis; Region: PASTA_pknB; cd06577"
                     /db_xref="CDD:119328"
     misc_feature    complement(57830..58021)
                     /locus_tag="BT0063"
                     /note="PASTA domain; Region: PASTA; smart00740"
                     /db_xref="CDD:197851"
     gene            complement(58673..59602)
                     /locus_tag="BT0064"
                     /db_xref="GeneID:4642370"
     CDS             complement(58673..59602)
                     /locus_tag="BT0064"
                     /EC_number="2.1.2.9"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="YP_945076.1"
                     /db_xref="GI:119952867"
                     /db_xref="GeneID:4642370"
                     /translation="MRIFFASSDSIALEVLRKVSDHYNVVGVLTAPDKPSGRGLFLKV
                     NDIKVEAINRNITVLDPVVLNSDVIGMVKKLKPDLMLVFSYGKIFRQEFLDIFPMGCI
                     NVHPSLLPKYRGPSPIQTAILNGDTIGGITVQKMALEMDSGNILAQSQFEIKSFNTSA
                     DIFRYVSLNSFNLVLEALSKLNKGHIGIVQDSNQATYCSFFNKQHRMLNFNLSAFEIK
                     NKINACNPWPLARAKLDKDEIIFHRADFIKTTDYSDQAIGKIVSFDPSKGILVKTEDG
                     ILLLLELQRSGRKVVDYKSFYNGNRDLIGKIFS"
     misc_feature    complement(58676..59602)
                     /locus_tag="BT0064"
                     /note="methionyl-tRNA formyltransferase; Region: fmt;
                     TIGR00460"
                     /db_xref="CDD:232983"
     misc_feature    complement(59006..59602)
                     /locus_tag="BT0064"
                     /note="Methionyl-tRNA formyltransferase, N-terminal
                     hydrolase domain; Region: FMT_core_Met-tRNA-FMT_N;
                     cd08646"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(59180..59185,59192..59197,59201..59203,
                     59261..59263,59285..59296,59321..59323,59336..59359,
                     59567..59572,59582..59584))
                     /locus_tag="BT0064"
                     /note="putative active site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(59255..59263,59285..59290,59294..59296,
                     59345..59356,59483..59494,59498..59500,59510..59512,
                     59570..59572,59576..59581))
                     /locus_tag="BT0064"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(59180..59185,59192..59197,59294..59296,
                     59321..59323,59336..59344,59348..59350,59357..59359))
                     /locus_tag="BT0064"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187715"
     misc_feature    complement(order(59180..59182,59288..59290,59294..59296))
                     /locus_tag="BT0064"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187715"
     misc_feature    complement(58727..58981)
                     /locus_tag="BT0064"
                     /note="C-terminal domain of Formyltransferase and other
                     enzymes; Region: Met_tRNA_FMT_C; cd08704"
                     /db_xref="CDD:187732"
     misc_feature    complement(order(58730..58732,58736..58741,58745..58747,
                     58751..58753,58883..58885,58889..58891,58922..58924))
                     /locus_tag="BT0064"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187732"
     gene            complement(59599..60096)
                     /gene="def"
                     /locus_tag="BT0065"
                     /db_xref="GeneID:4642367"
     CDS             complement(59599..60096)
                     /gene="def"
                     /locus_tag="BT0065"
                     /EC_number="3.5.1.88"
                     /note="cleaves off formyl group from N-terminal methionine
                     residues of newly synthesized proteins; binds iron(2+)"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="YP_945077.1"
                     /db_xref="GI:119952868"
                     /db_xref="GeneID:4642367"
                     /translation="MKIVCYPNDLLRIKTKTVLNIDNELRNTAFKMVNLMDAKNGVGL
                     AASQVGLDLSIFVVRENAMSKPLIFINPLITETSFELVLYKEGCLSIPGVYYDLLRPK
                     SIIVEAYDENGEFFKIESSGLLARIVQHEMDHLKGVLFIDYYEDKLRNNLLRSYMKKR
                     RFVKT"
     misc_feature    complement(59677..60090)
                     /gene="def"
                     /locus_tag="BT0065"
                     /note="Polypeptide or peptide deformylase; a family of
                     metalloenzymes that catalyzes the removal of the
                     N-terminal formyl group in a growing polypeptide chain
                     following translation initiation during protein synthesis
                     in prokaryotes. These enzymes utilize Fe(II)...; Region:
                     Pep_deformylase; cd00487"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(59695..59697,59704..59709,59830..59838,
                     59953..59955,59968..59976))
                     /gene="def"
                     /locus_tag="BT0065"
                     /note="active site"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(59704..59706,59830..59832,59953..59955,
                     59968..59970))
                     /gene="def"
                     /locus_tag="BT0065"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238271"
     misc_feature    complement(order(59695..59697,59707..59709,59833..59835))
                     /gene="def"
                     /locus_tag="BT0065"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238271"
     gene            complement(60120..60809)
                     /locus_tag="BT0066"
                     /db_xref="GeneID:4642349"
     CDS             complement(60120..60809)
                     /locus_tag="BT0066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945078.1"
                     /db_xref="GI:119952869"
                     /db_xref="GeneID:4642349"
                     /translation="MRFVSLFVIFIVFCFVHLFSLSSDIIFHDSYKDAMDEARSLHKN
                     VLILVGKDIKGNLIRDFLKSFEDDNLLKAIAKNNVFLIIDVNNEIFGEINLKKSPTLF
                     FVDSQSEQIKAAYVGSIRDTVQCNQEFLNYALGVSKLDDIIHKKNNYEINTLDDKVFF
                     YKTLDGHWRLRMNGQDKKLLPSKIELKEFLVFKDENEGKLYAFPKSRKGSIYFSEAEN
                     EEWKLFGQIKL"
     misc_feature    complement(60492..60728)
                     /locus_tag="BT0066"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(60806..62584)
                     /locus_tag="BT0067"
                     /db_xref="GeneID:4642135"
     CDS             complement(60806..62584)
                     /locus_tag="BT0067"
                     /EC_number="3.4.11.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro aminopeptidase"
                     /protein_id="YP_945079.1"
                     /db_xref="GI:119952870"
                     /db_xref="GeneID:4642135"
                     /translation="MEISTKIFSLRNLMMKSEIDAYLIASYDPHMSEYSHVRFNVREF
                     ITGFTGSAGTVIVTETEAVLFTDGRYFLQASSELKGTEFKLMKLGVKGYPDIFGYINA
                     NLKGLRLGIYSEDVNIKFYNDLVQNCRYTDIEILHEDLVSKIWQDRPGLESNKIFELS
                     GAQKIDKRTDKLDKVNAKLEEKAIDFCIISSLDEIAWLLNLRGLDVESSALFYAFLFI
                     ARSERYKNVLFVNIDKLDSELSERFEAEGFEIEDYSNFYSFLAEINHEGKFFIPVESN
                     VKILESIGKPNAILGESIVNELKAIKSDYEISKMKEAHIIDAVSLIKFLYKFKSLNKD
                     ELSKLDEVDVANMLLNFRTARDEFFSSSFNSIVGFKENAALPHYRPTKGAKNLDGNGL
                     LLIDSGGSYLELGTTDVTRTILIGEASCKEREDYTLVLKSFIALASLKFPFGTLGSSL
                     DGIARFPLLKQGLNFAHGTGHGVGFFLNVHELPVSISPLSSYSFKGSEIASIEPGLYR
                     DSEYGIRTENLVFVKQSYSNEFGTFLEFENLTLVPFEKELIVTEMLSKDELDYINSYH
                     EFIYSSLKEYLSGDELKFLEILTNKI"
     misc_feature    complement(62165..62557)
                     /locus_tag="BT0067"
                     /note="Creatinase/Prolidase N-terminal domain; Region:
                     Creatinase_N; pfam01321"
                     /db_xref="CDD:250531"
     misc_feature    complement(60935..62008)
                     /locus_tag="BT0067"
                     /note="Xaa-Pro aminopeptidase [Amino acid transport and
                     metabolism]; Region: PepP; COG0006"
                     /db_xref="CDD:223085"
     misc_feature    complement(60992..61657)
                     /locus_tag="BT0067"
                     /note="X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also
                     known as X-Pro aminopeptidase, proline aminopeptidase,
                     aminopeptidase P, and aminoacylproline aminopeptidase.
                     Catalyses release of any N-terminal amino acid, including
                     proline, that is linked with proline; Region: APP;
                     cd01085"
                     /db_xref="CDD:238518"
     misc_feature    complement(order(61034..61036,61076..61078,61160..61162,
                     61361..61363,61397..61399,61454..61456))
                     /locus_tag="BT0067"
                     /note="active site"
                     /db_xref="CDD:238518"
     gene            62706..63596
                     /locus_tag="BT0068"
                     /db_xref="GeneID:4642361"
     CDS             62706..63596
                     /locus_tag="BT0068"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase (HAD superfamily)"
                     /protein_id="YP_945080.1"
                     /db_xref="GI:119952871"
                     /db_xref="GeneID:4642361"
                     /translation="MKDIKAVISDLDGTLLLSNSQIGAFSEIVIKKLTKENKKFIIAT
                     GRSKNEIISLTEHLNSHVSFFITLNGARVYNNQWQLISSYDLSSEIVNEILNLRENKY
                     KDIPHFLQKSEDIDEKLYADNTTKNAINNIFEKHELLRKHKYIEHELKDISIKYHEVN
                     SFREIKNFNNIAKILLLHDEEPQLIKYEATILEKYRKEINAYLSTPHSLEIVNNRVSK
                     GSALKDVLKSIHINLNEAIAFGDGFNDVDMLENVNKGLLMGNANYRLKKMLSYLEIIG
                     TNDNEAVAHYINDNILEEPV"
     misc_feature    62721..>62930
                     /locus_tag="BT0068"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    62724..63566
                     /locus_tag="BT0068"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase_3; pfam08282"
                     /db_xref="CDD:254707"
     misc_feature    order(62733..62741,62835..62840)
                     /locus_tag="BT0068"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    62733..62750
                     /locus_tag="BT0068"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    62835..62837
                     /locus_tag="BT0068"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    <63348..63461
                     /locus_tag="BT0068"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     gene            63610..64848
                     /locus_tag="BT0069"
                     /db_xref="GeneID:4642317"
     CDS             63610..64848
                     /locus_tag="BT0069"
                     /EC_number="3.4.11.-"
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="YP_945081.1"
                     /db_xref="GI:119952872"
                     /db_xref="GeneID:4642317"
                     /translation="MKTDLIKYAELIILKGINLQKNQCVLITGSIENYEFLKILAQKA
                     YEYGAKYVELNIEDTDILKTRLKSSPEDLLEFIPDFKHKFFEEMINEKWAKIRIDNTE
                     NLDTLKDNDSKKISKYFKALNIASRKVSSAIMNNELAWCIICAPGPKWAAKVLNKPES
                     QKTLEEFFKIQKKIMLLDSKDPIKAWEDHGKKLHQRCKILNKLKLEKIIFKNQKTNLE
                     IYLLESSIWTGGSEKIRGTNIEFNANMPTEEVYTTPNYKKTNGIMYVTRPVTVLGNLI
                     TGIWLEFREGKVINFGCDNEQSRNILKRHMETDMQAQYIGEVALVDCNSPIYQSGLTF
                     CNILYDENASCHIALGNAYPSCLSNGQELKTDAEKLDYGCNVSLIHTDFMIGSNDINV
                     IGIDKSRKEHTIIQNGQFVI"
     misc_feature    63613..64839
                     /locus_tag="BT0069"
                     /note="Thermophilic metalloprotease (M29); Region:
                     Peptidase_M29; pfam02073"
                     /db_xref="CDD:145308"
     gene            64866..65333
                     /locus_tag="BT0070"
                     /db_xref="GeneID:4642102"
     CDS             64866..65333
                     /locus_tag="BT0070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945082.1"
                     /db_xref="GI:119952873"
                     /db_xref="GeneID:4642102"
                     /translation="MIKELFTNDLFLSCFVSGIVAQMIKYIIQAMKTKKFKTNPKYLL
                     KSIFLETGGMPSSHSSTVTALATSILITEGIDTNFIIALAFALITIRDSFGVRYMAGV
                     QAEYLNALSEQLKMKIKIEPLKIKVVKGHKKKEVFTGILIGIISAWVICNRII"
     misc_feature    64866..65330
                     /locus_tag="BT0070"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1963"
                     /db_xref="CDD:224874"
     gene            65356..66825
                     /locus_tag="BT0071"
                     /db_xref="GeneID:4642075"
     CDS             65356..66825
                     /locus_tag="BT0071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945083.1"
                     /db_xref="GI:119952874"
                     /db_xref="GeneID:4642075"
                     /translation="MKLPKFLNILLILLLISCNMAKFGDYKPIYFKGEEDLKTANDYI
                     NSLGYKTISEYTTKVNILDFPDFKEITINKLIHLNDYDLRKDLFLKKLPNLFNIEKKK
                     ILYVESAFTSSDLRKLKQDQKIEAEMHSLNYKTKIKYFSSITFITIIILLLLLNIKYA
                     PFIILFLISSCTIFIFSDEILYFYPLTILSYLLFTLIDNFNKNYNKIYLRDISFTVLI
                     KKIKIPIFLFLFIVFYFIVIINFLTTNLEALLIIFVSISTLCIFLIFTWIKTESNLKH
                     TFLSLIEIKEQKRETKILKFKILIHIMLFIASLMPFFYAQNILNAYNNFNYLYSKKLN
                     YFDYLNPNNIYLMVGHNEEIPNIVGYMYHIFYQNELKYKITSQYGKVNTHVKEDYFEI
                     ENNKITINQKTVYKVDKEFISKNLNKELPKLFLDNGNPILIYKETPANIAINKDNFTI
                     LFSLSLPFFLLLFLFKAIRFTILLNMSEKSYRKYIRGNI"
     misc_feature    65821..>66279
                     /locus_tag="BT0071"
                     /note="stage II sporulation protein E; Region: spore_II_E;
                     TIGR02865"
                     /db_xref="CDD:234038"
     gene            66822..69128
                     /locus_tag="BT0072"
                     /db_xref="GeneID:4642386"
     CDS             66822..69128
                     /locus_tag="BT0072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945084.1"
                     /db_xref="GI:119952875"
                     /db_xref="GeneID:4642386"
                     /translation="MMSNSKTLKIKKQYKVNIDEIQMPECVLIPLETENAKSTIYIIE
                     NQRITEGQILSKNKNAELYTYSPISGTIEKIYTANLPGEHQLKSALIRFHGRIKNEQE
                     LSVEEESREKTLEKLIRLGIPWFNEHSLFQYVSKCKKIDKMLFLINGKDPFTNISEIL
                     IKEKLDEIIYGFETIDKIFKFKEILIVLSNYHLKKELEHLNIFQDKRLTIKLIPNTSY
                     PYSNHEVIMHFLYNEESIKNNINPNKNILLANVEDLYNVYSTLKTNSPYKEKFITING
                     NKKIQSKIIKVKIGTSIQQIINEDIDTKKYDIFINNPANKIKINNLNIPITRDIYSIT
                     ILKKESILSKIKLLKTPSFSPRYMEEIILSKIKGKNNISNTQLQYLQYTETETEDEIN
                     KVKKEIKEKILNLSLNNEPIYTENNLKDIYLTIILALIPSLIFSFTNNIKFLIDTLIL
                     TMISLCSYITIMLKSKHKYLSFFIYTSLIINIILPLNFSIILKIISLLFTFLVFFYFS
                     KLSKFLVNPILISFMFLLLNFPSSFKHTYSKKLSEQEDIIPTWNKIMQQSSNIQNLES
                     LKEFKRYENKHIDMIEKFINDNILSNINIMIPRFHIENLLGLQNEKYLSPILIYIGFS
                     FILGKFIINKLIPLSFYISLLLIAYILKNLGLYSHISFDMLTLIMSPIPMILVFTMST
                     ELQIAPPFKFEQILYGITLSLVYFITLSYIPLETLAAVISIFILQISSTLIKRYSLTF
                     QIKKILHHLSINQAKTIKYKNDNGEEII"
     misc_feature    66861..68417
                     /locus_tag="BT0072"
                     /note="Predicted NADH:ubiquinone oxidoreductase, subunit
                     RnfC [Energy production and conversion]; Region: RnfC;
                     COG4656"
                     /db_xref="CDD:227003"
     misc_feature    68055..68942
                     /locus_tag="BT0072"
                     /note="NQR2, RnfD, RnfE family; Region: NQR2_RnfD_RnfE;
                     cl00779"
                     /db_xref="CDD:260616"
     gene            69132..69701
                     /locus_tag="BT0073"
                     /db_xref="GeneID:4642230"
     CDS             69132..69701
                     /locus_tag="BT0073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945085.1"
                     /db_xref="GI:119952876"
                     /db_xref="GeneID:4642230"
                     /translation="MKNSLIMYLLVNNLLLIHFIGIEDIKIKDNKTLSKKYLIVIITS
                     LLIYSSLFYLYKLFSEHNLLFIIPIIYITLIYILTIILKTLNNILIVYNNKSKYSNDF
                     LLSNSSLIAITFFSLDKSHNFLEGIKILILSSLSVLIALILITLTKKSFEKKLTSKIL
                     ANETIYFFIMFILSLIPNIIMLINNIEGL"
     gene            69717..70778
                     /gene="prfB"
                     /locus_tag="BT0074"
                     /db_xref="GeneID:4642618"
     CDS             69717..70778
                     /gene="prfB"
                     /locus_tag="BT0074"
                     /note="RF-2; recognizes the termination signals UGA and
                     UAA during protein translation a specificity which is
                     dependent on amino acid residues residing in loops of the
                     L-shaped tRNA-like molecule of RF2; in some organisms
                     control of PrfB protein levels is maintained through a +1
                     ribosomal frameshifting mechanism; this protein is similar
                     to release factor 1"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="YP_945086.1"
                     /db_xref="GI:119952877"
                     /db_xref="GeneID:4642618"
                     /translation="MNFWNKLKMSGGSFDSNKIKVKLKEYEKQINDENFWNDNKKAQE
                     ILKNQNILKAKIEPWEDLICKLKDLRELCEIAESEEDTALLDQDINKLREQYKHLLTL
                     SYFKEDIDINNAFLTIHSGAGGTEACDWVSMLYRIYLRYSERHGYKTELIDLLEAEGG
                     IKSVTIEIKGEYAYGFLKSEVGIHRLVRISPFDAAKKRHTSFASVFIDPVIDDKIEIT
                     IKPEDIRVDTYRASGAGGQHVNKTSSAVRITHLQTGIVTQSQTDRSQHRNKDLAMRVL
                     KSKLYEHYKILEQQKSKSKQEEKKDISWGNQIRSYIFQPYTLVKDHRTKFENPNIISV
                     MDGNIDNFIEEYLKWKNLS"
     misc_feature    69720..70775
                     /gene="prfB"
                     /locus_tag="BT0074"
                     /note="peptide chain release factor 2; Validated; Region:
                     prfB; PRK00578"
                     /db_xref="CDD:234799"
     misc_feature    69783..70025
                     /gene="prfB"
                     /locus_tag="BT0074"
                     /note="Spectrin repeats; Region: SPEC; smart00150"
                     /db_xref="CDD:197544"
     misc_feature    69927..70256
                     /gene="prfB"
                     /locus_tag="BT0074"
                     /note="This domain is found in peptide chain release
                     factors; Region: PCRF; smart00937"
                     /db_xref="CDD:214923"
     misc_feature    70347..70685
                     /gene="prfB"
                     /locus_tag="BT0074"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            70760..72166
                     /locus_tag="BT0075"
                     /db_xref="GeneID:4642885"
     CDS             70760..72166
                     /locus_tag="BT0075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945087.1"
                     /db_xref="GI:119952878"
                     /db_xref="GeneID:4642885"
                     /translation="MEKSKLIIILFLILTLKLAYPQSNIEYGFSYIINTQDENKNLQE
                     GIEQTLDKIYKTINEHIVNNNDKDFIRRIYINQNIVNKEQEISKLKEDMDKKKLQNAI
                     SSREENKIEIKINELKKDIENIKIKQKEFEEYLINLKKMKTKYIKHKEKIHPSNLNTE
                     FLISQELFFINYIHLKKIEKYYLVEISNITPQGVKVKKEIFHLSSSVDDIANKIAELS
                     FEEILGREFIKIKINVINNLDAKIYINEQFVSKGIYNNDIWDISKLPNKEIIINIIST
                     TYKPHTVKQKVKSGDTINLNINLQKANYRKIPITSNVTSKVFKKGIFIGETPIEIEEP
                     EGIESILLQAKGYKNMFKMISKEDKEINIEMLKDNKSELIIKRDQFYINLGIFTLSLI
                     GTAFAITKYNESSELYNIALKNIIKRKITPQDLYNVKSEQMITTFLLGTGITLSVGSF
                     IPLIIHLVKYIQEASRGE"
     gene            72208..73062
                     /locus_tag="BT0076"
                     /db_xref="GeneID:4642660"
     CDS             72208..73062
                     /locus_tag="BT0076"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="YP_945088.1"
                     /db_xref="GI:119952879"
                     /db_xref="GeneID:4642660"
                     /translation="MRILGIFDKIKNLFKNKEKTQIFEKLEDILLEADIKNDIVIEII
                     ENIKKLKVKDEEETFLKLKDFLKSYINQQSLNLENKRLNILLIIGVNGVGKTSSIIKL
                     ANKFKNEGKNVLIAAADTFRAAAIEQIKIQSEKIGIKVISQNQGSDAAAVIFDSISSA
                     KTKNYDILIIDTAGRLQNKENLIKELQKMDNVIKKQMIKTDVNYKKILVIDSIAGKNI
                     NNQTEIFNKAIEIDGIIATKFDSSSRAGGIINISKLFKKPIYFFTFGEQVEHIKEFNT
                     DDYLNKLL"
     misc_feature    72220..72408
                     /locus_tag="BT0076"
                     /note="SRP54-type protein, helical bundle domain; Region:
                     SRP54_N; pfam02881"
                     /db_xref="CDD:251589"
     misc_feature    72268..73059
                     /locus_tag="BT0076"
                     /note="signal recognition particle-docking protein FtsY;
                     Region: ftsY; TIGR00064"
                     /db_xref="CDD:232804"
     misc_feature    72451..73059
                     /locus_tag="BT0076"
                     /note="SRP54-type protein, GTPase domain; Region: SRP54;
                     pfam00448"
                     /db_xref="CDD:249866"
     gene            73059..74093
                     /locus_tag="BT0077"
                     /db_xref="GeneID:4642783"
     CDS             73059..74093
                     /locus_tag="BT0077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945089.1"
                     /db_xref="GI:119952880"
                     /db_xref="GeneID:4642783"
                     /translation="MTTKIVILFLIFIIPSTYGQNYFISDVFFNKYQEIYEIPQTGFY
                     IEYMKINEIEKFSLFKDLQLIKYKTQKTIKDDKKKLTFYNEKDIKTKEEIYDNLNNKI
                     QEIKYSPKGIILESVNYFYKNNDLIYKEIKILNQKPKTLHYMKDSNGKLLKITGSDFQ
                     VWNYGINGEIKSTYFDIKKSKTKVIQYDDQKRHLESIILDNNKIKSREKNQYLDDNEV
                     INTEEKEEGNIKIISKYKGPNLIKKEIYKNNEITEISDFEYNESGNVIVENVIVKENK
                     KEHNTKTKYEYNSDNRLTSKTIYENNLILLKTDYFNDHEYEQEIYYDGNPIFKVRYKN
                     DEIIEEIKRY"
     misc_feature    73185..>73910
                     /locus_tag="BT0077"
                     /note="DNA polymerase III PolC; Validated; Region: polC;
                     PRK00448"
                     /db_xref="CDD:234767"
     gene            74105..75352
                     /locus_tag="BT0078"
                     /db_xref="GeneID:4642880"
     CDS             74105..75352
                     /locus_tag="BT0078"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="YP_945090.1"
                     /db_xref="GI:119952881"
                     /db_xref="GeneID:4642880"
                     /translation="MGLNKFLLKRLILDEQNSLSLTIVIILSIVLGQIIIIITISIMN
                     GFQNDFFTSISTLESGNLKIESQLNDQELNALKEIKEIIQINKIYETQGIGIENYYYP
                     SILNIIALDTKDIIEDKNFILLTGLTQSELQLNDDEIIIGDVLSYNLGLLEGDIIGLI
                     LSDEIKNLQTLKNEIKYFKIKAIFKSNYAKINESTIFMNINYFYKKQIIKDSDIKYQI
                     KTQNLYPSKSLINKIKNINPNIQFKPWNEYNKEFYKALKIERNTMLIILTSIFLVIAV
                     NTYYLQKRIIINKSKSISIILSLGLKSQKIRKIFLIHSVIICILGGIIGLITGIIISS
                     NINEILNVIDILINSLINTINYILKLKLENIEIKIVKNTITPKIFLSDLMFTLFFACL
                     FTICSSLKVTKKIKYVDKINGAS"
     misc_feature    74168..75319
                     /locus_tag="BT0078"
                     /note="ABC-type transport system, involved in lipoprotein
                     release, permease component [Cell envelope biogenesis,
                     outer membrane]; Region: LolE; COG4591"
                     /db_xref="CDD:226957"
     gene            75353..76033
                     /locus_tag="BT0080"
                     /db_xref="GeneID:4642894"
     CDS             75353..76033
                     /locus_tag="BT0080"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein releasing system ATP-binding protein
                     LolD"
                     /protein_id="YP_945091.1"
                     /db_xref="GI:119952882"
                     /db_xref="GeneID:4642894"
                     /translation="MKNIICITEIHKTYTKNKTKIKVLENLNLNVKDGDFISIQGKSG
                     CGKSTLFNIISGIDKMDSGDIISCGISLKDANEKTLSLYKNKKIGLVFQNHNLIDEFS
                     VFENIILPKIIEGKDNLETINRKALRLMKILEIDKRGDHYPSELSGGEAQRAAIARAL
                     INEPNIILCDEPTGNLDINTAKTVESLLINTAKTFHKTLILVSHNPEFSNKADIKYEF
                     KEKTLKRI"
     misc_feature    75362..76012
                     /locus_tag="BT0080"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    75380..76021
                     /locus_tag="BT0080"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    75473..75496
                     /locus_tag="BT0080"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(75482..75487,75491..75499,75629..75631,75860..75865,
                     75962..75964)
                     /locus_tag="BT0080"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    75620..75631
                     /locus_tag="BT0080"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    75788..75817
                     /locus_tag="BT0080"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    75848..75865
                     /locus_tag="BT0080"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    75872..75883
                     /locus_tag="BT0080"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    75950..75970
                     /locus_tag="BT0080"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            76030..77280
                     /locus_tag="BT0081"
                     /db_xref="GeneID:4642653"
     CDS             76030..77280
                     /locus_tag="BT0081"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein releasing system transmembrane
                     protein LolE"
                     /protein_id="YP_945092.1"
                     /db_xref="GI:119952883"
                     /db_xref="GeneID:4642653"
                     /translation="MMRPNIKELTKIAYIIFINSKNKKALIGSGMSLSLVMIPLIIVY
                     YMSNNIMNSTIEKYIENEGFSVQIEYNEIQKDTYLKSKLEKLKKEYQHDELRYFFERR
                     TYGIIGNNKKQGVLIRAVENKFIDENKHIKLIDGKKSFNKNEILISKQIKDRLNLNIN
                     ESIYIVVPNNKHQKIFPKAKKFNISGIIETGLREIDKNLVLISLQDSNIMSEEFSKSI
                     IGISIKPNTKEKTDNLKKNIKKEFQEYKIKTFYELYLNKYTNLDISKKLLIFIMAFIV
                     IFASINISSSLCMLILENKKKIAIFKSIGMNNSSLKLIFILIALVLSSISCIIGIIIG
                     NYITINIEHLINIIDIIINTILKIFGTDNTELLNSDYYISEFNIKISYKFSLIILLSY
                     TLISITTTLIPLNIISKFKEKEIL"
     misc_feature    76093..77277
                     /locus_tag="BT0081"
                     /note="ABC-type transport system, involved in lipoprotein
                     release, permease component [Cell envelope biogenesis,
                     outer membrane]; Region: LolE; COG4591"
                     /db_xref="CDD:226957"
     misc_feature    76834..>76995
                     /locus_tag="BT0081"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            complement(77310..78593)
                     /locus_tag="BT0082"
                     /db_xref="GeneID:4642157"
     CDS             complement(77310..78593)
                     /locus_tag="BT0082"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945093.1"
                     /db_xref="GI:119952884"
                     /db_xref="GeneID:4642157"
                     /translation="MSKTSEERIKIYLSKLSKYKNKILKENSIKDIIERADISDADIE
                     NIEMRFSKIYDRARRLEEMGELSDSLRELETIYLYSLHNKSIFASFFNFYKRLIKRID
                     SKNLNKKLIHVSLQAREFGIVSGINLKDYDEAERLKHRVLILLLSFVLIAIIAFITYT
                     IMHSFIGGYEKLDEVKDVHRTTFQGLPSVTRASDLVVESVNLAAGPYVLYHVEVEDAK
                     VLVFEDAHAYQLKAGVVSAKDPIKRIYYGVTVYDDLGRPILNKVFEKTSDFPNKWSKG
                     VYAPIDFIYSISKEINGHPKKMVLDIRLVEFFSEVDNLSSVNLETSSSILNFKYLGSY
                     FNESFGIYEANSLIEVYNDSKDNIKDLEIEVTYVSKDSQIIRSLQRKLISESNSFLKP
                     YSRQSFSLKTIFPKEIYPNIKEELSSIKIVNVFVR"
     misc_feature    complement(<77748..77879)
                     /locus_tag="BT0082"
                     /note="Flagellar basal body protein FlaE; Region: FlaE;
                     pfam07559"
                     /db_xref="CDD:254288"
     gene            complement(78586..78903)
                     /locus_tag="BT0083"
                     /db_xref="GeneID:4642569"
     CDS             complement(78586..78903)
                     /locus_tag="BT0083"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945094.1"
                     /db_xref="GI:119952885"
                     /db_xref="GeneID:4642569"
                     /translation="MKEIIYRFEKAEDYKLVPINNIYGSVTNTGEIFCDLVFESTEIP
                     EEIVYTKTKEGVLEEISGEFKGSKEKIILINSFVGISITKDTAKNIAYWLLKKVDELE
                     DNE"
     gene            79100..80368
                     /locus_tag="BT0084"
                     /db_xref="GeneID:4642745"
     CDS             79100..80368
                     /locus_tag="BT0084"
                     /EC_number="4.4.1.-"
                     /EC_number="4.4.1.16"
                     /note="selenocysteine lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfhydrase"
                     /protein_id="YP_945095.1"
                     /db_xref="GI:119952886"
                     /db_xref="GeneID:4642745"
                     /translation="MDLNLIKDTNETVKILRKDFPILNKTINDKKIIYFDNAATSQKP
                     QSVISSIVEYYTNYNANVYRSGHELAIQSSLKVAKVRKIVKNFINAESCKNIIFNSGT
                     TDGINTVVNSLLFSKLLKKNDEIITTTLEHNSNLLPWINIAKFLKLKIKLAKFNEMGI
                     IQPEQIKNLITNKTRIIAISSINNILGTIQDLETIGKLARDNKIILFIDAAQMAPHMN
                     IDVKKIDCDFLVFSGHKMLAPTGIGVLYISDKIIDKLNSSKLGGNTIEDIFMKNGELN
                     FKTLEPPNKFESGTPNIAGIIGLGKAIEYINNVSMEFIQEHDRALIEYCVAKLKEIDE
                     VEFILNKDIKRKSIISFTVKDIHSHDIETYLDTMGIAIRSGKTCAYLAFFSENIKKDH
                     LLRISFYLYNTKEEIDTFISCLKSTIKAFY"
     misc_feature    79196..80341
                     /locus_tag="BT0084"
                     /note="Cysteine desulfurase (SufS)-like. This family
                     belongs to the pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to cysteine desulfurase
                     (SufS) and selenocysteine lyase. SufS...; Region:
                     SufS_like; cd06453"
                     /db_xref="CDD:99746"
     misc_feature    order(79403..79408,79415..79417,79493..79495,79724..79726,
                     79730..79735,79793..79795,79799..79804)
                     /locus_tag="BT0084"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99746"
     misc_feature    79802..79804
                     /locus_tag="BT0084"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99746"
     gene            80539..80943
                     /locus_tag="BT0085"
                     /db_xref="GeneID:4642632"
     CDS             80539..80943
                     /locus_tag="BT0085"
                     /codon_start=1
                     /transl_table=11
                     /product="NifU-like protein"
                     /protein_id="YP_945096.1"
                     /db_xref="GI:119952887"
                     /db_xref="GeneID:4642632"
                     /translation="MFSEETKKELIRFSKIKKYYFKTDKNQSSVYHQSKCGDQITFKI
                     NESNKKIRLKYNAYGCIIFLSSAYILTKLCDNKPRKEILEIITKTINKNFENLEEIDK
                     SLKNFENFLYTNRKDCFMLPYKALKEILNTIK"
     misc_feature    80560..80925
                     /locus_tag="BT0085"
                     /note="Iron-sulfur cluster scaffold-like proteins; Region:
                     IscU_like; cd06664"
                     /db_xref="CDD:143480"
     misc_feature    order(80560..80562,80569..80574,80644..80649,80716..80718,
                     80722..80724,80878..80883,80887..80892)
                     /locus_tag="BT0085"
                     /note="trimerization site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:143480"
     misc_feature    order(80644..80646,80716..80718,80890..80892)
                     /locus_tag="BT0085"
                     /note="active site"
                     /db_xref="CDD:143480"
     gene            80966..82495
                     /locus_tag="BT0086"
                     /db_xref="GeneID:4642620"
     CDS             80966..82495
                     /locus_tag="BT0086"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase subunit ChlI-related ATPase"
                     /protein_id="YP_945097.1"
                     /db_xref="GI:119952888"
                     /db_xref="GeneID:4642620"
                     /translation="MKIYSHSSIGYEGELIEIEVDIRKGISGIDIVGLAGSEIKESRE
                     RVKSAIKNSEFTFPKDRILINLAPAGIKKIGTAIDLSIATSIITIKENQNNNLEVLIL
                     GELQLDGQIRAIKGVLPAISLAKKRGIKCIIIPFDNLEESLLIENLNIWGVKTLKEAL
                     EIISNLNNNIFPAKHTINFKTEYNEEKFEYDFKNIKGQHRTKRALEIAVAGGHNIMLF
                     GPPGSGKTLSIKCVQSILPPLTNKEIIETNRIWSVAGKLIDTKIIRQRPFRQPHQTAS
                     KEGIIGGGSNALPGEVSLAHNGILFLDEALEFQKSILQSLREPIEDKMISIVRASSKS
                     FKYPANFQLMIATNPCPCGNLGKNDTECFCSQQEVSNYWKKLGAAMLDRIDIRVPVKP
                     VDNAKLFQEDNESSCEIRQKIIKTRNIQSKRYANIENIHKNSDLKPEHIAIFCELDKI
                     LREEMIYILNKLNISSRATHSILKLARTIADLKEENHISRESLLEAIEHRKHGERLLE
                     E"
     misc_feature    80972..82465
                     /locus_tag="BT0086"
                     /note="Mg chelatase-related protein; Region: TIGR00368"
                     /db_xref="CDD:129465"
     misc_feature    81017..81379
                     /locus_tag="BT0086"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     misc_feature    81551..82012
                     /locus_tag="BT0086"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    81620..81643
                     /locus_tag="BT0086"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(81623..81646,81872..81874,82007..82009)
                     /locus_tag="BT0086"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    81860..81877
                     /locus_tag="BT0086"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    82169..82465
                     /locus_tag="BT0086"
                     /note="Magnesium chelatase, subunit ChlI; Region:
                     Mg_chelatase_2; pfam13335"
                     /db_xref="CDD:257665"
     gene            complement(82518..83468)
                     /locus_tag="BT0087"
                     /db_xref="GeneID:4642187"
     CDS             complement(82518..83468)
                     /locus_tag="BT0087"
                     /EC_number="1.1.1.27"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase"
                     /protein_id="YP_945098.1"
                     /db_xref="GI:119952889"
                     /db_xref="GeneID:4642187"
                     /translation="MLKRNKVVLVGAGGVGSSFAYALTIDNSLVHELIIIDLAQDKAK
                     GEVMDLNHGQMFLEKNIKIEFGNYDDCSDADIVVITAGLNQKPGETRLDLVGKNTKIF
                     KEIVTSVVSSGFSGIFVIASNPVDIMTYVTMKYSNFPTHKVIGTGTTLDTSRLRYFLA
                     ERFNVNTQNIHSYIMGEHGDSSFATWDETKIAMKSLSEYLAEGKVSDAELDEMHKNVV
                     NAAYEVIKLKGATYYAIGLGIKKIVNAIISDQNLILPISSYINGQYGNFVKDIYIGAP
                     SVVCKDGIKEVLDFTISDRELEKFKISASQLKSYIDKIEF"
     misc_feature    complement(82530..83420)
                     /locus_tag="BT0087"
                     /note="L-2-hydroxyisocapronate dehydrogenases and some
                     bacterial L-lactate dehydrogenases; Region: HicDH_like;
                     cd05291"
                     /db_xref="CDD:133427"
     misc_feature    complement(82542..83420)
                     /locus_tag="BT0087"
                     /note="L-lactate dehydrogenase; Region: L-LDH-NAD;
                     TIGR01771"
                     /db_xref="CDD:233566"
     misc_feature    complement(order(82746..82748,82758..82760,82767..82775,
                     82785..82790,82965..82967,83001..83003,83007..83012,
                     83301..83306,83313..83327,83331..83333,83388..83393,
                     83406..83408,83415..83420))
                     /locus_tag="BT0087"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133427"
     misc_feature    complement(order(82599..82604,82626..82628,82710..82712,
                     82716..82730,82887..82892,82905..82907,82962..82964,
                     82971..82973,82977..82979,83289..83291,83376..83378))
                     /locus_tag="BT0087"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:133427"
     misc_feature    complement(order(82935..82937,83031..83033,83100..83108,
                     83220..83231,83355..83360))
                     /locus_tag="BT0087"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133427"
     misc_feature    complement(order(82776..82778,82806..82808,82935..82937,
                     83007..83009,83100..83102,83196..83198))
                     /locus_tag="BT0087"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:133427"
     gene            complement(83651..85456)
                     /locus_tag="BT0088"
                     /db_xref="GeneID:4642820"
     CDS             complement(83651..85456)
                     /locus_tag="BT0088"
                     /note="binds to the ribosome on the universally-conserved
                     alpha-sarcin loop"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein LepA"
                     /protein_id="YP_945099.1"
                     /db_xref="GI:119952890"
                     /db_xref="GeneID:4642820"
                     /translation="MKISSYKKNFCIIAHIDHGKSTLADRFIQKAKIVSDREFKSQIL
                     DSMDIERERGITIKSQAVTIDYKCSDGNTYELNFVDTPGHVDFSYEVSRAISSCEGAL
                     LLVDASQGIEAQTVSNFYMAFEHNLEIIPVINKIDLPSANIDFVKEQIEHDLGLDSNI
                     AVPISAKNGIGIDELLEAICKYVPSPKGSVKSSLKALIFDSHYDSYRGVIVHFRIFEG
                     QIKTGNKIKLMHADREYLVEEIGIFRIILERKEILEAGDVGYFIAGIKNISDVKIGDT
                     VTLVDNPASAPLEGFKEVKPVVFSSIYPVDANQYDDLLKAMDRLKLNDASLTFEKDAS
                     AALGHGFKCGFLGLLHLEVIQERIEREFDLNVILTSPSVRYKIIPKKGNSYFIESPEQ
                     FPGNENIEVSLEPYIRANIIVPTEFLGNVMSVCLLKRGVQENLIYLDTKRVEVIYKMP
                     LAEILFDFYDKVKSVSRGYASFDYVLLGYEETDLVKLDILVNGDRVDALSQLVFKDGA
                     RAKALSICKKLKDEIARQQFKIAIQGAIGSNIIARETISPVRKDVTAKCYGGDITRKR
                     KLLEKQKEGKKRLKMIGNIEIPQSAFLAILKSDDN"
     misc_feature    complement(83654..85456)
                     /locus_tag="BT0088"
                     /note="GTP-binding protein LepA; Provisional; Region:
                     PRK05433"
                     /db_xref="CDD:235462"
     misc_feature    complement(84899..85435)
                     /locus_tag="BT0088"
                     /note="LepA also known as Elongation Factor 4 (EF4);
                     Region: LepA; cd01890"
                     /db_xref="CDD:206677"
     misc_feature    complement(85394..85417)
                     /locus_tag="BT0088"
                     /note="G1 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(order(85010..85012,85022..85024,85130..85135,
                     85202..85207,85274..85279,85370..85375,85382..85384,
                     85391..85396,85406..85408,85412..85414))
                     /locus_tag="BT0088"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(order(84956..84964,85046..85048,85052..85057,
                     85391..85408))
                     /locus_tag="BT0088"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206677"
     misc_feature    complement(85277..85312)
                     /locus_tag="BT0088"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(85289..85291)
                     /locus_tag="BT0088"
                     /note="G2 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(85208..85219)
                     /locus_tag="BT0088"
                     /note="G3 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(85157..85213)
                     /locus_tag="BT0088"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(85046..85057)
                     /locus_tag="BT0088"
                     /note="G4 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(84956..84964)
                     /locus_tag="BT0088"
                     /note="G5 box; other site"
                     /db_xref="CDD:206677"
     misc_feature    complement(84620..84877)
                     /locus_tag="BT0088"
                     /note="lepA_II: This subfamily represents the domain II of
                     LepA, a GTP-binding protein localized in the cytoplasmic
                     membrane. The N-terminal domain of LepA shares regions of
                     homology to translation factors. In terms of interaction
                     with the ribosome, EF-G, EF-Tu...; Region: lepA_II;
                     cd03699"
                     /db_xref="CDD:239670"
     misc_feature    complement(84353..84574)
                     /locus_tag="BT0088"
                     /note="Elongation Factor G, domain II; Region: EFG_II;
                     pfam14492"
                     /db_xref="CDD:258632"
     misc_feature    complement(84008..84247)
                     /locus_tag="BT0088"
                     /note="lepA_C: This family represents the C-terminal
                     region of LepA, a GTP-binding protein localized in the
                     cytoplasmic membrane.   LepA is ubiquitous in Bacteria and
                     Eukaryota (e.g. Saccharomyces cerevisiae GUF1p), but is
                     missing from Archaea. LepA exhibits...; Region: lepA_C;
                     cd03709"
                     /db_xref="CDD:239680"
     misc_feature    complement(83666..83986)
                     /locus_tag="BT0088"
                     /note="GTP-binding protein LepA C-terminus; Region:
                     LepA_C; pfam06421"
                     /db_xref="CDD:203441"
     gene            complement(85497..86510)
                     /locus_tag="BT0089"
                     /db_xref="GeneID:4642827"
     CDS             complement(85497..86510)
                     /locus_tag="BT0089"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat family protein"
                     /protein_id="YP_945100.1"
                     /db_xref="GI:119952891"
                     /db_xref="GeneID:4642827"
                     /translation="MRKFNIFIDMLRPFLLLFIFSFIFNLNSSGVKEFPYWILLEKGR
                     QFIYSKEGFIKSNLTSAINYLQEALLRKGIYPEANYYLSIAYSMIGNVVFEKLHLQKA
                     LEDKDYLLDKSFEKNILFSLAKIAEIEDNYVDMIDYLNEILSKFSSSDDYYNYHYVVQ
                     KYENTTGSTGNKFNMSFYLHSYLKQVRGTSGLDFTFNLYRFNKYNIIDTHQSLSKVYL
                     KIGAYELAITHGLVAAIGILTKMYDCVSYYEPLYEFKNLRSFVQKINEYTDVKTSFES
                     TDFWEIVYTIAYATYSYDDHKHTLRAIDTWKLIVDLAPKFSPYVLKSKIHIRNFLLNK
                     SVY"
     gene            complement(86547..86981)
                     /locus_tag="BT0090"
                     /db_xref="GeneID:4642617"
     CDS             complement(86547..86981)
                     /locus_tag="BT0090"
                     /EC_number="3.6.3.14"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the K subunit is a
                     nonenzymatic component which binds the dimeric form by
                     interacting with the G and E subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit K"
                     /protein_id="YP_945101.1"
                     /db_xref="GI:119952892"
                     /db_xref="GeneID:4642617"
                     /translation="MNIGLIGVNSALAIAAIGSALGMGAAGSAAIGAWKRCYMQGKPA
                     PFLLIVFVSAPLTQIIYGYILMNTLAGIMTQADPWLLFGAGFGGGLAISISAFAQGRT
                     AAGACDAFAETGKGFATNLLVLGLIESVALFVMVFLMIFKFV"
     misc_feature    complement(86553..86981)
                     /locus_tag="BT0090"
                     /note="V-type ATP synthase subunit K; Validated; Region:
                     PRK06649"
                     /db_xref="CDD:180645"
     gene            complement(87003..88823)
                     /locus_tag="BT0091"
                     /db_xref="GeneID:4642159"
     CDS             complement(87003..88823)
                     /locus_tag="BT0091"
                     /EC_number="3.6.3.14"
                     /note="Produces ATP from ADP in the presence of a proton
                     gradient across the membrane. Subunit I is part of the
                     membrane proton channel."
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit I"
                     /protein_id="YP_945102.1"
                     /db_xref="GI:119952893"
                     /db_xref="GeneID:4642159"
                     /translation="MIVKMSKVLILTLLKYKKESLEILRELGVVHINFCNRVSESLEK
                     VIEERGILVQALSLLGDDSEVKLLSSSNENFLDVAKSIISLGSEIKDLRDMQQSLLHK
                     RDIISFWGYFSLELVNKLRESNIYVQFFKSGIAEYKKLLACSETKVALINNYKGTAYF
                     VAINYSKQTIDTAEEYEFEFDLDFIENKLRFVDEILDQKLTQLSILNKYRDVLRDEIK
                     EYDQIVEFEQVMADMDVACDNFVYITGFVPEDKREDLKNLKGKFVVQFAEPDDDVVPT
                     YIKRRGIAKLAKPIFDVLDTIPGYKERDVSCVFMLFFFMFFGMIIGDAAYGIIFLLVG
                     IFLSLGNFIKGKPLTSIHALIFYLSTSAIIYGSMTGTWFGSNPFILELFPILKSLKLG
                     YLTGTNGMQNIMFICFTIGVLQISLAHIWNFVQKVKEKPHIHSIAQIGWLIIMPGLYY
                     LVLNLILGKDRFPMHSIILNMIYGGVILVFIFEKQDGSNFFMCVLKSFGGIIEQFLAT
                     VSGFADIISYIRLFAVGLAGLAISDSFNSMSAALLKSSNIGLIISGIIVMLFGHILNI
                     TLSLLSVVVHGVRLNMLEFSNHLGQEWNGYSYRPFRKIKN"
     misc_feature    complement(87006..88823)
                     /locus_tag="BT0091"
                     /note="V-type ATP synthase subunit I; Validated; Region:
                     PRK05771"
                     /db_xref="CDD:235600"
     gene            complement(88834..89454)
                     /locus_tag="BT0092"
                     /db_xref="GeneID:4642190"
     CDS             complement(88834..89454)
                     /locus_tag="BT0092"
                     /EC_number="3.6.3.14"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the D subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit D"
                     /protein_id="YP_945103.1"
                     /db_xref="GI:119952894"
                     /db_xref="GeneID:4642190"
                     /translation="MASKKGLAMPKVKLTKNELKKQKDSLKMLGRYLPTLQLKKQQLY
                     LEIRKVEALKRARKLEQDRLKRDIKSWIALFGEKFTFQDWIQIKRVVRSFANIAGINI
                     PVFDFVEYEDIKHDLLLTPYWVDRGIEVIKSMIQINAELEVLDDQIRLLESELNTTSQ
                     RVNLFEKVMIPAAKINIKKINIYLGDQQTAAVVRGKMAKASLIKNR"
     misc_feature    complement(88837..89430)
                     /locus_tag="BT0092"
                     /note="V-type ATP synthase subunit D; Provisional; Region:
                     PRK02195"
                     /db_xref="CDD:179382"
     gene            complement(89433..90734)
                     /locus_tag="BT0093"
                     /db_xref="GeneID:4642485"
     CDS             complement(89433..90734)
                     /locus_tag="BT0093"
                     /EC_number="3.6.3.15"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the B subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit B"
                     /protein_id="YP_945104.1"
                     /db_xref="GI:119952895"
                     /db_xref="GeneID:4642485"
                     /translation="MKRVYSKIESIVGNVITVMAQNVKYGELAIVRSKDSSSLAEVIK
                     LDRDKVSLQVYNGTIGISTADEVKFLGHPMQVTFSENLLGRIFDGAGNPKDGGPRLED
                     DLIEIGGPSANPAKRIVPRNMIRTGIPMIDVFNTLVESQKLPIFSVSGEPYNELLIRI
                     ALQAEVDLIILGGMGLKNDDYLTFKDYLEKGGALSRTIFFVNTANDPVVESLTVPDIS
                     LAVAEKFALQGKKVLVLLTDMTNFADAMKEIAITMEQVPSNRGYPGDLYSQLASRYEK
                     AIDFEGAGSITILAVTTMPGDDITHPVPDNTGYITEGQYYLKGGRIEPFGSLSRLKQM
                     VNGKTRDDHRTIMDAMIKLYASSKESIEKKAMGFNMTEWDEKLIKYSGMFESKLMDLS
                     VNIPLEEALDLGWEILFSCFEPKETGIRTELVEKYWPQKKD"
     misc_feature    complement(89436..90734)
                     /locus_tag="BT0093"
                     /note="V-type ATP synthase subunit B; Provisional; Region:
                     PRK02118"
                     /db_xref="CDD:179373"
     misc_feature    complement(90522..90713)
                     /locus_tag="BT0093"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    complement(89742..90518)
                     /locus_tag="BT0093"
                     /note="V/A-type ATP synthase (non-catalytic) subunit B.
                     These ATPases couple ATP hydrolysis to the build up of a
                     H+ gradient, but V-type ATPases do not catalyze the
                     reverse reaction. The Vacuolar (V-type) ATPase is found in
                     the membranes of vacuoles, the golgi...; Region:
                     V_A-ATPase_B; cd01135"
                     /db_xref="CDD:238555"
     misc_feature    complement(90273..90296)
                     /locus_tag="BT0093"
                     /note="Walker A motif homologous position; other site"
                     /db_xref="CDD:238555"
     misc_feature    complement(90021..90032)
                     /locus_tag="BT0093"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238555"
     gene            complement(90744..92474)
                     /locus_tag="BT0094"
                     /db_xref="GeneID:4642696"
     CDS             complement(90744..92474)
                     /locus_tag="BT0094"
                     /EC_number="3.6.3.14"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the A subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit A"
                     /protein_id="YP_945105.1"
                     /db_xref="GI:119952896"
                     /db_xref="GeneID:4642696"
                     /translation="MEARGKVVGVIGNLVTIEIVGTVSMNEIVFIKTGGRSLKAEIIR
                     IRDGEVDAQVFEMTKGIAVGDDIEFTDKLLTVELGPGLLSQVYDGLQNPLSELAAQCG
                     FFLERGLYLSALDRSKKWSFNATAKVGDIVVAGDYLGFVVEGTIKHKIMVPFYRKDSY
                     KIVEIVSDGNYTVDDKIAVIENDAGGRHVITMSFHWPVKVPITSYKDRLIPSEPMVTQ
                     TRIIDTFFPVAKGGTFCIPGPFGAGKTVLQQVTSRNADVDVVIIAACGERAGEVVETL
                     KEFPELIDPRTGKSLMDRTCIICNTSSMPVAAREASVYTAITIGEYYRQMGLDILLLA
                     DSTSRWAQAMREMSGRLEEIPGEEAFPAYLESVIASFYERAGIVVLNDGNVGSVTVGG
                     SVSPAGGNFEEPVTQATLKVVGAFHGLTRERSDARKFPAINPLESWSKYRGVVESEKT
                     GYARSFLAKGNEINQMMKVVGEEGISIGDFLVYLKSELLDACYLQQNSFDSVDTAVSP
                     ERQNYMFDILYDILQSDFKFENKLEARSFVNELRQNILDMNLNPFKEEKFNKLENTLK
                     DLVRSKKLDF"
     misc_feature    complement(90765..92474)
                     /locus_tag="BT0094"
                     /note="V-type ATP synthase subunit A; Provisional; Region:
                     PRK04192"
                     /db_xref="CDD:235248"
     misc_feature    complement(92265..92456)
                     /locus_tag="BT0094"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    complement(91152..92258)
                     /locus_tag="BT0094"
                     /note="V/A-type ATP synthase catalytic subunit A. These
                     ATPases couple ATP hydrolysis to the build up of a H+
                     gradient, but V-type ATPases do not catalyze the reverse
                     reaction.  The Vacuolar (V-type) ATPase is found in the
                     membranes of vacuoles, the golgi...; Region: V_A-ATPase_A;
                     cd01134"
                     /db_xref="CDD:238554"
     misc_feature    complement(91740..91763)
                     /locus_tag="BT0094"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238554"
     misc_feature    complement(91470..91484)
                     /locus_tag="BT0094"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238554"
     misc_feature    complement(<90885..91124)
                     /locus_tag="BT0094"
                     /note="ATP synthase alpha/beta chain, C terminal domain;
                     Region: ATP-synt_ab_C; pfam00306"
                     /db_xref="CDD:249758"
     gene            complement(92486..93031)
                     /locus_tag="BT0095"
                     /db_xref="GeneID:4642185"
     CDS             complement(92486..93031)
                     /locus_tag="BT0095"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945106.1"
                     /db_xref="GI:119952897"
                     /db_xref="GeneID:4642185"
                     /translation="MLSPYYYVMSSLPYLDLKIGKGGSISGFFDNIEIALSREDFLCL
                     KDLSESRFARGNLKVIDQFLEFEEMMRYTLATIRAEKLGFSRDVYLESSYFSSYYLGI
                     LKPLCLKENPFEVELGLDMLKWQFLTELEVGNDFNFEKLVIYLLKLMLVSRRSLFIEE
                     IGEKNFDDICQKLSMQMSKNF"
     gene            complement(93042..93638)
                     /locus_tag="BT0096"
                     /db_xref="GeneID:4642179"
     CDS             complement(93042..93638)
                     /locus_tag="BT0096"
                     /EC_number="3.6.3.14"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the E subunit is part of the
                     catalytic core of the ATP synthase complex"
                     /codon_start=1
                     /transl_table=11
                     /product="V-type ATP synthase subunit E"
                     /protein_id="YP_945107.1"
                     /db_xref="GI:119952898"
                     /db_xref="GeneID:4642179"
                     /translation="MQFEVKDLINKIKKDGLEEAEKLANEIILNAKRDAEAIVLKAES
                     DAKDLKMQAEAEANEYKRYSLEASRQAVRDLIIGTEKNIKSLFKTALKDSVSRVYDDN
                     FLRDLIIKVVDIWSKNDKIDIMLNESDFSNLLSVLRAKIGNRLDDAIEIKPFKGISKG
                     FTIQQRDGNLYYDFTSETVADILFEYLNPRFKEVIKLI"
     misc_feature    complement(93045..93638)
                     /locus_tag="BT0096"
                     /note="V-type ATP synthase subunit E; Provisional; Region:
                     PRK01558"
                     /db_xref="CDD:179302"
     misc_feature    complement(93054..93635)
                     /locus_tag="BT0096"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     gene            complement(93749..94144)
                     /locus_tag="BT0097"
                     /db_xref="GeneID:4642658"
     CDS             complement(93749..94144)
                     /locus_tag="BT0097"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945108.1"
                     /db_xref="GI:119952899"
                     /db_xref="GeneID:4642658"
                     /translation="MGISRFEEFENALFKICLDVDCVLEDEFGNSYKVHPSRLSRGKA
                     ANGLLDGLFRVTTSFTLGYGSKFGRGYLVIIEIITLDMVDIEFSNRVIERGIKVFGEK
                     LKERFPGKKLFIVHDINVYKIIGDFFSGV"
     gene            complement(94145..96505)
                     /locus_tag="BT0098"
                     /db_xref="GeneID:4642461"
     CDS             complement(94145..96505)
                     /locus_tag="BT0098"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="YP_945109.1"
                     /db_xref="GI:119952900"
                     /db_xref="GeneID:4642461"
                     /translation="MSLRDIRVMQEKYLEKIDFYQILSSVASYVAISDTLNLLGEQQI
                     LKTEEEINRVCCFVKLIKNLIEVYDEYPNSCLESISDSIILLLKEKSRISIEEIKNII
                     FFLREVLRIMLFLDRNEFKIQDEVEILKELLFVDPSLKHLLETLCKYIDLDELKIKRG
                     VVKNYDEIDFEIRNLDKKIEKQLKQIISLNSQYLTSTLIYYKSGKYTIALKSSFKNKI
                     KGNIISISSSGETFYIEPNDIVSENNRLGFLGFEKTRIVLKILQELSDEIRRHIVLLK
                     SLYNKFLYYDSLKARAIYGIRNQGVFPRFDSNINIINARHPLIQHAKSINFCPLNNKV
                     VVITGPNAGGKTATLKTVALLSAMFQFGIPVPVDESSTFKIFDNILVDIGDDQSIANS
                     LSTFSSHMNNIAYILKYATRDSLLIFDEFCSGTDIEQGQALAVAVLEHLININSCVII
                     STHYNALKYFAYTHEFVVNASMQMDLDKMEPNYNLMFSVPGESFAFSVASKSSIDANI
                     VLRAKEIHSSNKTGVNEILERLTKKEQEIHLLEEELKDKLKLIELKEIEINNIRNNII
                     LKEKDLEERLINEQKEFLKNSRKILENLVREIKEGSVCTTKNKEFISNITDNIITKTT
                     KIRLLNQEIATKIEFRVGDKVRVAGSNASGEIIGVTKKGFIVNTGVFKITVSSSNLEK
                     ILDDKKSKNDRDKNFSFSFENQDDELSLTVDIRGMRVVEAIDFLNRKIDNMLLRNVCK
                     FEIIHGKGEGLLMEGVHAFLRDVKFVKKYYFAHPSDGGVGKTIVEF"
     misc_feature    complement(94151..96481)
                     /locus_tag="BT0098"
                     /note="MutS2 family protein; Region: mutS2; TIGR01069"
                     /db_xref="CDD:130141"
     misc_feature    complement(95627..>96232)
                     /locus_tag="BT0098"
                     /note="MutS domain III; Region: MutS_III; pfam05192"
                     /db_xref="CDD:253074"
     misc_feature    complement(94994..95578)
                     /locus_tag="BT0098"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(95468..95491)
                     /locus_tag="BT0098"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(95147..95149,95246..95251,95354..95356,
                     95465..95473,95477..95482))
                     /locus_tag="BT0098"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(95354..95365)
                     /locus_tag="BT0098"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(95300..95341)
                     /locus_tag="BT0098"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(95246..95263)
                     /locus_tag="BT0098"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(95228..95239)
                     /locus_tag="BT0098"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(95141..95161)
                     /locus_tag="BT0098"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(94148..94372)
                     /locus_tag="BT0098"
                     /note="Smr domain; Region: Smr; pfam01713"
                     /db_xref="CDD:250812"
     gene            complement(96453..97394)
                     /locus_tag="BT0099"
                     /db_xref="GeneID:4642431"
     CDS             complement(96453..97394)
                     /locus_tag="BT0099"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="YP_945110.1"
                     /db_xref="GI:119952901"
                     /db_xref="GeneID:4642431"
                     /translation="MNDLRFEILWGVNNIYSIVNVNTNEIYEGVIKGKVLNTQDKEYS
                     PLVPGDFVCGDIYDEGKVYIKERLKRKSVLWRYNKKAALRQVIVSNIDNVLIVSSANL
                     PEIKNSFIDRALVVAEEQGITPIILINKIDEGISTKVDTLIKIYENLGYRVIKTSAIT
                     LQGIEEIKEIIKNSRASFVGQSGVGKSSLINEVDLNAAQAINEISYKYSRGRHTTVYA
                     MAFHSDNGVVIDTPGIKEFGIESLEPLKLRYYFREFKDLNDFCRFNSCLHANEPNCFI
                     MNQIGFRISEVRYNSYLKIINELKRYKSYAREIFGKN"
     misc_feature    complement(97167..97349)
                     /locus_tag="BT0099"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    complement(order(97305..97307,97311..97313,97341..97343))
                     /locus_tag="BT0099"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(96504..97259)
                     /locus_tag="BT0099"
                     /note="ribosome small subunit-dependent GTPase A; Region:
                     TIGR00157"
                     /db_xref="CDD:232848"
     misc_feature    complement(96504..97130)
                     /locus_tag="BT0099"
                     /note="Ribosomal interacting GTPase YjeQ/EngC, a
                     circularly permuted subfamily of the Ras GTPases; Region:
                     YjeQ_EngC; cd01854"
                     /db_xref="CDD:206747"
     misc_feature    complement(order(96510..96512,96522..96524,96531..96533,
                     96639..96641,96645..96647,96657..96659,96942..96944,
                     97038..97043,97050..97055,97059..97064,97071..97076))
                     /locus_tag="BT0099"
                     /note="GTPase/Zn-binding domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(order(96831..96848,96921..96926,96996..97001,
                     97005..97010))
                     /locus_tag="BT0099"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206747"
     misc_feature    complement(96999..97010)
                     /locus_tag="BT0099"
                     /note="G4 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(96918..96926)
                     /locus_tag="BT0099"
                     /note="G5 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(96834..96857)
                     /locus_tag="BT0099"
                     /note="G1 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(96738..96761)
                     /locus_tag="BT0099"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(96750..96752)
                     /locus_tag="BT0099"
                     /note="G2 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(96696..96707)
                     /locus_tag="BT0099"
                     /note="G3 box; other site"
                     /db_xref="CDD:206747"
     misc_feature    complement(96693..96701)
                     /locus_tag="BT0099"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206747"
     gene            complement(97391..98155)
                     /locus_tag="BT0100"
                     /db_xref="GeneID:4642552"
     CDS             complement(97391..98155)
                     /locus_tag="BT0100"
                     /EC_number="5.1.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="YP_945111.1"
                     /db_xref="GI:119952902"
                     /db_xref="GeneID:4642552"
                     /translation="MSNLKNVIVIFDSGVGGLSYFEYISKRFVKRNYVYVADNKNFPY
                     GEKSSDFLLKEILELILKLEQMYNVAAIVIACNTASISVYDKLNFSFPVIYTLPSVCL
                     VEELAYKRVILVATHATINSKFIQREKDCHWDLILKPASELVNFVEYGDRFKEDALKY
                     LNFLKLEVKASRRDMVFLGCTHYLHIKDMIENFLGIPVYENRELVTNELIKELKSIES
                     RDDCFTRYFYLTQDENLYFYKNFCKKYGLHFKGIIN"
     misc_feature    complement(97403..98155)
                     /locus_tag="BT0100"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:260472"
     gene            98298..99683
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /db_xref="GeneID:4642199"
     CDS             98298..99683
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /EC_number="6.1.1.22"
                     /note="catalyzes a two-step reaction, first charging an
                     asparagine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginyl-tRNA synthetase"
                     /protein_id="YP_945112.1"
                     /db_xref="GI:119952903"
                     /db_xref="GeneID:4642199"
                     /translation="MHKSIKEILNNPILDSIITVKGWIRTKRSNGKISFVEINDGSNI
                     KGIQAIINEEDHQFEKKELKKLTTGASISLTGILILSPAKGQTYEIKTTNFNIIGEAD
                     QETYLLQKKRHTFEFLREIPHLRIRTNTFGAVARIRNQISYKIHEYFQKNGFLYIHTP
                     IITSNDGEGAGEIFRVSTLDFNNITNGKEVDFKDDFFGKQAFLTVTGQLHGEAYAMAL
                     SKIYTFGPTFRAENSNTTRHASEFWMIEPEMAFFTLEDNINLAENFLKYILKETLNNC
                     NQDIEFFDNFIEKGLIKKIEDVINSNFEVITYTQAIKQLENATKTFEIKPYWGMDLQT
                     EHERYLTEEIIKKPAIVIDYPKEFKAFYMKMNEDGKTVKGMDILVPRIGEIIGGSERE
                     DNLDKLNKRIKELNLEIETLNWYLDLRRFGSTPHSGFGLGLERLIQYITGMANIRDVI
                     PFPRTPKTLYF"
     misc_feature    98298..99680
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="asparaginyl-tRNA synthetase; Validated; Region:
                     asnC; PRK03932"
                     /db_xref="CDD:235176"
     misc_feature    98349..98597
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="EcAsnRS_like_N: N-terminal, anticodon recognition
                     domain of the type found in Escherichia coli
                     asparaginyl-tRNA synthetase (AsnRS) and, in Arabidopsis
                     thaliana and Saccharomyces cerevisiae mitochondrial (mt)
                     AsnRS. This domain is a beta-barrel domain (OB...; Region:
                     EcAsnRS_like_N; cd04318"
                     /db_xref="CDD:239813"
     misc_feature    order(98364..98366,98418..98420,98508..98510,98592..98594)
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239813"
     misc_feature    order(98373..98375,98379..98384,98400..98402,98439..98441,
                     98445..98447,98496..98498,98538..98540,98562..98564)
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="putative anticodon binding site; other site"
                     /db_xref="CDD:239813"
     misc_feature    98631..99668
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="Asx tRNA synthetase (AspRS/AsnRS) class II core
                     domain.  Assignment to class II aminoacyl-tRNA synthetases
                     (aaRS) based upon its structure and the presence of three
                     characteristic sequence motifs in the core domain. This
                     family includes AsnRS as well as...; Region: AsxRS_core;
                     cd00776"
                     /db_xref="CDD:238399"
     misc_feature    order(98658..98660,98664..98666,98676..98678,98691..98693,
                     98709..98714,98721..98723,98733..98735,98754..98756,
                     98763..98765,98769..98771,98775..98783,98787..98789,
                     98874..98879,98883..98891,98925..98927,98934..98936,
                     98943..98954,99015..99020,99045..99050,99063..99065,
                     99546..99548,99555..99566,99657..99665)
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238399"
     misc_feature    98775..98789
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="motif 1; other site"
                     /db_xref="CDD:238399"
     misc_feature    98979..98990
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="motif 2; other site"
                     /db_xref="CDD:238399"
     misc_feature    order(98982..98984,98988..98990,99006..99011,99447..99449,
                     99456..99458,99591..99593,99600..99602)
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="active site"
                     /db_xref="CDD:238399"
     misc_feature    99591..99602
                     /gene="asnC"
                     /locus_tag="BT0101"
                     /note="motif 3; other site"
                     /db_xref="CDD:238399"
     gene            99707..100285
                     /locus_tag="BT0102"
                     /db_xref="GeneID:4642697"
     CDS             99707..100285
                     /locus_tag="BT0102"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945113.1"
                     /db_xref="GI:119952904"
                     /db_xref="GeneID:4642697"
                     /translation="MKIKILCQITLTLSALMLFSNEKFENNLKIFSNVEKEITGKKSN
                     YQYSKEKPRINKSNKINYPHKKEDYHHNIIKKKDTNLQIDKTNKKQDVQKPINNIVKI
                     RKSNKIYYPQDKNNIQTSKSKKNIWYNIKVYSTHTKDRFKKIKALNKINTQIENNFAL
                     IGPILEDYLGEITKALHVIGYSELEYIKVEQN"
     gene            complement(100282..100872)
                     /locus_tag="BT0103"
                     /db_xref="GeneID:4642683"
     CDS             complement(100282..100872)
                     /locus_tag="BT0103"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="YP_945114.1"
                     /db_xref="GI:119952905"
                     /db_xref="GeneID:4642683"
                     /translation="MKKFVSYEEIRINGLKLAYKIYKNGFIPDIMYVSLRGGAYLGNI
                     ISEFFKFIKLEKPLLYAAVVARSYDISNKQKKIMIDGWTYDPKYLRAGDNVLFVDDIF
                     DTGRTIIHLREEVLKRGIDSQNVKIAVYDYKERGYVDYKPDYYVNKYSSEDELNTWIH
                     YSNHELIGLSEDEYKLSFLNLDDELNDILKFLSSKL"
     misc_feature    complement(100429..100833)
                     /locus_tag="BT0103"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(100552..100566,100570..100578,
                     100762..100764,100768..100770))
                     /locus_tag="BT0103"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(101226..102683)
                     /locus_tag="BT0104"
                     /db_xref="GeneID:4642636"
     CDS             complement(101226..102683)
                     /locus_tag="BT0104"
                     /EC_number="3.4.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="protease Do"
                     /protein_id="YP_945115.1"
                     /db_xref="GI:119952906"
                     /db_xref="GeneID:4642636"
                     /translation="MEVYKMKKNFISVFLASFLALTIGFFVGIHYLGSDKNTIVFAQE
                     KGDAGESLQDSFRKVSKKILPSTVEIYATGIVKTRDLFHLFFFFDIPGLNLEKKAQWG
                     GSGVIIGRDSKKTNLFYALTNSHVVDNAIEFEVGTYDNKTYKAKLVGKDDKKDIALVS
                     FEANDAAIEIAELGDSDMLEIGDWVIAVGSPHNFSFSVTAGIISGLHRSVNPNLKARN
                     SFIQTDAAINRGNSGGPLVNIKGEVIGINTWISASPSGGNLGLGFAVPINNAKSIFDV
                     LMSGKKSESAWMGVDLHRLRSKDPELLKSLGYEDNFESLAIIAGVYDGTSAFRAGLKA
                     GDVISKINDVSMNFFYDVKQYINDFYAKEKIKVEILRGKEKKNVEIELDVKPKISNEK
                     EYISELKLMPGFTVYPLTKEVRTQLGLRNWTNGVVVDSVDPTLGTNPKISTGDIIMVV
                     NSKSIKSLRDFYDAVEHGKNTYTVLRDGQTFKVSF"
     misc_feature    complement(101229..102524)
                     /locus_tag="BT0104"
                     /note="periplasmic serine protease, Do/DeqQ family;
                     Region: degP_htrA_DO; TIGR02037"
                     /db_xref="CDD:233695"
     misc_feature    complement(101946..102377)
                     /locus_tag="BT0104"
                     /note="Trypsin-like peptidase domain; Region: Trypsin_2;
                     pfam13365"
                     /db_xref="CDD:257693"
     misc_feature    complement(101544..101828)
                     /locus_tag="BT0104"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(101625..101630,101637..101642,
                     101799..101801,101814..101825))
                     /locus_tag="BT0104"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     misc_feature    complement(101229..101477)
                     /locus_tag="BT0104"
                     /note="PDZ domain of trypsin-like serine proteases, such
                     as DegP/HtrA, which are oligomeric proteins involved in
                     heat-shock response, chaperone function, and apoptosis.
                     May be responsible for substrate recognition and/or
                     binding, as most PDZ domains bind...; Region:
                     PDZ_serine_protease; cd00987"
                     /db_xref="CDD:238487"
     misc_feature    complement(order(101298..101303,101310..101315,
                     101466..101468,101472..101477))
                     /locus_tag="BT0104"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238487"
     gene            complement(102727..103479)
                     /locus_tag="BT0105"
                     /db_xref="GeneID:4642631"
     CDS             complement(102727..103479)
                     /locus_tag="BT0105"
                     /EC_number="3.4.11.18"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="YP_945116.1"
                     /db_xref="GI:119952907"
                     /db_xref="GeneID:4642631"
                     /translation="MKLRLKSRAEIEKIRASARLLAQTFLEIEKNIVPGINTKTLDLI
                     ASDFITKNGAKSAFKGYAGFKGTICASINEEVIHGIPGTRELKDGDVISIDCGVILDG
                     FYSDMAKTFKVGKVSPRVNKLLEVTEAALYRGIDEMKAGNRVLDISKAIENYIKPFGF
                     GIVRDYTGHGVGFALHEEPSVPNYYEPFFKNVRIQEGMVLAIEPMVNLGGHKVSVKND
                     DWTVFASDFSCSAHFEHTVAVVDGLPLILSKI"
     misc_feature    complement(102733..103449)
                     /locus_tag="BT0105"
                     /note="Methionine Aminopeptidase 1. E.C. 3.4.11.18. Also
                     known as methionyl aminopeptidase and Peptidase M.
                     Catalyzes release of N-terminal amino acids,
                     preferentially methionine, from peptides and arylamides;
                     Region: MetAP1; cd01086"
                     /db_xref="CDD:238519"
     misc_feature    complement(order(102778..102780,102871..102873,
                     102973..102975,103162..103164,103195..103197,
                     103246..103248))
                     /locus_tag="BT0105"
                     /note="active site"
                     /db_xref="CDD:238519"
     gene            complement(103484..105136)
                     /locus_tag="BT0106"
                     /db_xref="GeneID:4642605"
     CDS             complement(103484..105136)
                     /locus_tag="BT0106"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945117.1"
                     /db_xref="GI:119952908"
                     /db_xref="GeneID:4642605"
                     /translation="MKANKVLLFFILFLVLFISIFVYLSLNPYVLYMLKGELDFNEIL
                     VEVDGYLLNENLESAENAIRFYSYYADTEYKWLSLIKRAKLYSVKIKHYLLMRDILDL
                     SVKSLPGNLKLRALEVYSKLKVGAVLEAYDIAKQYLLGYKEYKHLYDEAFIKSLILSY
                     DVKDIKSFLIKMERERDALAFETIGLNLQNNAFLIDAMLLYIEKKDLDSAKRILLKIK
                     EDKDFSKELAYISYGLDNLDFTIANLKLNNSNEPSLMFLLADAYLKKGDINNAKIEYL
                     KLYTDFPDYSMMVYLGLAFIAKKENDLKRAIAYLNKANENFKENEMVNYYLANIYFEA
                     NDYFNANEIAKKYRDSPLFFKLYFVLNYANLKYEAKKSFLWRLFYRSNYSTDIAQLLA
                     WNLLLYSDLKDLDLFFKIYDSVDEVQDWYYFYKFYYFFLKKDLSVAEKIIIENQVGKY
                     LYGFYYNLGVLKLYQKNYKESEEYFSKTVSLLPFTLDDKSKITLREREDVAKVYLKRG
                     INYLYLGEFEKGREAILTSNFFYETNEGKLYMNMIEILKERN"
     misc_feature    complement(<104102..>104383)
                     /locus_tag="BT0106"
                     /note="putative PEP-CTERM system TPR-repeat lipoprotein;
                     Region: PEP_TPR_lipo; TIGR02917"
                     /db_xref="CDD:234059"
     gene            complement(105123..105563)
                     /gene="nusB"
                     /locus_tag="BT0107"
                     /db_xref="GeneID:4642558"
     CDS             complement(105123..105563)
                     /gene="nusB"
                     /locus_tag="BT0107"
                     /note="Regulates rRNA biosynthesis by transcriptional
                     antitermination"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusB"
                     /protein_id="YP_945118.1"
                     /db_xref="GI:119952909"
                     /db_xref="GeneID:4642558"
                     /translation="MVMDLRHKARVLAFQKIYSIDINCKAKDNIYDIFNLEDHGLELE
                     ENLKLFYSVLVNGTYDNLEFIDKLISDISLNWRLDRMDKVDLAILRMSVYSLKFQNLD
                     VPKRVIIDEAILIAKKYGSKNSYKFVNGILDALLKNMESSFESK"
     misc_feature    complement(105147..105548)
                     /gene="nusB"
                     /locus_tag="BT0107"
                     /note="Transcription termination factor NusB (N
                     protein-Utilization Substance B). NusB plays a key role in
                     the regulation of ribosomal RNA biosynthesis in eubacteria
                     by modulating the efficiency of transcriptional
                     antitermination. NusB along with other Nus...; Region:
                     Terminator_NusB; cd00619"
                     /db_xref="CDD:238342"
     misc_feature    complement(order(105534..105536,105546..105548))
                     /gene="nusB"
                     /locus_tag="BT0107"
                     /note="putative RNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238342"
     gene            complement(105583..106617)
                     /locus_tag="BT0108"
                     /db_xref="GeneID:4642447"
     CDS             complement(105583..106617)
                     /locus_tag="BT0108"
                     /codon_start=1
                     /transl_table=11
                     /product="basic membrane protein"
                     /protein_id="YP_945119.1"
                     /db_xref="GI:119952910"
                     /db_xref="GeneID:4642447"
                     /translation="MIDIKVIFMGNVLCFLLFFVVGITSFAQNTPVVIINLHSNEIIT
                     KTEFDSKVNTLKKTQGRDLSNAERKQVLQILIADVLFGQEALKQGIKVEDAEVMQTIR
                     TQFGLLNLTDEQIKQMVESQGTNWNELLSSMKRSLSAQKLILKMAQPKFSEIKIPGEK
                     EVVEYYEANKTKFVNPDIARISHVFFSSKDKKRSEVLANAKDIVNQIKSKKITFEEAV
                     RKYSNDEGSKVKNGDLGFLARGDQNAQNVLGLDFVKEVFMLKKGDISQPISSKEGFHI
                     VKVTEMYSQRFLGLQDKISPNVDMTVKDAIKNNMVNIHQQQIVARVQQEIYDKLNKSA
                     SIQILDSSLK"
     misc_feature    complement(105589..106584)
                     /locus_tag="BT0108"
                     /note="Parvulin-like peptidyl-prolyl isomerase
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: SurA; COG0760"
                     /db_xref="CDD:223831"
     misc_feature    complement(106192..106524)
                     /locus_tag="BT0108"
                     /note="SurA N-terminal domain; Region: SurA_N; pfam09312"
                     /db_xref="CDD:150092"
     misc_feature    complement(105775..106071)
                     /locus_tag="BT0108"
                     /note="PPIC-type PPIASE domain; Region: Rotamase;
                     pfam00639"
                     /db_xref="CDD:250020"
     gene            complement(106688..107893)
                     /locus_tag="BT0109"
                     /db_xref="GeneID:4642426"
     CDS             complement(106688..107893)
                     /locus_tag="BT0109"
                     /EC_number="2.3.1.9"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="YP_945120.1"
                     /db_xref="GI:119952911"
                     /db_xref="GeneID:4642426"
                     /translation="MGFCMRKIAIIDGLRSPITKFGGVLKGMNIVDVSSDIVKALLAR
                     NNIDKVDEVIVGNVISAGLGQNIARQIALKAGLGEIIPAFTVNKVCGSGLKSLELAFN
                     SIALGNSEIILAGGVEDLSNAPYLLPRGVRFDGLKFGDFKIEDSIYKDALVDTPSSTV
                     MGLTAENLAEMYEITREMQDQFAYNSHMKATAARDSGYFNDEIYPLSVFDKKTKLKSV
                     ICSDEEIRDSLSLEKLSSLKPVFKEGGTVTAGNSSSLDDGACFLILASEDFVCKMGLQ
                     PLAYVGGFKSVGLNPLHMGFGAFLAIKEIIEKFNLTPSEIDFIETNEAFAAQSLSVLK
                     ALRQKYDVRDSIINVNGGAIALGHPFSVSGSRILLTLARLIKINNKSKGIASLCIGGG
                     QGIAAFLYR"
     misc_feature    complement(106691..107869)
                     /locus_tag="BT0109"
                     /note="Thiolase are ubiquitous enzymes that catalyze the
                     reversible thiolytic cleavage of 3-ketoacyl-CoA into
                     acyl-CoA and acetyl-CoA, a 2-step reaction involving a
                     covalent intermediate formed with a catalytic cysteine.
                     They are found in prokaryotes and...; Region: thiolase;
                     cd00751"
                     /db_xref="CDD:238383"
     misc_feature    complement(106697..107866)
                     /locus_tag="BT0109"
                     /note="acetyl-CoA acetyltransferases; Region:
                     AcCoA-C-Actrans; TIGR01930"
                     /db_xref="CDD:233642"
     misc_feature    complement(order(106718..106723,106970..106972,
                     107030..107032,107036..107038,107042..107044,
                     107531..107533,107576..107578,107585..107590,
                     107609..107611,107633..107644,107675..107677,
                     107687..107689,107696..107698,107738..107740,
                     107813..107815))
                     /locus_tag="BT0109"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238383"
     misc_feature    complement(order(106730..106732,106820..106822,
                     107624..107626))
                     /locus_tag="BT0109"
                     /note="active site"
                     /db_xref="CDD:238383"
     gene            108057..109412
                     /locus_tag="BT0110"
                     /db_xref="GeneID:4642709"
     CDS             108057..109412
                     /locus_tag="BT0110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945121.1"
                     /db_xref="GI:119952912"
                     /db_xref="GeneID:4642709"
                     /translation="MYLAKLNLKMIIIMLAINSYAYNHLIKYQNDRVDKYHFNNLNDG
                     LGFALCDFFDDLRSGSLIFIHESKYNFMINAEAHMLTFRGNKDSPEQLRTRVDLLEIG
                     FMYYFPFSIKTKTQYFGNIDIGIGIKNLIYGNWGGALIQQAVHFTLRQLRPIPKNYEN
                     YNYRGFLSTAINYSYMKFFNLENYIDLSYFADYFFKTSIAMDFKNESIGIETKLFYQT
                     QSKINSIETYSKTQEAETGIGIQYRLHSKNFFTINNLNLNNFSTKEKFFSVGGFGIIF
                     TEEYDNTLEDNLYLLNQNFSFGFDIMIPFQTRNLIYYIIIPSLKYYFAIATNYDINLA
                     EFNSRTNRFSSGLMYELFTKNRFILYICSGIFVSYNKDKKDIKAIYRPLKIKDTLQAG
                     LEIEPGILIETLKYNKVKYNAKIFTKINYHPIVYNTTNYNLETHKLNFNYLGIGITIN
                     I"
     gene            complement(109514..110899)
                     /locus_tag="BT0111"
                     /db_xref="GeneID:4642489"
     CDS             complement(109514..110899)
                     /locus_tag="BT0111"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="YP_945122.1"
                     /db_xref="GI:119952913"
                     /db_xref="GeneID:4642489"
                     /translation="MAFTSVSTASTLLFNEGAEKAVISSIFYNPGKVEEALLYLKPDD
                     FYSQNHEMIFKAMISLYEKRENIDPITVFEEVSSLTPKSQLLSNFKALTGLQDYLSFL
                     SGYLPTDKTINVYAKIVKEHRIRRDISKISRELNDLANDSTKKVEQFVEEAQRHILSI
                     ELDCSSKNLNHAKIIAERVHAEIYERSMKKREVNFGIPSGFKKVDSLIGGFRESDFII
                     IGARPSVGKTAFALNIASSIALRNDKKRKVGFFSLEMTSDALIKRIIAAQANIDSFKI
                     QNSILSGHEIKAINDVVNDISNSEFYIEDTANISLLTLATQARKLKRFSDIDILFVDY
                     ISLISLEARNVPRHEQVASISKALKELARELKIPIVALSQLTRDTEGREPSLASLRES
                     GALEQDADIVILLHRDKDLKSGSDDERVISAIDTKIIVAKHRNGPTGRADILFLPHVV
                     KFVNKEHENDY"
     misc_feature    complement(110537..110869)
                     /locus_tag="BT0111"
                     /note="DnaB-like helicase N terminal domain; Region: DnaB;
                     pfam00772"
                     /db_xref="CDD:250122"
     misc_feature    complement(109529..110848)
                     /locus_tag="BT0111"
                     /note="replicative DNA helicase; Region: DnaB; TIGR00665"
                     /db_xref="CDD:233080"
     misc_feature    complement(109559..110296)
                     /locus_tag="BT0111"
                     /note="DnaB helicase C terminal domain. The hexameric
                     helicase DnaB unwinds the DNA duplex at the  chromosome
                     replication fork. Although the mechanism by which DnaB
                     both couples ATP hydrolysis to translocation along DNA and
                     denatures the duplex is unknown, a...; Region: DnaB_C;
                     cd00984"
                     /db_xref="CDD:238484"
     misc_feature    complement(110216..110236)
                     /locus_tag="BT0111"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    complement(order(109565..109567,109598..109600,
                     109679..109681,109778..109780,109901..109903,
                     110216..110221))
                     /locus_tag="BT0111"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238484"
     misc_feature    complement(109901..109912)
                     /locus_tag="BT0111"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    complement(order(109640..109645,109679..109684,
                     109757..109783,109856..109864,109883..109888))
                     /locus_tag="BT0111"
                     /note="DNA binding loops [nucleotide binding]"
                     /db_xref="CDD:238484"
     gene            complement(110916..111413)
                     /gene="rplI"
                     /locus_tag="BT0112"
                     /db_xref="GeneID:4642478"
     CDS             complement(110916..111413)
                     /gene="rplI"
                     /locus_tag="BT0112"
                     /note="in Escherichia coli this protein is wrapped around
                     the base of the L1 stalk"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="YP_945123.1"
                     /db_xref="GI:119952914"
                     /db_xref="GeneID:4642478"
                     /translation="MMRVILKEDFINLGKEGDIVDVKDGFARNYLLPKGFAVFSDKHN
                     IDIFNQKRRSILKRQETRKKAALELKEKLDKINLEFVMQSNDSGKLFHSINSLNIADE
                     LLKLGFEIERRKIDIHHGTLKTFGIYDVTIKLYEGINSVIKVEIKREEKKHSLKKSKS
                     VEKEV"
     misc_feature    complement(110967..111410)
                     /gene="rplI"
                     /locus_tag="BT0112"
                     /note="ribosomal protein L9; Region: L9; TIGR00158"
                     /db_xref="CDD:129262"
     misc_feature    complement(111270..111410)
                     /gene="rplI"
                     /locus_tag="BT0112"
                     /note="Ribosomal protein L9, N-terminal domain; Region:
                     Ribosomal_L9_N; pfam01281"
                     /db_xref="CDD:250502"
     misc_feature    complement(110967..111227)
                     /gene="rplI"
                     /locus_tag="BT0112"
                     /note="Ribosomal protein L9, C-terminal domain; Region:
                     Ribosomal_L9_C; pfam03948"
                     /db_xref="CDD:252268"
     gene            complement(111420..111713)
                     /gene="rpsR"
                     /locus_tag="BT0113"
                     /db_xref="GeneID:4642289"
     CDS             complement(111420..111713)
                     /gene="rpsR"
                     /locus_tag="BT0113"
                     /note="binds as a heterodimer with protein S6 to the
                     central domain of the 16S rRNA; helps stabilize the
                     platform of the 30S subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="YP_945124.1"
                     /db_xref="GI:119952915"
                     /db_xref="GeneID:4642289"
                     /translation="MYKDIDSHQRDSRTDGHQDGFKKNPNFRFFKKKTCRFCDMDRVP
                     DYKEFDFLKKFVTEQGKILPRRITGTSAKHQRRLALEVKKARYMALLPFVKKY"
     misc_feature    complement(111426..111659)
                     /gene="rpsR"
                     /locus_tag="BT0113"
                     /note="30S ribosomal protein S18; Reviewed; Region: rpsR;
                     PRK00391"
                     /db_xref="CDD:178997"
     gene            complement(111726..112163)
                     /locus_tag="BT0114"
                     /db_xref="GeneID:4642459"
     CDS             complement(111726..112163)
                     /locus_tag="BT0114"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand DNA binding protein"
                     /protein_id="YP_945125.1"
                     /db_xref="GI:119952916"
                     /db_xref="GeneID:4642459"
                     /translation="MADINSLVLSGRLTRDSELTYTEAGMAILKFGLANNRRVKKNDE
                     WMDYAQFFDCTLFGKRAESLASFLKKGKQVVISGSLRYESWQDKNTGDKKNRCSVLVD
                     DIQMFGSLITTKGANDVGFESYKKPDSFTDIGFDDGFNEDIPF"
     misc_feature    complement(111729..112160)
                     /locus_tag="BT0114"
                     /note="Single-stranded DNA-binding protein [DNA
                     replication, recombination, and repair]; Region: Ssb;
                     COG0629"
                     /db_xref="CDD:223702"
     misc_feature    complement(111846..112142)
                     /locus_tag="BT0114"
                     /note="SSB_OBF: A subfamily of OB folds similar to the OB
                     fold of ssDNA-binding protein (SSB). SSBs bind with high
                     affinity to ssDNA. They bind to and protect ssDNA
                     intermediates during DNA metabolic pathways. All bacterial
                     and eukaryotic SSBs studied to date...; Region: SSB_OBF;
                     cd04496"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(111873..111875,111882..111884,
                     111918..111920,111945..111947,112008..112010,
                     112014..112016,112053..112061,112134..112142))
                     /locus_tag="BT0114"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(111864..111866,111870..111872,
                     111912..111917,111921..111923,111927..111929,
                     111951..111956,111993..111995,111999..112001,
                     112005..112007,112011..112013,112017..112022,
                     112050..112055,112074..112076,112104..112106,
                     112122..112130))
                     /locus_tag="BT0114"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     misc_feature    complement(order(111849..111851,111933..111935,
                     111939..111941,111945..111947))
                     /locus_tag="BT0114"
                     /note="tetramer (dimer of dimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239942"
     gene            complement(112175..112576)
                     /gene="rpsF"
                     /locus_tag="BT0115"
                     /db_xref="GeneID:4642297"
     CDS             complement(112175..112576)
                     /gene="rpsF"
                     /locus_tag="BT0115"
                     /note="binds cooperatively with S18 to the S15-16S
                     complex, allowing platform assembly to continue with S11
                     and S21"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="YP_945126.1"
                     /db_xref="GI:119952917"
                     /db_xref="GeneID:4642297"
                     /translation="MIKKYEACFLFKSEELEYKAALEEVKKQLTVFNASDFAENSLGE
                     RALEYPIRKQLRGRYEIIEFKMDSENLKELEIQLKLIKNLLRHMILVKINKKVSVKKV
                     KRRNFREFKDNRDIKEKESSEFNSNVDVKVD"
     misc_feature    complement(112307..112570)
                     /gene="rpsF"
                     /locus_tag="BT0115"
                     /note="Ribosomal protein S6; Region: Ribosomal_S6;
                     cl00414"
                     /db_xref="CDD:260412"
     gene            complement(112908..114617)
                     /locus_tag="BT0116"
                     /db_xref="GeneID:4642883"
     CDS             complement(112908..114617)
                     /locus_tag="BT0116"
                     /EC_number="2.7.1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, glucose-specific IIABC component"
                     /protein_id="YP_945127.1"
                     /db_xref="GI:119952918"
                     /db_xref="GeneID:4642883"
                     /translation="MERSRVINFLKVFRFANLQKFSSAVRLPISVVTIFCLMLGIGSA
                     LLNPSNLFYVDNFVVKLVLGLIKSTSNIIILNIPLLFVIGITVGVARAQKGPAALSGL
                     VGYLIFNITENYFLDVFARLVDPNLMSSVGQVNILGIQTLNTGILGSLSVGLLVGYLH
                     NKFYCIELPGPLNFFSGFRFVPIVVFPFCILLGIIFVLIWPYFNELITSFGFFIAKFN
                     YLNSFLYGFLNRLLIPLGLHSILTFPFNFTSLGGTEVIDGQVVGGIQNIFYAQLADPY
                     LVRFSPSISRFNSGFYLSIMFGLPGAALGVYRGIIHDDKSKIVPLLFSGAFAAFLTGI
                     TEPLEFLFVFTAPLLYFIHAIYTGFALLIANVLDIAVGVTFSAGFFDFLMFGVLQGHA
                     KTNWLYLLPLGFAFFALYYFTFKWVYNYFDFQIFGVDEPFFAGSEGEVEGMGIAHLIA
                     QGLGGLDNIQEFNVISTNLMFVVFSPELISEDFLKKTGALNIVTIDNTIKIDYGTNVY
                     YIKQAIKNYSPERLFKASAIVASDNVKHGIKAYIEMKEDDKLERQGSTGKVYKLNKDD
                     EDN"
     misc_feature    complement(113076..114566)
                     /locus_tag="BT0116"
                     /note="bifunctional PTS system maltose and
                     glucose-specific transporter subunits IICB; Provisional;
                     Region: PRK10110"
                     /db_xref="CDD:182245"
     misc_feature    complement(113301..114560)
                     /locus_tag="BT0116"
                     /note="Phosphotransferase system IIC components,
                     glucose/maltose/N-acetylglucosamine-specific [Carbohydrate
                     transport and metabolism]; Region: PtsG; COG1263"
                     /db_xref="CDD:224183"
     misc_feature    complement(113067..113285)
                     /locus_tag="BT0116"
                     /note="PTS_IIB, PTS system, glucose/sucrose specific IIB
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIB_glc; cl00164"
                     /db_xref="CDD:260229"
     misc_feature    complement(113208..113228)
                     /locus_tag="BT0116"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    complement(113223..113225)
                     /locus_tag="BT0116"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     gene            114845..115531
                     /locus_tag="BT0117"
                     /db_xref="GeneID:4642517"
     CDS             114845..115531
                     /locus_tag="BT0117"
                     /note="hemolysin III-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945128.1"
                     /db_xref="GI:119952919"
                     /db_xref="GeneID:4642517"
                     /translation="MFEKNKKYTSYNEPIPKNELFSSISHLFGIILSIIGTTILITLS
                     THSKKYLHAVLFLIYGSSMTLLYTMSTLYHIFTKGSKIKQLFRKFDHISIFILIAGTY
                     TPPCLILMPNAYGKIILITVWGFAILGIIFKSIYVNSPGWLNGCIFILMGWSIIFGIR
                     LIYNILPIQGFLWLALGGILYTLGGIIYSASKKLNPIANMRMHDFFHILILFASFAHF
                     WFMFKYVLPY"
     misc_feature    114896..115519
                     /locus_tag="BT0117"
                     /note="channel protein, hemolysin III family; Region:
                     hlyIII; TIGR01065"
                     /db_xref="CDD:233258"
     gene            complement(115576..116859)
                     /locus_tag="BT0118"
                     /db_xref="GeneID:4642738"
     CDS             complement(115576..116859)
                     /locus_tag="BT0118"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane metalloprotease"
                     /protein_id="YP_945129.1"
                     /db_xref="GI:119952920"
                     /db_xref="GeneID:4642738"
                     /translation="MMYIFLSILAFTFIIFIHELGHLFFAKLFKVKVEVFSIGIGPSL
                     FKFKIKDTEYRFSPIFLGGYCKLKGAEHLENELRLNRQLEADKDSIFGISNFKKILIY
                     FAGPLFNLIFALIVFIAIEMIGIVYPDYFNKIVVINNSVLSKFRDGDVILSVNNSGIR
                     YFSDLNKVVPLKDSRVTFIVLRDSKTISFEDYTSFDKLLKEIGPWINLIISKVKTNSS
                     AEVAGLKPNDKIISINDVILNNNVELNNLIEKLDSNVVDIKYERNGEILTSRLVFQDT
                     NKSLGVYLLPGLERVVKSDNLGIAIKNSFNKVLNILGHILYSIVALFTNFKNNAKNVT
                     GPVGMINIFIDSFSAGILSWFNTIAIFNLLIAGMNLFFVVIPMLDGGQILISLIEILR
                     GKRFRAKVIYYFYIFGILLMLSLFILGFFNDLRNL"
     misc_feature    complement(115579..116856)
                     /locus_tag="BT0118"
                     /note="RIP metalloprotease RseP; Region: TIGR00054"
                     /db_xref="CDD:232801"
     misc_feature    complement(<116500..116850)
                     /locus_tag="BT0118"
                     /note="RseP-like Site-2 proteases (S2P), zinc
                     metalloproteases (MEROPS family M50A), cleave
                     transmembrane domains of substrate proteins, regulating
                     intramembrane proteolysis (RIP) of diverse signal
                     transduction mechanisms. In Escherichia coli, the S2P
                     homolog...; Region: S2P-M50_PDZ_RseP-like; cd06163"
                     /db_xref="CDD:100084"
     misc_feature    complement(order(116794..116796,116803..116808))
                     /locus_tag="BT0118"
                     /note="active site"
                     /db_xref="CDD:100084"
     misc_feature    complement(116290..116493)
                     /locus_tag="BT0118"
                     /note="PDZ domain, also called DHR (Dlg homologous region)
                     or GLGF (after a conserved sequence motif). Many PDZ
                     domains bind C-terminal polypeptides, though binding to
                     internal (non-C-terminal) polypeptides and even to lipids
                     has been demonstrated; Region: PDZ; cl00117"
                     /db_xref="CDD:260201"
     misc_feature    complement(order(116350..116355,116362..116364,
                     116479..116481,116485..116493))
                     /locus_tag="BT0118"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238080"
     misc_feature    complement(116041..116253)
                     /locus_tag="BT0118"
                     /note="PDZ domain of bacterial and plant zinc
                     metalloprotases, presumably membrane-associated or
                     integral membrane proteases, which may be involved in
                     signalling and regulatory mechanisms. May be responsible
                     for substrate recognition and/or binding, as most PDZ...;
                     Region: PDZ_metalloprotease; cd00989"
                     /db_xref="CDD:238489"
     misc_feature    complement(115582..>115797)
                     /locus_tag="BT0118"
                     /note="Site-2 protease (S2P) class of zinc
                     metalloproteases (MEROPS family M50) cleaves transmembrane
                     domains of substrate proteins, regulating intramembrane
                     proteolysis (RIP) of diverse signal transduction
                     mechanisms. Members of this family use proteolytic...;
                     Region: S2P-M50; cl10020"
                     /db_xref="CDD:245232"
     misc_feature    complement(order(115738..115740,115747..115755))
                     /locus_tag="BT0118"
                     /note="putative substrate binding region [chemical
                     binding]; other site"
                     /db_xref="CDD:100078"
     gene            complement(116873..117829)
                     /locus_tag="BT0119"
                     /db_xref="GeneID:4642393"
     CDS             complement(116873..117829)
                     /locus_tag="BT0119"
                     /EC_number="2.7.7.41"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="YP_945130.1"
                     /db_xref="GI:119952921"
                     /db_xref="GeneID:4642393"
                     /translation="MNLFFQVFCGQSIPFRIMIKTWNVLKIGRGILGDKSLFNLRSKK
                     LAFVARLGTFLFFVPLVLFLIFLEFNNYLFINILIFMFSGVAAKEVNDLLRVKSSSIS
                     STLSFFLGIAPPILTYVHCNVFDLGINIIFYLVITLVFSNWIVNLVFIKENEIVNFLS
                     QATSIIFILIYPGVLMSFVVAITTLPRAPILLLILFSMVSGNDTFAYLVGYFFGKNSY
                     RPTIISPNKTIMGFLGGILFSVIVAIVVVCLGLINLTYGEAMIFGVLIGFFTIIGDLF
                     ESGLKRSAGVKDSGNIIPGRGGALDSIDSYLLTGPIFYLYLS"
     misc_feature    complement(116876..117682)
                     /locus_tag="BT0119"
                     /note="CDP-diglyceride synthetase [Lipid metabolism];
                     Region: CdsA; COG0575"
                     /db_xref="CDD:223648"
     gene            complement(117726..118418)
                     /locus_tag="BT0120"
                     /db_xref="GeneID:4642189"
     CDS             complement(117726..118418)
                     /locus_tag="BT0120"
                     /EC_number="2.5.1.31"
                     /note="catalyzes the formation of undecaprenyl
                     pyrophosphate from isopentenyl pyrophosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl pyrophosphate synthase"
                     /protein_id="YP_945131.1"
                     /db_xref="GI:119952922"
                     /db_xref="GeneID:4642189"
                     /translation="MNNNSLPMHVGIIMDGNRRWALKRGLSLFEGHKEGLKRAKEIVK
                     YSLKLGIKYLSLYVFSTENWNRTKSEIKHLMFVIADYLSSEFEFYSTNNIKILVSGEI
                     EALSKEVRKSIIDAIDFTKNFDGLVLNLAINYGGRNEIVRATKKILGSGLQCETLDEI
                     VFSKFLDNPELCDLDLLIRTGGDMRISNFLLWRIAYCEFVFSSVLWPEYSVSHYDKDL
                     ECFKNRKRNFGR"
     misc_feature    complement(117750..118394)
                     /locus_tag="BT0120"
                     /note="Cis (Z)-Isoprenyl Diphosphate Synthases; Region:
                     Cis_IPPS; cd00475"
                     /db_xref="CDD:259850"
     misc_feature    complement(order(117858..117860,117864..117866,
                     117882..117884,118029..118031,118176..118178,
                     118185..118190,118209..118211,118221..118223,
                     118245..118247,118302..118304,118311..118313,
                     118323..118325,118335..118337,118362..118379))
                     /locus_tag="BT0120"
                     /note="active site"
                     /db_xref="CDD:259850"
     misc_feature    complement(order(117816..117818,117822..117836,
                     117840..117848,117855..117869,117900..117902,
                     117933..117935,117942..117950,117984..117989,
                     117996..118001,118005..118010))
                     /locus_tag="BT0120"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259850"
     gene            complement(118423..118977)
                     /gene="frr"
                     /locus_tag="BT0121"
                     /db_xref="GeneID:4642559"
     CDS             complement(118423..118977)
                     /gene="frr"
                     /locus_tag="BT0121"
                     /note="RRF; Rrf; Frr; ribosome-recycling factor; release
                     factor 4; RF4; recycles ribosomes upon translation
                     termination along with release factor RF-3 and elongation
                     factor EF-G; A GTPase-dependent process results in release
                     of 50S from 70S; inhibited by release factor RF-1;
                     essential for viability; structurally similar to tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome recycling factor"
                     /protein_id="YP_945132.1"
                     /db_xref="GI:119952923"
                     /db_xref="GeneID:4642559"
                     /translation="MEEYKALLDEKMSKVLLSLESEYKSLRTGRINSSLFDKVLVDYY
                     GEKTPLTRVANVSIPEARLIVIQPWDKSLLSKIEQAILSSDLSMNPSSDGAVLRIKVP
                     VLTVERRKEIVKQAKKIAEEYKVAARNVRQELNSKAKKQEKDSQITEDDLRRILDDIQ
                     RDTNSYIKKIDEIFDLKTKEIMEV"
     misc_feature    complement(118432..118968)
                     /gene="frr"
                     /locus_tag="BT0121"
                     /note="Ribosome recycling factor (RRF). Ribosome recycling
                     factor dissociates the posttermination complex, composed
                     of the ribosome, deacylated tRNA, and mRNA, after
                     termination of translation.  Thus ribosomes are 'recycled'
                     and ready for another...; Region: RRF; cd00520"
                     /db_xref="CDD:238288"
     misc_feature    complement(order(118666..118677,118885..118896))
                     /gene="frr"
                     /locus_tag="BT0121"
                     /note="hinge region; other site"
                     /db_xref="CDD:238288"
     gene            complement(119014..119850)
                     /gene="tsf"
                     /locus_tag="BT0122"
                     /db_xref="GeneID:4642200"
     CDS             complement(119014..119850)
                     /gene="tsf"
                     /locus_tag="BT0122"
                     /note="EF-Ts; functions during elongation stage of protein
                     translation; forms a dimer; associates with EF-Tu-GDP
                     complex and promotes exchange of GDP to GTP resulting in
                     regeneration of the active form of EF-Tu"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Ts"
                     /protein_id="YP_945133.1"
                     /db_xref="GI:119952924"
                     /db_xref="GeneID:4642200"
                     /translation="MSISPQEVKKLRDVTGAGFGDCKKALDAVGGDFELAKKKLREMG
                     IASADKRSGRDAKEGRVFSYVNKERVGLLLISCETDFVAMNSDFVTFGNSLIKQLVES
                     GKDSLDKQQELEIKNLAATIKENIHVSKIYISNIASNELVKNYLHGEQSKIGVFIKLK
                     VDDVLKMEDESLNNLAMDLALHVAAFAPLYLSVGDICSNYIKEQEEMFTKQMEASGKS
                     EAVIKGIVSGKLKKHLGEIALLEQGFVKDDKLTVKEKIEEISKSILTKIEIVDFKYLS
                     VG"
     misc_feature    complement(119017..119850)
                     /gene="tsf"
                     /locus_tag="BT0122"
                     /note="elongation factor Ts; Provisional; Region: tsf;
                     PRK09377"
                     /db_xref="CDD:236491"
     gene            complement(119868..120632)
                     /gene="rpsB"
                     /locus_tag="BT0123"
                     /db_xref="GeneID:4642529"
     CDS             complement(119868..120632)
                     /gene="rpsB"
                     /locus_tag="BT0123"
                     /note="one of the last subunits in the assembly of the 30S
                     subunit; absence of S2 does not inhibit assembly but
                     results in an inactive subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S2"
                     /protein_id="YP_945134.1"
                     /db_xref="GI:119952925"
                     /db_xref="GeneID:4642529"
                     /translation="MAVITMKSLLEAGVHFGHQVKRLDPRMKRFIFSERNEIHILDLQ
                     KTLQGIKDSYELVQSVIKSGKKVLFVGTKKQASEIIEQEARRSDMPYVNNRWLGGMLS
                     NFNTIKKSVQKLKKLEKMEIDGTFEMISKKEVSQLNREKLKLSKNLTGIKDMEELPGA
                     VFIIDPKREQIVINEARKLGIPIISVVDTNCNPDVIDCPIPGNDDAIRSVALFTKIIS
                     DAILESDKEVGIQIVENLNEEDLMSEIAVKDEKKEL"
     misc_feature    complement(119964..120608)
                     /gene="rpsB"
                     /locus_tag="BT0123"
                     /note="Ribosomal protein S2 (RPS2), involved in formation
                     of the translation initiation complex, where it might
                     contact the messenger RNA and several components of the
                     ribosome. It has been shown that in Escherichia coli RPS2
                     is essential for the binding of...; Region: RPS2; cd01425"
                     /db_xref="CDD:100106"
     misc_feature    complement(order(120099..120101,120108..120110,
                     120324..120329,120336..120344,120348..120350,
                     120522..120530,120555..120560))
                     /gene="rpsB"
                     /locus_tag="BT0123"
                     /note="rRNA interaction site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100106"
     misc_feature    complement(order(120042..120053,120093..120095,
                     120099..120104))
                     /gene="rpsB"
                     /locus_tag="BT0123"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:100106"
     misc_feature    complement(119982..119999)
                     /gene="rpsB"
                     /locus_tag="BT0123"
                     /note="putative laminin-1 binding site; other site"
                     /db_xref="CDD:100106"
     gene            complement(120668..121267)
                     /locus_tag="BT0123A"
                     /db_xref="GeneID:4642425"
     CDS             complement(120668..121267)
                     /locus_tag="BT0123A"
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation protein Maf"
                     /protein_id="YP_945135.1"
                     /db_xref="GI:119952926"
                     /db_xref="GeneID:4642425"
                     /translation="MIYKENFEIALVSNSFARAEFLEALKIKFLSLSVDIDEGSIMKS
                     GEIGVTKRIAVLKLTNAIEKYGKDKCLITVDTLLKNDSIYVGKLSDEKEAFSKIMGYS
                     HKLIEVETSFCVFIPGKEKIIKACEVSFIKFRELTPDIVYHYIALGHWKDKAGGISLK
                     NGVADILIEYINGSYSNIIGLPIGLFYDILIRENVISTI"
     misc_feature    complement(120680..121252)
                     /locus_tag="BT0123A"
                     /note="Maf_Ham1. Maf, a nucleotide binding protein, has
                     been implicated in inhibition of septum formation in
                     eukaryotes, bacteria and archaea. A Ham1-related protein
                     from Methanococcus jannaschii is a novel NTPase that has
                     been shown to hydrolyze nonstandard...; Region: Maf_Ham1;
                     cl00276"
                     /db_xref="CDD:260318"
     misc_feature    complement(order(121043..121045,121097..121099,
                     121154..121156,121214..121216,121229..121231))
                     /locus_tag="BT0123A"
                     /note="putative active site [active]"
                     /db_xref="CDD:238485"
     gene            complement(121257..121535)
                     /locus_tag="BT0124"
                     /db_xref="GeneID:4642542"
     CDS             complement(121257..121535)
                     /locus_tag="BT0124"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945136.1"
                     /db_xref="GI:119952927"
                     /db_xref="GeneID:4642542"
                     /translation="MVTFFFHLILTNIIISFVVSFFVVFFGILRFGFLLVYLISFLGS
                     VLFLFFIPLFYSDYYNRQVDVLFYLFPVIGSIVLISLLGFSERSKNDL"
     gene            complement(121550..122338)
                     /locus_tag="BT0125"
                     /db_xref="GeneID:4642540"
     CDS             complement(121550..122338)
                     /locus_tag="BT0125"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945137.1"
                     /db_xref="GI:119952928"
                     /db_xref="GeneID:4642540"
                     /translation="MFFCFSMKKFDNNIILLIVFLLVVSCGLEDIVIVDSPLVIDSRA
                     SRDTLAFALPSWYFGNNHNSRVRGFDIYYKFYPEGSNYHFRGFAESVQKDFNALKSVF
                     NNVNEFNRRGFYKINLDGDRFSGKPTLKLDKSWIQGNFPLYFELNFENLRKSTPGSVF
                     INIRKGNSSSAPLIRSIKTVYRSYVVNDLYREFSEALKKSKVTNSTNRPFDLKHISDS
                     FFTKDVSPKYNLVIFVMAVGNAIEDDLYSVIVNLGSLHGFELSS"
     gene            complement(122345..122953)
                     /locus_tag="BT0126"
                     /db_xref="GeneID:4642522"
     CDS             complement(122345..122953)
                     /locus_tag="BT0126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945138.1"
                     /db_xref="GI:119952929"
                     /db_xref="GeneID:4642522"
                     /translation="MLMFKNKFFIGIFAVIVFVGIVVYFYSSMDVDYVKAGGEVVENL
                     ERDLNLYLRAKNIEEKLELESKIEESINKRDDVAYEFLSRFYLARSTYFQSKGLYKEA
                     LEDLDIVIGSKWIERELAYLNKAVIYEKMGQVDNALIIYDNLIKQTKLDFIKIRALLG
                     KAVLIETRDKKLAIDIYSEIANFSYENNLYVNLAKNKLLQLR"
     gene            complement(122940..124607)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /db_xref="GeneID:4642149"
     CDS             complement(122940..124607)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="in Escherichia coli this protein is involved in
                     binding to the leader sequence of mRNAs and is itself
                     bound to the 30S subunit; autoregulates expression via a
                     C-terminal domain; in most gram negative organisms this
                     protein is composed of 6 repeats of the S1 domain while in
                     gram positive there are 4 repeats; the S1 nucleic
                     acid-binding domain is found associated with other
                     proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="YP_945139.1"
                     /db_xref="GI:119952930"
                     /db_xref="GeneID:4642149"
                     /translation="MRMENQEDLQENYLKVLEKVELGSSVSGVVINVMKDYVLVDIGY
                     KSEGFIKIDEFETIPSIGDKLDAIVTKVGGELGLVLSVAKLDSLNLQDKIDEYISNRK
                     VLKGKILAELSSGYKVQINENVIGFMPSYLSSKFRDEKLKRGLVVEFYVVQADKTDGL
                     RLILDRRTLERERELVKKKELVSSYNEGDIVDGVVERITDYSAIIKVKNLVLGVLHKR
                     NIAFNRVENIEDFIRVGDKLRLKIIKLNVNAVKMELSLKALKTNPWDSVEAKYKVESI
                     VKGKVVKILPFGAVVELDSEISGFIHISNFSWVRVIKSPQELVKVGQIVEVKILEIDK
                     ENQKISLGIKQVNENPWNNLAQRCAVGKVVQGVVKNITKTGAFVSIEEGIDAYISKFD
                     ISWIDEVNPEEYFKLGSSISGKVIELDAKKQNIKLGIKQLEENPWDDFSKSYKKGDTL
                     EVEIVEKKSKGVQVRVYGKIMGFISKIQLGDTKESSLETFENLNIGDKLKVIITNIDF
                     KNKLVLLSYRAYKEQKSSEEISSYLFKEDDEESYKPFANLLKRNADV"
     misc_feature    complement(122946..124607)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="30S ribosomal protein S1; Reviewed; Region: rpsA;
                     PRK06299"
                     /db_xref="CDD:235775"
     misc_feature    complement(124365..124541)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    complement(order(124455..124457,124461..124463,
                     124491..124493,124515..124517))
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(124107..124304)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="Ribosomal protein S1-like RNA-binding domain;
                     Region: S1; smart00316"
                     /db_xref="CDD:197648"
     misc_feature    complement(123834..124049)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    complement(order(123960..123962,123966..123968,
                     123996..123998,124020..124022))
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(123576..123800)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="S1 RNA binding domain; Region: S1; pfam00575"
                     /db_xref="CDD:249971"
     misc_feature    complement(order(123702..123704,123708..123710,
                     123738..123740,123762..123764))
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(123318..123500)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="Ribosomal protein S1-like RNA-binding domain;
                     Region: S1; smart00316"
                     /db_xref="CDD:197648"
     misc_feature    complement(order(123441..123443,123447..123449,
                     123477..123479))
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(123054..123275)
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="Ribosomal protein S1-like RNA-binding domain;
                     Region: S1; smart00316"
                     /db_xref="CDD:197648"
     misc_feature    complement(order(123183..123185,123189..123191,
                     123219..123221,123243..123245))
                     /gene="rpsA"
                     /locus_tag="BT0127"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     gene            complement(124604..125272)
                     /locus_tag="BT0128"
                     /db_xref="GeneID:4642476"
     CDS             complement(124604..125272)
                     /locus_tag="BT0128"
                     /EC_number="2.7.4.14"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="YP_945140.1"
                     /db_xref="GI:119952931"
                     /db_xref="GeneID:4642476"
                     /translation="MVIAIDGPSASGKSSIAKALGMRLGFKFISSGYFYRIITLIAQR
                     FSLNEYDLLSESKILELVSQNDIKFNGFDFLLNGTNVISHILNERIDFQVSLYSSYIG
                     VRNIVNKKLREIVKLKDDNYIIEGRDITTVVFPEAEVKIYLDASVKVRALRRYNQRSD
                     NVTLNELEQALERRDEIDQNKEYGKLKLDKEVFYIDTSYKCLDDVCNIIIKTFNLKKK
                     VIER"
     misc_feature    complement(124634..125272)
                     /locus_tag="BT0128"
                     /note="cytidylate kinase; Region: cmk; TIGR00017"
                     /db_xref="CDD:129128"
     misc_feature    complement(124679..125269)
                     /locus_tag="BT0128"
                     /note="Cytidine monophosphate kinase (CMPK) catalyzes the
                     reversible phosphorylation of cytidine monophosphate (CMP)
                     to produce cytidine diphosphate (CDP), using ATP as the
                     preferred phosphoryl donor; Region: CMPK; cd02020"
                     /db_xref="CDD:238978"
     misc_feature    complement(<125027..125269)
                     /locus_tag="BT0128"
                     /note="AAA domain; Region: AAA_17; pfam13207"
                     /db_xref="CDD:257574"
     misc_feature    complement(order(124730..124732,124889..124894,
                     124961..124963))
                     /locus_tag="BT0128"
                     /note="CMP-binding site; other site"
                     /db_xref="CDD:238978"
     misc_feature    complement(order(124739..124741,124751..124753))
                     /locus_tag="BT0128"
                     /note="The sites determining sugar specificity; other
                     site"
                     /db_xref="CDD:238978"
     gene            complement(125273..126016)
                     /locus_tag="BT0129"
                     /db_xref="GeneID:4642182"
     CDS             complement(125273..126016)
                     /locus_tag="BT0129"
                     /EC_number="4.2.1.70"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     B"
                     /protein_id="YP_945141.1"
                     /db_xref="GI:119952932"
                     /db_xref="GeneID:4642182"
                     /translation="MTNTNSKGLRVHVFLAEKGVGSRRFCEDLIRKNSVRINNTLAKL
                     GDKVFLGDRVECRKQVFVFRDCKVESKIYIALHKPKNYLCSNFDPEGRQLAISLVQPL
                     FKERLFSIGRLDFKSSGLLLFTNDGQFANNIVHPRSKVEKEYIVESKRAVNENLLINF
                     KHGIKIGREIFKLKSYVMLGNNSVKLVLTEGKNREIRKVFLSKNIFLKKIHRIRIGNI
                     KLDDLKEGQIKVLSLAKINKFKTQILGEY"
     misc_feature    complement(125288..125998)
                     /locus_tag="BT0129"
                     /note="16S rRNA uridine-516 pseudouridylate synthase and
                     related pseudouridylate synthases [Translation, ribosomal
                     structure and biogenesis]; Region: RsuA; COG1187"
                     /db_xref="CDD:224108"
     misc_feature    complement(125786..125989)
                     /locus_tag="BT0129"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    complement(order(125870..125872,125876..125890,
                     125891..125896,125915..125917,125921..125926,
                     125933..125938,125942..125947,125951..125956,
                     125987..125989))
                     /locus_tag="BT0129"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    complement(125372..125800)
                     /locus_tag="BT0129"
                     /note="Pseudouridine synthases catalyze the isomerization
                     of specific uridines in an RNA molecule to pseudouridines
                     (5-ribosyluracil, psi); Region: PseudoU_synth; cl00130"
                     /db_xref="CDD:260207"
     misc_feature    complement(order(125426..125428,125675..125686))
                     /locus_tag="BT0129"
                     /note="active site"
                     /db_xref="CDD:211324"
     gene            complement(125988..126803)
                     /locus_tag="BT0130"
                     /db_xref="GeneID:4642684"
     CDS             complement(125988..126803)
                     /locus_tag="BT0130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945142.1"
                     /db_xref="GI:119952933"
                     /db_xref="GeneID:4642684"
                     /translation="MKLVRLMLKKIKNRMTNLDDYLIVCNDFKGGIEIFFDYIRNKRE
                     ILKTFNLNKIIEDFLVFSESIEIDVKELIKFYSFSTSLLYLKTQILYPVKLKDKKLVE
                     REMVKKLINFSEKYVKSKSSTRNLKDEKCLNVSKSSFLRENSIFFESVDNVQNYMVGI
                     NKVKSKVSRISKKQDDILRNIKFRSNVILGIYDAKIFDKKTKIIALLTKEDNFIFEFL
                     LNFDDKFYFFERFCYFLIVLEYKMSNIIDLVYLNDKLVLRKGKSIDEYKQQRA"
     gene            complement(126763..127854)
                     /gene="recA"
                     /locus_tag="BT0131"
                     /db_xref="GeneID:4642678"
     CDS             complement(126763..127854)
                     /gene="recA"
                     /locus_tag="BT0131"
                     /note="catalyzes the hydrolysis of ATP in the presence of
                     single-stranded DNA, the ATP-dependent uptake of
                     single-stranded DNA by duplex DNA, and the ATP-dependent
                     hybridization of homologous single-stranded DNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase A"
                     /protein_id="YP_945143.1"
                     /db_xref="GI:119952934"
                     /db_xref="GeneID:4642678"
                     /translation="MSKLKDKIDDSLNDRLNREKAIELARIQIEKDFGKGSLIKMGES
                     PVGKGIESISSGSILLDEAIGVGGYPRGRIIEIFGPESSGKTTLTLQAISEVQKNGGI
                     AAFIDAEHALDPVYAKALGVNIDELWLSQPDTGEQALEIAEYLIRSGGVDLIVVDSVA
                     ALTPQAEIDGEMGDCQIGLQARLMSKALRKITGILSKSKTCIMFINQLRMKIGVMFGN
                     PETTTGGNALKFYSSLRLEVRKIEQVTGSSADDVVGNKVRVKVVKNKVAPPFRKIELV
                     IYFGKGISREASILDASIKYKLIQKIGSWYSIGDDKLGQGRESAIIYLIKEKELTNEL
                     EIKLRKIIFEGLSPDSIEIGPPNVKKDKE"
     misc_feature    complement(126766..127806)
                     /gene="recA"
                     /locus_tag="BT0131"
                     /note="recombinase A; Provisional; Region: recA; PRK09354"
                     /db_xref="CDD:236476"
     misc_feature    complement(126826..127806)
                     /gene="recA"
                     /locus_tag="BT0131"
                     /note="RecA is a  bacterial enzyme which has roles in
                     homologous recombination, DNA repair, and the induction of
                     the SOS response.  RecA couples ATP hydrolysis to DNA
                     strand exchange; Region: recA; cd00983"
                     /db_xref="CDD:238483"
     misc_feature    complement(order(126877..126879,127015..127017,
                     127165..127167,127177..127179,127480..127485,
                     127498..127518,127522..127527,127735..127749,
                     127759..127761,127768..127773,127777..127782))
                     /gene="recA"
                     /locus_tag="BT0131"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238483"
     misc_feature    complement(127597..127620)
                     /gene="recA"
                     /locus_tag="BT0131"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238483"
     misc_feature    complement(order(127015..127026,127090..127092,
                     127135..127137,127234..127236,127384..127386,
                     127507..127509,127516..127518,127528..127530,
                     127594..127614))
                     /gene="recA"
                     /locus_tag="BT0131"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238483"
     misc_feature    complement(127384..127398)
                     /gene="recA"
                     /locus_tag="BT0131"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238483"
     gene            complement(127865..130567)
                     /locus_tag="BT0132"
                     /db_xref="GeneID:4642673"
     CDS             complement(127865..130567)
                     /locus_tag="BT0132"
                     /note="contains N-terminal domain of unknown function
                     fused to transcription elongation factor; GreA is
                     necessary for efficient RNA polymerization through
                     arresting sites; cleaves the nascent transcript and allows
                     resumption of transcription elongation"
                     /codon_start=1
                     /transl_table=11
                     /product="transcript cleavage factor/unknown domain fusion
                     protein"
                     /protein_id="YP_945144.1"
                     /db_xref="GI:119952935"
                     /db_xref="GeneID:4642673"
                     /translation="MSNITIERLDNILQEDKWTRIVVNNYSLAKIRELDELIDSIISE
                     NLTEEALDICGKHLKDVKKSIAGLYISGMLIYSRRPLNDMSLLTVVDLFSQNLKWSLV
                     EHICHKMLLTSENKHALYTLAKIYSQNNENDKLPGIWMRIVEADVDDTVCVRQLATHY
                     ENIDLQKSIYFFRKAIYRFIDKKQMSGIREVWSKLIRYVSDDFDSFLLILQKVEKELG
                     FKKVVVLYEDLYEHYSVSENIDETIEILKGILKLDNKNQKARENLVIFLREKYKDVKN
                     IEEYLEKSDLENLDKNFIDVYSDFEKYLFFAKGNFVYHQTWFVGIVKDVNEQGIVVDF
                     VSKRRHFISFDMAMSALSPLKKEDIRVLKAIKPKEELVENLKRDVEWALRIIIKSYKS
                     IDLKGIKRELVPSLMTQSAWNAWSVKAKQILKDNPHFVMASGKADCYIYNERASNFNE
                     KIYDKFKVEKDFYKRYEIFMHYCTAGGVVKDLHVEEEMLNYFLIYVNNFAKVDHYVIS
                     SYVILKSLKNSERGGAFKINIEKDINLDVLLKEYSKNIVDLFDSILNAEIKKELVSLI
                     KDELVDWVVYYKQLFPCYVNKKLIDSLYKEDIKETAHLFNYIIKNYKVYKDAYIWLLK
                     HYTSYSLDLDYSDSELLINLIKILTDSVVKINNKNNSVANKRIYKMVMNLLIKDKYLS
                     IVLNNVMDEELAKRIYMTCFYIRDFPPKDLLHIKTAIRSVFIDLEFEDEKMQSSGDKV
                     EIGFLTILSSLSKKQKELQYLKDVEIPENSKEIGKARELGDLKENAEYHSAKERQQFL
                     TKRLNSLMSEIDFAKVIDTKELQSSVVGFGTKVTMINKDTKREESYLIFGPWESNPDE
                     GIISYKSPFGENLLDAKEGDNLDFVINDTHFQYYVKKIEPAKIN"
     misc_feature    complement(127868..130567)
                     /locus_tag="BT0132"
                     /note="transcript cleavage factor/unknown domain fusion
                     protein; Provisional; Region: PRK14720"
                     /db_xref="CDD:184804"
     misc_feature    complement(128369..130519)
                     /locus_tag="BT0132"
                     /note="Uncharacterized N-terminal domain of the
                     transcription elongation factor GreA [Function unknown];
                     Region: COG1747"
                     /db_xref="CDD:224661"
     misc_feature    complement(128126..128326)
                     /locus_tag="BT0132"
                     /note="Transcription elongation factor, N-terminal;
                     Region: GreA_GreB_N; pfam03449"
                     /db_xref="CDD:251961"
     misc_feature    complement(127880..128110)
                     /locus_tag="BT0132"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            complement(130604..131548)
                     /locus_tag="BT0133"
                     /db_xref="GeneID:4642162"
     CDS             complement(130604..131548)
                     /locus_tag="BT0133"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945145.1"
                     /db_xref="GI:119952936"
                     /db_xref="GeneID:4642162"
                     /translation="MSSEKIAELIKDIYLSFRKGDFKTALMKSEEAHSLDFDNIEILT
                     ALKSSVYWNGQVESLDRIDKDYEKAEFLIREWNNFARRYLKKMNFDFIQGRNSIKYFV
                     FQLCLEIYKNIYKLQPENLDILIKIAKSYKGMGNYERAITVFLQILGDTKDNADVVAE
                     LADSYALIDEIKEAKVLFREAFFINPQKIDIDALESEMILKLIEAIKSDRNISDTLVK
                     EWIPVYGALNGVFNIKRELRPIELGHLKQSVYSLRNELKEKSYRSINESILLPRLINK
                     YFWLIDHYVRIKEDRVRIDEILSYIKEIDIGIYQQYVN"
     misc_feature    complement(130988..131242)
                     /locus_tag="BT0133"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(131006..131008,131015..131017,
                     131027..131029,131063..131065,131108..131110,
                     131117..131119,131129..131131,131165..131167,
                     131210..131212,131219..131221,131231..131233))
                     /locus_tag="BT0133"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(130988..131197)
                     /locus_tag="BT0133"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    complement(order(131045..131050,131057..131062,
                     131069..131074,131150..131155,131162..131167,
                     131171..131176))
                     /locus_tag="BT0133"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            131729..132874
                     /locus_tag="BT0134"
                     /db_xref="GeneID:4642464"
     CDS             131729..132874
                     /locus_tag="BT0134"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat family protein"
                     /protein_id="YP_945146.1"
                     /db_xref="GI:119952937"
                     /db_xref="GeneID:4642464"
                     /translation="MAMEPNKLINKSISYYNSQKYSDVVKLLEKEIFLYKNYYFYHYI
                     LGMSYLRMGNLGTAQTYLKKAYTLNPTEPDVKQSIAILLAAQGKEDKAIQIWLKMIEE
                     NQEIQRSEFSLETIRKNPIQGALFLNKNKIYAKLFPEIKVETGQNLSKLIRILLIIAS
                     LAFLLIAIFLLIHSKETIKLSLSNSKIKEKKAINNIAAYIDDIKINDKEKIENHEGQF
                     VFILTETEIKNSFQKIKTHLKQGKDNFARIEINKILNSNASESIKLKAKNLASFISRP
                     NFITFDDYLVLKEIKKNPLIYSNVYVKWEGIANNIEKKDNITYFDFYVGYNKNALEGI
                     ITTKTTFDIDINFKDYVEILGQIDYDYNTNILTLNAITIRKIEKQKN"
     misc_feature    131744..132022
                     /locus_tag="BT0134"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(131744..131749,131753..131758,131765..131770,
                     131855..131860,131864..131869,131876..131881,
                     131957..131962,131969..131974,131981..131986)
                     /locus_tag="BT0134"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(131762..131764,131798..131800,131810..131812,
                     131819..131821,131864..131866,131900..131902,
                     131912..131914,131921..131923,131966..131968,
                     132002..132004,132014..132016)
                     /locus_tag="BT0134"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(132920..134290)
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /db_xref="GeneID:4642635"
     CDS             complement(132920..134290)
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /EC_number="6.1.1.21"
                     /note="catalyzes a two-step reaction, first charging a
                     histidine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; class II aminoacyl-tRNA
                     synthetase; forms homodimers; some organisms have a
                     paralogous gene, hisZ, that is similar to hisS and
                     produces a protein that performs the first step in
                     histidine biosynthesis along with HisG"
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="YP_945147.1"
                     /db_xref="GI:119952938"
                     /db_xref="GeneID:4642635"
                     /translation="MDVRTLKGFRDYLPKEALIRTHIIKQIYSVLVSYNFDLIDTPIL
                     EYSEFLLRKSGDEVEKQTYRFKDNGDRDVSMRFDLTVPFARFMASNRSKLKFPFRRSQ
                     IGKVFRGENTQRGRYREFMQFDFDIVGEDTFRSDAEILSIVYCGLEEIFLNFIEGINR
                     KFVIHFSHIGILNAYIDKLGLKDKATFILRNIDKLDKMGIESVRENLLVQINEEHVDL
                     ILEFINLEGAFWDKLETLKGVLENNDAVKRIEDVFVHLSALGIQDAFNFNLKIVRGLD
                     YYTGIVFEAEMIGINMGSICSGGRYDNLLSLFSSSLQKVSGVGGSFGIDRIQDIIEIE
                     KFNYIKLFVVKASSRVLIVNIDDSLQDYYYKLADKFRRHDYSKINNIACEVYPKSKEG
                     KNIKVQIEYALNKAIRFLIFVGQDEYREDKLKVRDLTKKEELLLSFDEAIKFIKGNDK
                     FLCTPF"
     misc_feature    complement(132941..134290)
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="Histidyl-tRNA synthetase [Translation, ribosomal
                     structure and biogenesis]; Region: HisS; COG0124"
                     /db_xref="CDD:223202"
     misc_feature    complement(133295..134245)
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="Class II Histidinyl-tRNA synthetase (HisRS)-like
                     catalytic core domain. HisRS is a homodimer. It is
                     responsible for the attachment of histidine to the 3' OH
                     group of ribose of the appropriate tRNA. This domain is
                     primarily responsible for...; Region: HisRS-like_core;
                     cd00773"
                     /db_xref="CDD:238396"
     misc_feature    complement(order(133331..133336,133394..133396,
                     133868..133870,133877..133879,133889..133891,
                     133913..133915,133934..133939,134021..134026,
                     134033..134038,134051..134053,134057..134059,
                     134093..134098,134159..134179,134192..134194,
                     134228..134230))
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238396"
     misc_feature    complement(134159..134185)
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="motif 1; other site"
                     /db_xref="CDD:238396"
     misc_feature    complement(order(133313..133315,133322..133324,
                     133331..133333,133394..133396,133409..133411,
                     133457..133462,133466..133468,133472..133474,
                     133913..133915,133925..133927,133931..133933,
                     133940..133942,133961..133963,133967..133969,
                     134051..134053,134057..134059))
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="active site"
                     /db_xref="CDD:238396"
     misc_feature    complement(133958..133972)
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="motif 2; other site"
                     /db_xref="CDD:238396"
     misc_feature    complement(order(133313..133315,133322..133336))
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="motif 3; other site"
                     /db_xref="CDD:238396"
     misc_feature    complement(132953..133243)
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="HGTP anticodon binding domain, as found at the
                     C-terminus of histidyl, glycyl, threonyl and prolyl tRNA
                     synthetases, which are classified as a group of class II
                     aminoacyl-tRNA synthetases (aaRS). In aaRSs, the anticodon
                     binding domain is responsible for...; Region:
                     HGTP_anticodon; cl00266"
                     /db_xref="CDD:260312"
     misc_feature    complement(order(133013..133015,133019..133021,
                     133049..133051,133073..133075,133091..133093,
                     133223..133228))
                     /gene="hisS"
                     /locus_tag="BT0135"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238379"
     gene            134433..136310
                     /locus_tag="BT0136"
                     /db_xref="GeneID:4642710"
     CDS             134433..136310
                     /locus_tag="BT0136"
                     /note="division specific D,D-transpeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsI"
                     /protein_id="YP_945148.1"
                     /db_xref="GI:119952939"
                     /db_xref="GeneID:4642710"
                     /translation="MHKKFASSLRLNIILIIFLIITLLTIYKYFVLMSSKDIQYFSQN
                     INHISRRGNIYDRNGKIIAFSSKSHSVGTDPNKIKNIVNTSETLGAILKIDPQILKKK
                     LSLKKGFIYIKRKITREESELIKRIQSEGRLKDIILYPDYTRIYPFKELTSNITGFVG
                     TDNIGLTGIELSLNTILNEDLTKQKSINEKLSTNNIYLTIDIDLQKSINQIAQKHFKE
                     NKPENMIAIVMNAKNGEILSMLQFPQYDANYYAKYPKEIWNNFATSLTYEPGSINKIF
                     TVAILLDSGLLKSNEKFLDNGIYQKKFKSGEVVTIKTLNPPYGYIDPSGILIYSSNVG
                     IAHITDKVSNEYFHNKLIDFGFGKRVGFPLPGETKGLLTHHSKWSGRSKATIGFGQEI
                     GVSAIQILQAASALSNEGIMLKPKIIKRISNEMENTIQEFQKEEIKKVISKHTAKEVL
                     KMMREVVNKGGIPKLKMKNLSISAKSGTSQVIDKNTGKYSDEDYTSSILVIYPTEDPQ
                     YIIYIVYRYPKKIIYGTRIAAPMAKEIIELIEHRNNKNEYNEIKISSKISIPKPIIKY
                     EKTETLPNLTGISKRDLMKILKNYTNIKIKIKGNGFVYKQSKPPNTKLKHIDELEIIL
                     K"
     misc_feature    134556..136277
                     /locus_tag="BT0136"
                     /note="stage V sporulation protein D; Region: spoVD_pbp;
                     TIGR02214"
                     /db_xref="CDD:131269"
     misc_feature    134580..134963
                     /locus_tag="BT0136"
                     /note="Penicillin-binding Protein dimerization domain;
                     Region: PBP_dimer; pfam03717"
                     /db_xref="CDD:252119"
     misc_feature    135102..136043
                     /locus_tag="BT0136"
                     /note="Penicillin binding protein transpeptidase domain;
                     Region: Transpeptidase; pfam00905"
                     /db_xref="CDD:250215"
     misc_feature    136143..136307
                     /locus_tag="BT0136"
                     /note="PASTA domain of PBP2x-like proteins, second repeat.
                     Penicillin-binding proteins (PBPs) are the major targets
                     for beta-lactam antibiotics, like penicillins and
                     cephalosporins. Beta-lactam antibiotics specifically
                     inhibit transpeptidase activity by...; Region:
                     PASTA_Pbp2x-like_2; cd06575"
                     /db_xref="CDD:119326"
     gene            complement(136312..138204)
                     /locus_tag="BT0137"
                     /db_xref="GeneID:4642847"
     CDS             complement(136312..138204)
                     /locus_tag="BT0137"
                     /EC_number="6.2.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain-fatty-acid--CoA ligase"
                     /protein_id="YP_945149.1"
                     /db_xref="GI:119952940"
                     /db_xref="GeneID:4642847"
                     /translation="MSIVKNFFEIAKKRGNGVAQIYRSNKDYFNVTYEDLKNNVLKFA
                     AFLKKMGLGYQDKVFICSENRIEWSVIDFAILALGAVDVPKGADVTLFEAEVIINNVL
                     PNIIIVENLNLLDSVVQINFKVDPIIVIIDDLDEKDKIQFGNFKIYTYKECISIGDKS
                     RRDEEIIEILSNINPDDMATIIYTSGTTGNPKGVMLSHANFLYQVSSFSRMINTSEGQ
                     IFMCILPIWHSFQRSFSYNIFLKGMTCLFSSIVPRNMLDDMKNVNPHYIAAVPRLWIA
                     IKQNIFKEVAKKPFFSKLLFKIFVKSACLNDICYRIILGLYPDNGFDLLFPMKKLLGI
                     LGLIFFFPLRVLGDLIVFKKIKKVLGNNFVVGITGGGSMSLSVVRFFNSIGIELANAY
                     GLTEASPGVASNEHEKIMIGTCGRILPETVAEIRDENGNKLKTPGKGILFIKGPQVMI
                     GYYQDEDATRQVIGSDGFLNTGDIVKLSKDNVVQIIGREKDTIVLNNGENIEPAPIEI
                     KLEESLLIEKAVVVGQDQKFLGALILPNFEEINKYLESMGQKILDAHNRRQIIANNIV
                     LKAINDEIKKLINRANGFKPFEQILRFVLLEKPFEVGKEMSIKMDVKRNYILSFYKNE
                     IKNLFS"
     misc_feature    complement(136315..138204)
                     /locus_tag="BT0137"
                     /note="Long-chain acyl-CoA synthetases (AMP-forming)
                     [Lipid metabolism]; Region: FAA1; COG1022"
                     /db_xref="CDD:223953"
     misc_feature    complement(136354..138114)
                     /locus_tag="BT0137"
                     /note="Long-chain fatty acid CoA synthetases and
                     Bubblegum-like very long-chain fatty acid CoA synthetases;
                     Region: VL_LC_FACS_like; cd05907"
                     /db_xref="CDD:213275"
     misc_feature    complement(order(137629..137634,137638..137655,
                     137662..137664))
                     /locus_tag="BT0137"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213275"
     misc_feature    complement(order(136378..136380,136705..136707,
                     136741..136743,136750..136752,136786..136788,
                     137020..137037,137305..137310,137653..137655))
                     /locus_tag="BT0137"
                     /note="putative AMP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213275"
     misc_feature    complement(order(136444..136446,136705..136716,
                     136741..136743,136750..136752,136786..136788,
                     137020..137037,137305..137310,137377..137379,
                     137386..137391,137395..137397,137530..137535,
                     137653..137655))
                     /locus_tag="BT0137"
                     /note="putative active site [active]"
                     /db_xref="CDD:213275"
     misc_feature    complement(order(136444..136446,136456..136458,
                     136708..136716,137308..137310,137377..137379,
                     137386..137391,137533..137535))
                     /locus_tag="BT0137"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:213275"
     gene            complement(138360..138665)
                     /locus_tag="BT0139"
                     /db_xref="GeneID:4642440"
     CDS             complement(138360..138665)
                     /locus_tag="BT0139"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945150.1"
                     /db_xref="GI:119952941"
                     /db_xref="GeneID:4642440"
                     /translation="MGGYVYRAEIISNLSLELDLHEHMHRIEKDLGECIYYSKIYNVQ
                     GKGRTGEKQGNEIWPEENFILVVYTDNLFIIEKLRNAVEMLDQEYPTEGIRFFVIGN"
     gene            complement(138759..141944)
                     /locus_tag="BT0140"
                     /db_xref="GeneID:4642645"
     CDS             complement(138759..141944)
                     /locus_tag="BT0140"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance plasma membrane protein"
                     /protein_id="YP_945151.1"
                     /db_xref="GI:119952942"
                     /db_xref="GeneID:4642645"
                     /translation="MRLIMLVKKIVGKPITMLILFSLLMMLSIYTFSRLKIDLLPNIG
                     DSYITISTQYSGSSAKEVEEKVTSLLEGNLSLVKNIKTITSSSFKGHSSINLQFYHGT
                     NLDLALNEIRDALEISKRILPKEASLPRIYRGSLGSSPIISFVMYADRPVLELKRYAD
                     NILKPRLERLNGVGRVQVIGGGGKHILIEVLQNRLEAYGLTLSEIVPFISSQNVEFSV
                     GNMLDNDLEYQVQVSGKFNSIKDLENVVIAYRKPSIYSLGDNSFVQVRLRDIASVKSV
                     AQDVEDYAYYNDKPSIVISIQKQSDANSVFVSDAVNAEVEKIKLALPKDIFLDISYDD
                     AEHIKKAISSVANSAYSGAVLALCIIFFFLRSFRATIIIGITIPLAIVLTFCLMYFAN
                     ISLNVMSLSGLALSVGMLVDCSIVVIENIYKYRQKGAKLISSAILGTQEMILPIMTAT
                     LTSICVFAPMLIFKAELGVIGDFVRDFAFTIVISLVASLFVAVFLVPVLSSYYVGLYT
                     TSQKPIKNKLIKRIDDFLYGIYFVGERFYVKLLNYVLTWKLACSLIILFIFILSLVLF
                     PLLNVSFLPYERSSLIRFDFKFPHKTSLKIAKFYSDKILEIVKNEIKVYKSIVSEINS
                     NGFIFNVTLPLKEEADGEFVEDEEDIRYRVYKRVEKLYPDFNSNASSRGGFFGASPIE
                     IKIIASDFGYAREYGEFLVSLLKKKFPSLVNPRLNIREEMQIDIEIDREKAYFYGINM
                     ETLSREIRANIGGISAGNYIEDGVSYDILLRLDRDNIASFKDLDKISILSASGVQVPF
                     SSIVRLKKTKGIGEISREDQSLVVKLTAGIAPGENLALITANVVDFVTNKVPQRDGVL
                     VKFEGEYSEFTSSMQQFGVIMFMAVLLVFGVMAAQFESFLKPFVILFTIPLTLIGVVP
                     FYFISGEKVSVFTAIGMLMLIGVVVNTGIVLVDYINLLLKRGFNLKDAVLEAGRSRFR
                     PILMSALTSIIGLFPLAFSSSSESNLVKPIAFTFIGGMVASTFLTLLFIPMIFEIFYK
                     LSINAFISFKSRGPVDKIDLQGGSRGFSDKI"
     misc_feature    complement(138852..141932)
                     /locus_tag="BT0140"
                     /note="Cation/multidrug efflux pump [Defense mechanisms];
                     Region: AcrB; COG0841"
                     /db_xref="CDD:223911"
     misc_feature    complement(140466..>140885)
                     /locus_tag="BT0140"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    complement(138873..>139343)
                     /locus_tag="BT0140"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(141948..142925)
                     /locus_tag="BT0141"
                     /db_xref="GeneID:4642188"
     CDS             complement(141948..142925)
                     /locus_tag="BT0141"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance periplasmic protein"
                     /protein_id="YP_945152.1"
                     /db_xref="GI:119952943"
                     /db_xref="GeneID:4642188"
                     /translation="MNSIFNMRGCFKYYLLLLVLLFVLSCNEGTESEVQGDINTNNTT
                     SDFTNEPYRFPVVAMRVRQGALSNYISLNGDVDTKVKVEVFPNITGEIVSLNMKLGAY
                     VKKGQIIATLDPSKPGFLYLKSPVRAPISGYVLAINYKIGETVGTQTSIALIGRMDLI
                     QIKTYVSEKYILDIKVGNDAIIELESYPNEKFKAKISEVSPVLDFKSRSVAIYLEPIG
                     DNARKMIIGMFAKIKLITKHLENVIKIPSHAFVEREGKLCVFRLNPDTKTVERVFPVI
                     DFEIDNIMSIRDGINEGDLVVIEGISSLSDGAYVDIVDIRDGLDVEDNV"
     misc_feature    complement(141987..142760)
                     /locus_tag="BT0141"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    complement(<142578..142682)
                     /locus_tag="BT0141"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(142281..142550)
                     /locus_tag="BT0141"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(142938..144218)
                     /locus_tag="BT0142"
                     /db_xref="GeneID:4642638"
     CDS             complement(142938..144218)
                     /locus_tag="BT0142"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein TolC"
                     /protein_id="YP_945153.1"
                     /db_xref="GI:119952944"
                     /db_xref="GeneID:4642638"
                     /translation="MGVNIKRLILIFILSFSSYAEVIKISVEDAIRMALENSLESRDA
                     EYREKIKKLYKDNSWNLLIPNLGFSSNFSRQNSFMPNVEGRGEWNLNFGVAADLSVSP
                     SIVNNIRLTVFNYEAAKIDREKVIKNIRLNVLKMYNELLAFKSILEVLESQFENSKLK
                     FEQVKISYHNGLISEIDYLDAKLKHIKFQPSLDEQIIKFEETKERFKLLLGLDVLQDF
                     ETTGELSDEILDISLFDEVINIDGYLEVRELNNLTKIMQTTLESLWLDAFLPRFSFSV
                     SYNPGSISFSDGLSGSFKQGLHFSLGLTYSFTEVLPFSKSFTEIWERDYRLKFLENQI
                     ENKIREFKSNIIQKRKSVRLYKSILDNSKINLEMSKKNYQVAFDSFNVGTIDLIKLND
                     IEASYKQSDLQFIQDKLNYANAILEYKDLINKLD"
     misc_feature    complement(142962..144137)
                     /locus_tag="BT0142"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    complement(143586..144137)
                     /locus_tag="BT0142"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     misc_feature    complement(142950..143420)
                     /locus_tag="BT0142"
                     /note="Outer membrane efflux protein; Region: OEP;
                     pfam02321"
                     /db_xref="CDD:251221"
     gene            144332..144625
                     /locus_tag="BT0143"
                     /db_xref="GeneID:4642825"
     CDS             144332..144625
                     /locus_tag="BT0143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945154.1"
                     /db_xref="GI:119952945"
                     /db_xref="GeneID:4642825"
                     /translation="MHIFKKLFIIFNLILILLIKIYQNTLSKIVGFHCIYEPSCSNYA
                     LECLKKYNIITALILITLRLLRCNALFKGGSESLPTEKPILNSLKIFKTRLIK"
     misc_feature    144335..144622
                     /locus_tag="BT0143"
                     /note="hypothetical protein; Provisional; Region:
                     PRK14385"
                     /db_xref="CDD:172861"
     gene            complement(144614..145510)
                     /locus_tag="BT0144"
                     /db_xref="GeneID:4642153"
     CDS             complement(144614..145510)
                     /locus_tag="BT0144"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine-binding protein"
                     /protein_id="YP_945155.1"
                     /db_xref="GI:119952946"
                     /db_xref="GeneID:4642153"
                     /translation="MKGLLISVFISFILILFSCDKNDNSKDNGFKSVRSVKIAYVNWI
                     GETVATNIMKVVFEKIGYNVEILPVTTSIMYQYLASGQVDGMVSAWVPTADKFYYEKF
                     KDKFVDLGANYEGTLQGFVVPSYVTISSISELKGRGAEFKNKMIGIDAGAGTQLSVEE
                     TLKRYGLDKEYELISSSESVMLASLESAIKKHEWILVPLWKPHWAFTKYNIKFLDDPL
                     LSMGGPESIHSLVRIGLEDADPDAYYLFDNFYWGDDLLLPLIEKNYKEPGHEYGNAVE
                     FVDLHKEYVKNWVPDKYKDLFN"
     misc_feature    complement(144629..145510)
                     /locus_tag="BT0144"
                     /note="ABC-type proline/glycine betaine transport systems,
                     periplasmic components [Amino acid transport and
                     metabolism]; Region: ProX; COG2113"
                     /db_xref="CDD:225024"
     gene            complement(145547..146446)
                     /locus_tag="BT0145"
                     /db_xref="GeneID:4642856"
     CDS             complement(145547..146446)
                     /locus_tag="BT0145"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine transport system permease
                     protein"
                     /protein_id="YP_945156.1"
                     /db_xref="GI:119952947"
                     /db_xref="GeneID:4642856"
                     /translation="MNRDFIVANIDKAFNFLVDNFSDSNGIGFAKIVIFFYDNLKKLF
                     LLINPVFFIILICVLSFLFLKKRLALLIMLGFCFILYFNLWEVSMDTISIIFVSVFFS
                     VIWGILIGILGGYYSKFYVFLKPLLDLMQAMPPFIYLIPAIPFFGMGTSSAIFATIIF
                     AMPPVIRYTRLGIIQVPGEVIEAAKSFGSSNIRILFQIQLPLALQSIIEGINQSIMMA
                     ISMIVIAAMVGSSGLGRSVIYSVERLHFGEGLISGLAVVVIAIILDRIMQAIFIKFSY
                     LNTDNYGVKKENKFKRFLEMYNK"
     misc_feature    complement(145658..146176)
                     /locus_tag="BT0145"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(145658..145663,145670..145675,
                     145679..145684,145691..145696,145724..145729,
                     145766..145771,145778..145789,145808..145810,
                     145817..145822,145862..145864,145913..145915,
                     145922..145927,145937..145939,145943..145948,
                     145955..145957,145961..145963,145967..145972,
                     146018..146020,146024..146029,146036..146065,
                     146069..146080,146105..146107,146120..146125,
                     146132..146137))
                     /locus_tag="BT0145"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(145772..145789,146018..146062))
                     /locus_tag="BT0145"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(145694..145696,145724..145726,
                     145733..145735,145769..145771,145985..145987,
                     146018..146020))
                     /locus_tag="BT0145"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(145841..145843,145853..145858,
                     145874..145912))
                     /locus_tag="BT0145"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(146453..147571)
                     /locus_tag="BT0146"
                     /db_xref="GeneID:4642715"
     CDS             complement(146453..147571)
                     /locus_tag="BT0146"
                     /codon_start=1
                     /transl_table=11
                     /product="glycine betaine transport ATP-binding protein"
                     /protein_id="YP_945157.1"
                     /db_xref="GI:119952948"
                     /db_xref="GeneID:4642715"
                     /translation="MSKASVKVRNLYKTFSYNKNKKQIVKAIKSYESGKDRSDIYKES
                     SVFIANANISLDVYENEILVIMGMSGCGKSTFVRCLNGIHKIDSGSILVDNIEMNDIN
                     QKALSALRKDKFAMVFQNFGLFPHMNVLRNVTYGLEVKNVPKKIRIQRALDILKLVGL
                     EDSEYKYINELSGGMKQRVGIARALVVNPDILLMDEAFSALDPLIRGEMQCELLRLVD
                     KLKKTVVFITHDLIEAFKLGNRIAFMKDGEIVQVGRPLEILRDPKTDFIANFIKNLPV
                     LNILKIKDIIKMDFTLNGDTDKCNVILEKENNNFNLYDLSVNKKCNNLVSLNLGLDDE
                     IKSVVKYLNKLDYLIIKGEQDDIIGYIDLGEIAGLLAR"
     misc_feature    complement(146456..147559)
                     /locus_tag="BT0146"
                     /note="ABC-type proline/glycine betaine transport system,
                     ATPase component [Amino acid transport and metabolism];
                     Region: ProV; COG4175"
                     /db_xref="CDD:226643"
     misc_feature    complement(146735..147556)
                     /locus_tag="BT0146"
                     /note="ATP-binding cassette domain of the osmoprotectant
                     proline/glycine betaine uptake system; Region:
                     ABC_Pro_Gly_Betaine; cd03294"
                     /db_xref="CDD:213261"
     misc_feature    complement(147350..147373)
                     /locus_tag="BT0146"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(order(146885..146887,146984..146989,
                     147215..147217,147347..147355,147359..147364))
                     /locus_tag="BT0146"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(147215..147226)
                     /locus_tag="BT0146"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(147032..147061)
                     /locus_tag="BT0146"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(146984..147001)
                     /locus_tag="BT0146"
                     /note="Walker B; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(146966..146977)
                     /locus_tag="BT0146"
                     /note="D-loop; other site"
                     /db_xref="CDD:213261"
     misc_feature    complement(146879..146899)
                     /locus_tag="BT0146"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213261"
     gene            complement(147701..148705)
                     /locus_tag="BT0147"
                     /db_xref="GeneID:4642166"
     CDS             complement(147701..148705)
                     /locus_tag="BT0147"
                     /note="structural flagella protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin"
                     /protein_id="YP_945158.1"
                     /db_xref="GI:119952949"
                     /db_xref="GeneID:4642166"
                     /translation="MIINHNTSAINASRNNSINAANLSKTQEKLSSGHRINRASDDAA
                     GMGVAGKINAQIRGLSQASRNTSKAINFIQTTEGNLNEVEKVLVRMKELAVQSGNGTY
                     SDADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKSAAQNIKTAEELGMQPAKINT
                     PASLAGSQASWTLRVHVGANQDEAIAVNIYAANVANLFAGEGAQVSPAQEGAQQEGVQ
                     AAPAPAAAPAQGGVNSPVNVTTTIDANMSLSKIENAIRMVSDQRANLGAFQNRLESIK
                     ASTEYAIENLKSSYAQIQDATMTDEIVASTTNSILTQSAMAMIAQANQVPQYVLSLLR
                     "
     misc_feature    complement(147704..148705)
                     /locus_tag="BT0147"
                     /note="flagellin; Provisional; Region: PRK12803"
                     /db_xref="CDD:183758"
     misc_feature    complement(148292..148699)
                     /locus_tag="BT0147"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    complement(147707..147964)
                     /locus_tag="BT0147"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            complement(148827..150827)
                     /gene="fliD"
                     /locus_tag="BT0149"
                     /db_xref="GeneID:4642164"
     CDS             complement(148827..150827)
                     /gene="fliD"
                     /locus_tag="BT0149"
                     /note="involved in flagellin assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FliD"
                     /protein_id="YP_945159.1"
                     /db_xref="GI:119952950"
                     /db_xref="GeneID:4642164"
                     /translation="MSSGFFVPGVDNKYNTKEIRESMLKPDKAKIDSSVKKLENLEQE
                     KRAWQMINKKISTLNSLARQITSLNSPFNYMSGNSSNNDVLSLSARYGAKNETYKIDV
                     NQIASSDIFLSANFKQKEISIPSGDYIFLVGNKEIKIRNNGDIESLVKDINNRGKGFL
                     SAKVVRSDSAGNSRLILRSLKEGENNKLVMKGEALNLAKQIGILSELTTNFSPNLTEI
                     INSQQSSSNKIFLDKDDIVLEPLSEISISIPENIEVSSRSKIKFEIKYYDSDDKGILN
                     EIVFNPGEATFEDAKVEGEDSIINLESDHKLPLKERKYIQMNMIKIHSGTNSLELPPI
                     NVASDFEKVEVEIGSLLDLKEINIENKVNNKVFVIRNIEIFDPKNRDGFLPINAKSFA
                     ENAKVKFDGVDVERDSNTVNDLIPNVTLNLKQASDDTIVVRVEPDYEGIKKLLLDFLV
                     AYNQVLAEINIVSSNESNLEGQKSDVLEEWSYFSDEEREEAYKNLGILRTEFALKNLR
                     SRLELIMFNSYRTNDPNFSIINQIGVFTNSMSSSGGLSRYLGLDEKKFNEIIQSNINS
                     VKELFAVDFNDDRIYDDGLAKMLGDYLSPLISSGGFIYNKIRNYDLKIPNQKNVVEDY
                     KKKYEEREQKVEGELNTLDFTVKRMKEQEEILKSLNLQRQNR"
     misc_feature    complement(148830..150824)
                     /gene="fliD"
                     /locus_tag="BT0149"
                     /note="flagellar hook-associated protein FliD; Validated;
                     Region: fliD; PRK06664"
                     /db_xref="CDD:235848"
     misc_feature    complement(150498..150785)
                     /gene="fliD"
                     /locus_tag="BT0149"
                     /note="Flagellar hook-associated protein 2 N-terminus;
                     Region: FliD_N; pfam02465"
                     /db_xref="CDD:251313"
     misc_feature    complement(148875..149654)
                     /gene="fliD"
                     /locus_tag="BT0149"
                     /note="Flagellar hook-associated protein 2 C-terminus;
                     Region: FliD_C; pfam07195"
                     /db_xref="CDD:254097"
     gene            151003..152208
                     /locus_tag="BT0151"
                     /db_xref="GeneID:4642714"
     CDS             151003..152208
                     /locus_tag="BT0151"
                     /EC_number="3.5.1.25"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="YP_945160.1"
                     /db_xref="GI:119952951"
                     /db_xref="GeneID:4642714"
                     /translation="MPNFCLFNSKSVLTGNDKIDNSAVLIKDSKIFDIVTADRLEKID
                     LQNYEMIDVKGNYITPGLYDNHIHGFHGYGTDQCSTNSIIKMSQYLAEYGVVGFLPTL
                     YPRPTEEMIETIKACTAAIGKEKGAKILGLHLEGPFFSPEKKGAHPTSYLQQPSIEVM
                     KKFIDAAGGTFTDSFGRKRTNIATMTVAPELKGMRELAMFCMENNITLQAGHTNAKYE
                     NMIEGFQVGILHTTHFFNAMSKLDHRNPNAIGATLIHGDVSCEIIADGHHIHPKLVLM
                     LRKLKDISKLVLVTDGLTPTLQPSGKLIANGEEVYLNDDGLFHIVESDTIAGSALTMI
                     QGIKNLVEFGYSLSDAIQASSYNPIRIINLEKKGLICHGYDANINVLDKDLDLKLTMI
                     ESKIIFNKL"
     misc_feature    151003..152187
                     /locus_tag="BT0151"
                     /note="N-acetylglucosamine-6-phosphate deacetylase;
                     Region: nagA; TIGR00221"
                     /db_xref="CDD:232881"
     misc_feature    151015..152181
                     /locus_tag="BT0151"
                     /note="N-acetylglucosamine-6-phosphate deacetylase, NagA,
                     catalyzes the hydrolysis of the N-acetyl group of
                     N-acetyl-glucosamine-6-phosphate (GlcNAc-6-P) to
                     glucosamine 6-phosphate and acetate. This is the first
                     committed step in the biosynthetic pathway to...; Region:
                     NagA; cd00854"
                     /db_xref="CDD:238434"
     misc_feature    order(151198..151200,151204..151206,151405..151407,
                     151438..151440,151636..151638,151699..151701,
                     151708..151713,151804..151806,151873..151875,
                     151978..151980)
                     /locus_tag="BT0151"
                     /note="active site"
                     /db_xref="CDD:238434"
     misc_feature    order(151705..151707,151723..151725,151729..151734,
                     151738..151740,151759..151764,151801..151812,
                     151816..151821,151825..151830,151837..151839)
                     /locus_tag="BT0151"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238434"
     gene            152205..153044
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /db_xref="GeneID:4642550"
     CDS             152205..153044
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /EC_number="3.5.99.6"
                     /note="catalyzes the reversible formation of fructose
                     6-phosphate from glucosamine 6-phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="YP_945161.1"
                     /db_xref="GI:119952952"
                     /db_xref="GeneID:4642550"
                     /translation="MILFIYKYKEQQMRLIIRSNYNDISKWAANHVAMRIKKFSPTKE
                     KPFILGLPTGSSPIGMYKHLIEMNKLGKISFENVVTFNMDEYIKLDKNHPESYHSFMW
                     SNFFSHIDIKKENIHMLNGNATNLINECEEYENKIKSYGGIMLFVGGIGPDGHIAFNE
                     PGSSLSSRTRIKTLTQDTIIANSRFFENDINKVPKSALTVGVGTIMDSKEIMIIVNGH
                     NKARALKHAIEKGVNHMWTISALQLHKNAIIVSDEAATYELKVGTVKYFNDIERDNFN
                     NDI"
     misc_feature    152271..152981
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /note="GlcN6P_deaminase: Glucosamine-6-phosphate (GlcN6P)
                     deaminase subfamily; GlcN6P deaminase catalyzes the
                     reversible conversion of GlcN6P to D-fructose-6-phosphate
                     (Fru6P) and ammonium. The reaction is an aldo-keto
                     isomerization coupled with an amination or...; Region:
                     GlcN6P_deaminase; cd01399"
                     /db_xref="CDD:238693"
     misc_feature    order(152361..152372,152451..152456,152649..152654,
                     152667..152669,152673..152675,152754..152756,
                     152862..152864)
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /note="active site"
                     /db_xref="CDD:238693"
     misc_feature    order(152688..152690,152694..152699,152721..152723,
                     152886..152906,152928..152936)
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238693"
     misc_feature    order(152691..152696,152712..152723)
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /note="allosteric site; other site"
                     /db_xref="CDD:238693"
     misc_feature    order(152727..152729,152736..152768,152778..152786)
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /note="active site lid [active]"
                     /db_xref="CDD:238693"
     misc_feature    order(152742..152744,152856..152858,152868..152870,
                     152961..152963,152970..152981)
                     /gene="nagB"
                     /locus_tag="BT0152"
                     /note="hexamer (dimer of trimers) interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238693"
     gene            complement(153137..153829)
                     /locus_tag="BT0153"
                     /db_xref="GeneID:4642594"
     CDS             complement(153137..153829)
                     /locus_tag="BT0153"
                     /EC_number="1.15.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="YP_945162.1"
                     /db_xref="GI:119952953"
                     /db_xref="GeneID:4642594"
                     /translation="MGGMNPVIVAVKRNIKIVMEKAKKEDFMFKLPELGYAYDVLEPY
                     IDAKTMEIHHSKHHNAYTVNLNSVLEKTEINYSQDIESILKNIQRFPKEFQAAIRNNA
                     GGYSNHTLYFRILRPGNKDNILENFEEHVNATFGSLDNLKMALRDSAINVFGSGWAWL
                     VLHASKELQIISRPNQDSPLMEDYKPILGIDVWEHAYYLKYQNRRVEYIDAFFKVLNW
                     EEVSRVYNEIVE"
     misc_feature    complement(153146..153748)
                     /locus_tag="BT0153"
                     /note="Superoxide dismutase [Inorganic ion transport and
                     metabolism]; Region: SodA; COG0605"
                     /db_xref="CDD:223678"
     misc_feature    complement(153482..153745)
                     /locus_tag="BT0153"
                     /note="Iron/manganese superoxide dismutases, alpha-hairpin
                     domain; Region: Sod_Fe_N; pfam00081"
                     /db_xref="CDD:249570"
     misc_feature    complement(153155..153445)
                     /locus_tag="BT0153"
                     /note="Iron/manganese superoxide dismutases, C-terminal
                     domain; Region: Sod_Fe_C; pfam02777"
                     /db_xref="CDD:251524"
     gene            complement(153762..156470)
                     /locus_tag="BT0154"
                     /db_xref="GeneID:4642065"
     CDS             complement(153762..156470)
                     /locus_tag="BT0154"
                     /note="functions in protein export; can interact with
                     acidic membrane phospholipids and the SecYEG protein
                     complex; binds to preproteins; binds to ATP and undergoes
                     a conformational change to promote membrane insertion of
                     SecA/bound preprotein; ATP hydrolysis appears to drive
                     release of the preprotein from SecA and deinsertion of
                     SecA from the membrane; additional proteins SecD/F/YajC
                     aid SecA recycling; exists in an equilibrium between
                     monomers and dimers; may possibly form higher order
                     oligomers; proteins in this cluster correspond SecA1;
                     SecA2 is not essential and seems to play a role in
                     secretion of a subset of proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="YP_945163.1"
                     /db_xref="GI:119952954"
                     /db_xref="GeneID:4642065"
                     /translation="MIPDMLRAIFEATIGSKSKRDLKSYFPVLRTINKLESWALSLSD
                     EDFAMETEKFRDELKEGKTLEDILERAFALSREAARRRLKERPYDVQLIAGLALHQGK
                     IIEMKTGEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFELLGVSVGV
                     VLSNMDSARRKVEYDKDITYVTNNELGFDYLRDNMCFDLSQKSLRNFNYCIIDEIDSI
                     LIDEARTPLIISGSTEGDTSAYLEVNSLVSLLKECSKDPKTGDYPLEIDELDGDYTID
                     EKGKRVSFTANGLNNLEQILVSKGIIKGSMYVDSNFNYVHYMTQALKAHLLFLKDREY
                     IVGDSGVEIVDEFTGRILKGRRYSDGLHQAIEAKEGVKVASENKTMATITFQNLFRMF
                     KKISGMTGTADTEAKEFHRIYNLDVIVVPTNKLVARIDEDDIIYYTEEFKFKAITDEV
                     YEAYKKGQPVLVGTVSIEKSEILSNMFKNKGIKHEVLNAKNHFREALIIAEAGAKHSV
                     TIATNMAGRGTDIKLGGNLEHRVRKKFGTGMSLEEFQKAMQSEREQYLEDYEEVKALG
                     GLYVIGSERHESRRIDNQLRGRGGRQGDPGRSRFYVSLEDDLMRLFAGDNLRALMGKL
                     GMATGEPIAHSLLTKSLVNAQKRVEDRNFEIRKHLLEYDDVITKHREFIYSQRNLILV
                     DNNIKERVLLSLREYLDFLFDQVKGEVVTSSVLNEINSIFAYMMESVGSIETMNIVDL
                     KNKLMEIARANLDAKEELIGVEFFNEFLKHEYLRNIDSKFQDHLANLDSLRESVYLRS
                     YANKNPITEYKEEGFAIFSELVKDIKVETLRRTLQVRVDVDSSGYKNKKPKNVRATHK
                     EFSGIASADKGNTVGVQIIRSTPKIGRNEPCYCGSEKKYKNCHGKS"
     misc_feature    complement(153765..156458)
                     /locus_tag="BT0154"
                     /note="preprotein translocase subunit SecA; Reviewed;
                     Region: PRK12904"
                     /db_xref="CDD:237259"
     misc_feature    complement(<155814..156164)
                     /locus_tag="BT0154"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(156132..156146)
                     /locus_tag="BT0154"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(155823..155834)
                     /locus_tag="BT0154"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(155373..155777)
                     /locus_tag="BT0154"
                     /note="SecA preprotein cross-linking domain; Region:
                     SecA_PP_bind; smart00958"
                     /db_xref="CDD:214938"
     misc_feature    complement(153963..154580)
                     /locus_tag="BT0154"
                     /note="SecA Wing and Scaffold domain; Region: SecA_SW;
                     pfam07516"
                     /db_xref="CDD:254253"
     misc_feature    complement(153768..153824)
                     /locus_tag="BT0154"
                     /note="SEC-C motif; Region: SEC-C; pfam02810"
                     /db_xref="CDD:251544"
     gene            156522..157655
                     /locus_tag="BT0155"
                     /db_xref="GeneID:4642487"
     CDS             156522..157655
                     /locus_tag="BT0155"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945164.1"
                     /db_xref="GI:119952955"
                     /db_xref="GeneID:4642487"
                     /translation="MKKFYKIHLNLLFMIISCNIKTLNELGEQQFKIPFGTLPGEITP
                     LVNKFTNSSFDIKTYNGLVYIVEAKANKLMIFNSYGKLIQTYQNDIFKTNSDLKIKKV
                     DFENIKAIYPSKDFIVVSDKLNNKKSKFDEKENIAYSTRIFILNKDSSVEVLGQEGRN
                     GTLFPQVYDINIDDKNNIAIITISNEGYIIYSYDKELSPLYKIYVNTNILQIPEEEKK
                     KYNISIDKVFFEVNKKIIYVKTTHYENIRTNENINDLGVRIKNQYFYTMLLNKNKEFE
                     IKNKITLPQNLLDDQQESFINIIGIQKDKIIASTNMRNLSNTLIWKLDNKGKIKEQMV
                     LIEPPNLKFLAESLSKDGILSILYGEKSGVSVYWWNLNTLLKL"
     gene            157678..158103
                     /locus_tag="BT0156"
                     /db_xref="GeneID:4642850"
     CDS             157678..158103
                     /locus_tag="BT0156"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945165.1"
                     /db_xref="GI:119952956"
                     /db_xref="GeneID:4642850"
                     /translation="MRNKNCKSKIQNNHKQRLKKNLTLGIIFVIMLIIIKIVFIPKLQ
                     KLESKYRPTITIEHKIKNENLYIKINIKSQNIKNLGKANIEVYLDNKLIENNMIYIDK
                     INYTLYTNVAYRKEGLLNIVLINQKGDKAYFSKRLDLGG"
     gene            158107..158523
                     /locus_tag="BT0157"
                     /db_xref="GeneID:4642194"
     CDS             158107..158523
                     /locus_tag="BT0157"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945166.1"
                     /db_xref="GI:119952957"
                     /db_xref="GeneID:4642194"
                     /translation="MLQIYFISVLLNILGGIVLAFPILGERFKCLIIFEEFINLINNN
                     KNVRSIFGTTFLIASIFEIIIPYDLPIIGNLFPAISLFFIGFILFLSQKIPTSLQNNK
                     EYGKFKSLIESNKKVIGILALIIGIIHFFAPRVPFL"
     gene            158669..159769
                     /locus_tag="BT0160"
                     /db_xref="GeneID:4642191"
     CDS             158669..159769
                     /locus_tag="BT0160"
                     /EC_number="5.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_945167.1"
                     /db_xref="GI:119952958"
                     /db_xref="GeneID:4642191"
                     /translation="MIKNKEIIINLKNLEYNLTAIKNHIQKRELVATLKADAYGHGLI
                     QTFKFLKEKGINYFGIFWIDEALKIKKIDKRANVLLYINTDKSAIKNLVKFDITPFVA
                     DSQYLSLIEQECRKQNKKIKVHLKVDVGMNRYGIKIENALNLAMQIQNSKLVEFEGVC
                     THLPTTENRKITQAQIEKFVHFINELKTKNIKPKFIHASNSEHITNYPISEKFNMVRP
                     GLILYGYHPNSNSLNNNLQLKPVLSLYSKIIFLKKIKKDEQISYSGLFTAKEDMQIGL
                     LPVGYFDGIPQNTSNNFYCIIRDKKCFIRGKICMNISIIEIPKDLKINIGEKVEITSE
                     RLSLDILSKESGMSKYEILCSIGKHEKKKYLY"
     misc_feature    158675..159763
                     /locus_tag="BT0160"
                     /note="alanine racemase; Region: alr; TIGR00492"
                     /db_xref="CDD:129583"
     misc_feature    158687..159763
                     /locus_tag="BT0160"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Alanine Racemase; Region: PLPDE_III_AR; cd00430"
                     /db_xref="CDD:143481"
     misc_feature    order(158765..158767,158771..158773,158783..158785,
                     158909..158911,159044..159046,159065..159067,
                     159152..159154,159266..159271,159317..159328,
                     159452..159454,159509..159511,159593..159598,
                     159716..159718)
                     /locus_tag="BT0160"
                     /note="active site"
                     /db_xref="CDD:143481"
     misc_feature    order(158765..158767,158771..158773,158783..158785,
                     158909..158911,159065..159067,159152..159154,
                     159266..159271,159317..159328,159716..159718)
                     /locus_tag="BT0160"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    order(158771..158776,158849..158851,158858..158863,
                     158972..158977,159059..159070,159152..159154,
                     159158..159160,159413..159424,159428..159430,
                     159440..159445,159449..159457,159494..159496,
                     159509..159511,159527..159529,159599..159604,
                     159704..159709,159716..159721,159743..159745)
                     /locus_tag="BT0160"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143481"
     misc_feature    order(158771..158773,158783..158785,159065..159067,
                     159152..159154,159452..159454,159509..159511,
                     159593..159598,159716..159718)
                     /locus_tag="BT0160"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143481"
     misc_feature    order(158771..158773,159452..159454)
                     /locus_tag="BT0160"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143481"
     gene            complement(159761..161404)
                     /locus_tag="BT0161"
                     /db_xref="GeneID:4642743"
     CDS             complement(159761..161404)
                     /locus_tag="BT0161"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane associated protein"
                     /protein_id="YP_945168.1"
                     /db_xref="GI:119952959"
                     /db_xref="GeneID:4642743"
                     /translation="MYNKFIKIRLIDQGMTMFLVMFFVSCVLFSEEIYYRFADYDVNY
                     RIIGKYEISKENAEEECGYKFTYDDGRLVFIDYVGKLSILIPSFFGANQIKIEYSDDI
                     ERRLFLNGGFAAKNLKDVYVEQVEYFPNGRPKSIFNYNKSNEIIRDKYGIAYYHFIYN
                     DDSSFYVYRFSEVGFQIKDLNNVYYTKIIYDDSDRRKTVLYYDDNNYNIKAKNGIYGF
                     RLTYDSSHNIIREEYLDPVASLYANPFSVAIKTYRYDFDGKLIEILNYDIKNNLTPDE
                     NNVAIYRYEYNLKEKDYFYKEYNYDANNNLTVSQNGYAMRKTIFYMQNNEKRVINHSN
                     RINKNYNSDIPASYEEKYEIMNNFKGIAVYSYKYDNKFYLIENLFFDKNFNLISDSNG
                     VMIYKYAYNDDGLLKSQEHYGDFDNPIDDFAGVFRYKFAYDVNGNLILKSNYSKSGVL
                     VADRSAIFEYAYEYDKQNRLISQKNFGNLGQLQDDVHGVSVYKYEYNKFGKISKKTNH
                     GPDLRLRDDIGGISVYKWIYDSKGNLVDFQKFDSLGNLI"
     misc_feature    complement(<160316..160813)
                     /locus_tag="BT0161"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            161431..161598
                     /locus_tag="BT0162"
                     /db_xref="GeneID:4642721"
     CDS             161431..161598
                     /locus_tag="BT0162"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945169.1"
                     /db_xref="GI:119952960"
                     /db_xref="GeneID:4642721"
                     /translation="MAKISKNAQRSGSKELLSRWGGKIIMKSKFENGKIKHYAECQTS
                     KNTARRPKDLF"
     gene            complement(161602..163350)
                     /locus_tag="BT0163"
                     /db_xref="GeneID:4642691"
     CDS             complement(161602..163350)
                     /locus_tag="BT0163"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945170.1"
                     /db_xref="GI:119952961"
                     /db_xref="GeneID:4642691"
                     /translation="MKKLPEIFYLNDKEVDILISQIGISSDTQKMILRIILEHKHNII
                     DYANFIEDYSVKIRALKGELDFLFRKLYEVKRGIIINQSTSNGEMVPYKIIITDENSY
                     DFYYYAIEDLFLKHYVGIELFSTLLTIKNIDKNLLVFEKEFVILSNSDINLKYFQENS
                     SSKKIFVLDSLIIPSGKALYFIEFMKRILFGIASNRIVKDVFMRAKNVKLSEYDRMLD
                     EGINGVGVAYNLLLGILENKEEILNKKGVNISKHYFTFLEVLNIYITNEKNLEELKNL
                     ESIKIDETLKSIEKTIEFKPRFINIEEFKNILQEHAEVLSDSEYFLKTANEYFFESSI
                     KGSLPKIFSIKSGMYLYKPCAYSMFLKEFDQILVDIRDKLRNDFVKVFNSGKNSSTIL
                     TEEGLEKTLIEFIANYDINDYCLKNKVAFLDFIVSHYKRVSKTQNIQTHLKDIIKTEA
                     AKYFKNSNTFLPLYKIYKVDLSNLLDSAYRDLPLLKRLVLFLTGRQQSYKEALSRLNS
                     KIVVKDHAELFDPNERVKRQLDKRRKQREELREQIRSSYVRKGKTPKEATFNRAYTKS
                     EQDEAWLKFEDKLNKK"
     gene            complement(163422..164420)
                     /locus_tag="BT0164"
                     /db_xref="GeneID:4642689"
     CDS             complement(163422..164420)
                     /locus_tag="BT0164"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-calcium exchanger"
                     /protein_id="YP_945171.1"
                     /db_xref="GI:119952962"
                     /db_xref="GeneID:4642689"
                     /translation="MFVGGDFLAHIHLFCVIFGIFLLYLGGNYLLNSSVNIATYFQVP
                     NLLIGVVIVSLSTSSPELFTSLIASLKGKNEIIVSNIIGSNIINMLLALPLTGVFLRI
                     KTDFKRLKFSFIILFLLMFLLLLFSFDFGTLSFFKVPYHRTSSLVILILFLSYLFLFY
                     KEEKKYNSVPKNLENFNCNYGFNFLFLNTLLLLLSIYFLYFGSKLLIDSSIYIAHNVF
                     NISEKVIGIIFVAFGTSIPEIVVSLFAVIKKESDIALGNIIGSNIFNIGFILSSSSFV
                     NPVLMSDIYLADFSIMFVVSLMLLFIVRFRGAFSRGPAILFLCLYILYNSFLFGVF"
     misc_feature    complement(163449..164390)
                     /locus_tag="BT0164"
                     /note="K+-dependent Na+/Ca+ exchanger related-protein;
                     Region: TIGR00367"
                     /db_xref="CDD:232943"
     misc_feature    complement(163944..164324)
                     /locus_tag="BT0164"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     misc_feature    complement(163449..163829)
                     /locus_tag="BT0164"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     gene            complement(164422..166272)
                     /locus_tag="BT0165"
                     /db_xref="GeneID:4642679"
     CDS             complement(164422..166272)
                     /locus_tag="BT0165"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical cytosolic protein"
                     /protein_id="YP_945172.1"
                     /db_xref="GI:119952963"
                     /db_xref="GeneID:4642679"
                     /translation="MKLNTCIMLLYIICLLFSYFFLCFHLHSLDETKYFKNSDLFFIN
                     KGALYKKHNDVIFKVEPKGLETRWIYPFARPVSKRITSIYEDFYSSNSLLTTNDSVYV
                     SHNYFKSFIKLVDNEKFNKNSYITSSALSRGEYKRIAVGTSNSGIYLSVNDNLDFKSL
                     NSLISKTYLGAGYYDMVSAIEFSRNNANELYFSCGIYGDIILINTTLGVVRKLDFPFK
                     KQIVRIIDLSDAKIEKLLVRTYDNHFYSYVDGKWTFDGQFSVYGENSIEKLERMHLAS
                     NKGSIYLTAYTLRSKTAIDERFEFIKRLGMNAVIIDFKDDSGILTYASKLALPNKIKA
                     VKNLIDVPYILNKARELGIYVIARVVVFKDAKLYFYNNYEYALWNKKTNQPWANLVKV
                     EHGDSFKFVQKEHWVDLFLQGTWDYNLSIAKEIQSLGVDEIQFDYIRFPTDGPVSLIT
                     SRFNKYKMRAIDALESFLIMARKNISIPISIDIYGNNGWFITNSIGQNISMIADYVDV
                     ISPMFYPSHYTNDFLKNELYYTTRAYKIYKEGSNRAAVFSSGKVIIRPYVQAFLLGSE
                     RRVSKEVYLKYFFHQLRGVKESLGNGFSLWNASNIYYMVKSDLSEFLNFS"
     misc_feature    complement(164428..165630)
                     /locus_tag="BT0165"
                     /note="Putative glycosyl hydrolase domain; Region:
                     DUF4015; cl17870"
                     /db_xref="CDD:266899"
     gene            complement(166360..167841)
                     /locus_tag="BT0166"
                     /db_xref="GeneID:4642674"
     CDS             complement(166360..167841)
                     /locus_tag="BT0166"
                     /EC_number="2.4.1.25"
                     /note="amylomaltase; acts to release glucose from
                     maltodextrins"
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="YP_945173.1"
                     /db_xref="GI:119952964"
                     /db_xref="GeneID:4642674"
                     /translation="MKRKSGILLNISSLPSKYGIGDLGRGAYKFIDFLADSSQGYWQI
                     LPYSPPSFLEFPYSSYSAFAGNINYIDLNAIDRFIDIDLGTFECLEDRYVDYDKLKAK
                     EVILRNAALNFLHRATIDEIHAFEKFKKSAAYWLLDFSSFVAFKEYYSKFQSSQAFNL
                     LFSREILKRDAKALAKLRETLEVEINIQQVLQYFFFSQFKALKKYANNAGIKIVSDIP
                     IFVSYDSADVWAHQKYFKLRFDASKDKVTGVPPDCLFSKKYLWGNAAYNWKALRKDDY
                     VWWINRIDFLRKYVDIVRIDYFRGFVSTWEVSAEESLLFGGQWVKCPGKDFFKQILNE
                     INDLEIWVEDLVKDRGDTFRLRDYFGFPGTKMMQCAFDFDSANIYLPHNYIRNCVVYT
                     GTHESNTIRGFINSVDNEHKKYIFDYFNTSENAIVWDMIRGAMASVANSVIIPMKDYL
                     DLVADFSMNISDAMLNNFRILSGDLSDDLSKKISDITKLYGRT"
     misc_feature    complement(166363..167841)
                     /locus_tag="BT0166"
                     /note="4-alpha-glucanotransferase; Provisional; Region:
                     PRK14508"
                     /db_xref="CDD:237738"
     gene            168002..169159
                     /locus_tag="BT0167"
                     /db_xref="GeneID:4642633"
     CDS             168002..169159
                     /locus_tag="BT0167"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_945174.1"
                     /db_xref="GI:119952965"
                     /db_xref="GeneID:4642633"
                     /translation="MNIKIVILLFLANTLAFSSEILEFKYTKGAKFRIETTDNQEIYL
                     NGRFNSKTKTNIQVSSEVKDVKNNFADIKSYFRVLKRDNESDVYLLKEEFEGNFSINK
                     QGEYKINNAQKRPSVRGIPRFPKTPIKVNETWTYPAEEYIQASEISQEIKDFVTKFDV
                     NYVYKGKEKIDGKYYDIILSNYKSKYNVKNILFSQKVNQIIYFDSKLGNIYKYNDTYE
                     FQMQNDNNNIKMTGNSFGKIISIELPNDNIIEHEVKEYISTKQIDSINIEKNENGIKL
                     SLDIEFYPDSFQIIKKEYNKLKHIANLLEKFKDNNILIEGHTAKFGTEQEMQELSEKR
                     AHSIGNYLLKMKVKNKNQIFFKGWGAKKPKYANSSPLASKNRRVEITILNN"
     misc_feature    <168821..169156
                     /locus_tag="BT0167"
                     /note="Outer membrane protein and related
                     peptidoglycan-associated (lipo)proteins [Cell envelope
                     biogenesis, outer membrane]; Region: OmpA; COG2885"
                     /db_xref="CDD:225439"
     misc_feature    168830..169147
                     /locus_tag="BT0167"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(168851..168856,168953..168958,168965..168967,
                     168977..168982,168989..168991,169127..169129)
                     /locus_tag="BT0167"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(169163..169546)
                     /locus_tag="BT0168"
                     /db_xref="GeneID:4642634"
     CDS             complement(169163..169546)
                     /locus_tag="BT0168"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaK suppressor protein"
                     /protein_id="YP_945175.1"
                     /db_xref="GI:119952966"
                     /db_xref="GeneID:4642634"
                     /translation="MQKSNFEHEFVEKMRNFLLESKKEILNSIRSVEDSKREIINNDM
                     HLKDIIDIAFDNMDGNNLEALSSVEKKKLHLINQALYRISQNTYGNCLACDKSITRER
                     LVAIPYAFLCISCQTKKEKKGKRSI"
     misc_feature    complement(169172..169531)
                     /locus_tag="BT0168"
                     /note="DnaK suppressor protein [Signal transduction
                     mechanisms]; Region: DksA; COG1734"
                     /db_xref="CDD:224648"
     gene            169714..169935
                     /gene="infA"
                     /locus_tag="BT0169"
                     /db_xref="GeneID:4642625"
     CDS             169714..169935
                     /gene="infA"
                     /locus_tag="BT0169"
                     /note="stimulates the activities of the other two
                     initiation factors, IF-2 and IF-3"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="YP_945176.1"
                     /db_xref="GI:119952967"
                     /db_xref="GeneID:4642625"
                     /translation="MNTKEEAIETEGIVKESLPNTMFRVELKNGHLVLAHLSGKMRKH
                     FIKIVPGDRVKVELSPYDLTKGRIVYREK"
     misc_feature    169735..169926
                     /gene="infA"
                     /locus_tag="BT0169"
                     /note="S1_IF1: Translation Initiation Factor IF1, S1-like
                     RNA-binding domain. IF1 contains an S1-like RNA-binding
                     domain, which is found in a wide variety of RNA-associated
                     proteins. Translation initiation includes a number of
                     interrelated steps preceding the...; Region: S1_IF1;
                     cd04451"
                     /db_xref="CDD:239898"
     misc_feature    order(169759..169767,169783..169785,169819..169821,
                     169828..169833,169846..169857,169906..169908,
                     169912..169914)
                     /gene="infA"
                     /locus_tag="BT0169"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239898"
     misc_feature    order(169819..169821,169831..169833,169924..169926)
                     /gene="infA"
                     /locus_tag="BT0169"
                     /note="predicted 30S ribosome binding site; other site"
                     /db_xref="CDD:239898"
     gene            complement(169983..172028)
                     /locus_tag="BT0170"
                     /db_xref="GeneID:4642616"
     CDS             complement(169983..172028)
                     /locus_tag="BT0170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945177.1"
                     /db_xref="GI:119952968"
                     /db_xref="GeneID:4642616"
                     /translation="MGNKVRRTNCVFTRRLVISLVLFFINFEIYSLSGTDYLVSTKVL
                     QGSKVVHVIRLNLSQDIDESSLKFEISKDIKDNTEIASISKVPDGNNIVTEIKIEYGF
                     DKLGFVKIPSLKIVYLGEVYLSSEFEVVVLKEDESQFFGLPVRLYWDFDKEEIYEYQS
                     IGFVLRVNWLVNNNLKSIASSFNAVKDAMIDRTPIFENIKYRTFNSKEILDVPLYNFI
                     LTPLRGSKGIVIPSVSFNIGENVARMSPGISLKIKPIPDEVKSLAVGTFKIDYEFPNS
                     TLINQDTFTVLIKITGQGNLPHIRFPEIETYNSKVIYNKKNYNFEPSKDGYKGSISKI
                     YTLKPDNKGNLFLNIGDFTYLNPDDGKVYKLDGKRLKYEYYGEFKNNNDSGQELLSDF
                     SLLSYHDILKHRNKTFLFFVPVYYLILIPGILFSLAVFIRYKKFFIASGCGLVILILT
                     LAVSLNAMNDGSLSEDNINDLIEDYKSKNYDNALNRVDNILKKNPSYSGLWLNRALIL
                     NKMDRYFDAIYSAYKAFFTSPSNDTFYKVIDFIEAKNGVNENIRNNSFVWSNIFFIIS
                     LILINSLIVIISYKFYAKNLKRIILFLLLSVTCFTLFQTYYFYVDQQSEIGIIKGDLV
                     SLYKVPDNFSRSWRFLNGNISVYVLNRKDDFVLIQTSHGLQGWIYKNFIVSVKDSLI"
     misc_feature    complement(170724..171719)
                     /locus_tag="BT0170"
                     /note="Oxygen tolerance; Region: BatD; pfam13584"
                     /db_xref="CDD:257900"
     misc_feature    complement(170391..170606)
                     /locus_tag="BT0170"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(170457..170606)
                     /locus_tag="BT0170"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(order(170412..170414,170457..170459,
                     170466..170468,170478..170480,170514..170516,
                     170559..170561,170568..170570,170580..170582))
                     /locus_tag="BT0170"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(170394..170399,170406..170411,
                     170418..170423,170499..170504,170511..170516,
                     170520..170525))
                     /locus_tag="BT0170"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(170025..170189)
                     /locus_tag="BT0170"
                     /note="Bacterial SH3 domain homologues; Region: SH3b;
                     smart00287"
                     /db_xref="CDD:214600"
     gene            complement(171977..172564)
                     /locus_tag="BT0171"
                     /db_xref="GeneID:4642609"
     CDS             complement(171977..172564)
                     /locus_tag="BT0171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical cytosolic protein"
                     /protein_id="YP_945178.1"
                     /db_xref="GI:119952969"
                     /db_xref="GeneID:4642609"
                     /translation="MGRNFLICFLMSLMFASFLSCSNIRAMSLMAIGNYEYIRGDYQG
                     AISTYYDLVDDKQGTSWGYYNLGIVYYSLGEYESSLRMFSYAKRDNDSFLNFNINYNE
                     GIIYYNQGLYRKAEVAFKEALRINPASYNAKYNLELAIIKKRSIPDDLDSLSVKRSQN
                     FIENNENFLRYIENLERVLWVTRSEEQTVFLREDW"
     misc_feature    complement(172316..172489)
                     /locus_tag="BT0171"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    complement(172184..172480)
                     /locus_tag="BT0171"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(172238..172243,172250..172255,
                     172268..172273,172349..172354,172361..172366,
                     172370..172375,172460..172465,172472..172477))
                     /locus_tag="BT0171"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(172199..172201,172208..172210,
                     172220..172222,172256..172258,172307..172309,
                     172316..172318,172328..172330,172364..172366,
                     172409..172411,172418..172420,172430..172432,
                     172466..172468))
                     /locus_tag="BT0171"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(172178..172375)
                     /locus_tag="BT0171"
                     /note="Tetratricopeptide repeat; Region: TPR_16;
                     pfam13432"
                     /db_xref="CDD:257757"
     gene            complement(172546..173535)
                     /locus_tag="BT0172"
                     /db_xref="GeneID:4642593"
     CDS             complement(172546..173535)
                     /locus_tag="BT0172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945179.1"
                     /db_xref="GI:119952970"
                     /db_xref="GeneID:4642593"
                     /translation="MSIGNYYAFYLFIILFLVLFLYIYNFRKALPLFKTLSLMYVNNA
                     YIKNYYIKKILMMFFFVLSLGSLIVSILDISWGQKATEDKRSNLRISFVVDISRSMLT
                     FDEEKSINRLESAKNFISLILNNFENVEYSLTIFKGKSLLVLPFSKDKASLHKILNYI
                     EPNLISSPGSFLGEGVFSAIQGIKDDSYYNFLIILTDGDEWGENNYYTFPKLIDALNV
                     TSFVVGIGSDKPSPLIDNNLSVKDKDGNVVKAVLDEDNLYLLTSSLKGSYYNLYLKGT
                     NYVINEIRNDIMKKSSSDILLIGILRYKLFLAISFLFIVLYLFVKVIKWDETF"
     misc_feature    complement(172549..173493)
                     /locus_tag="BT0172"
                     /note="Uncharacterized protein containing a von Willebrand
                     factor type A (vWA) domain [General function prediction
                     only]; Region: COG2304"
                     /db_xref="CDD:225187"
     misc_feature    complement(172840..173271)
                     /locus_tag="BT0172"
                     /note="von Willebrand factor type A domain; Region: VWA_2;
                     pfam13519"
                     /db_xref="CDD:257839"
     misc_feature    complement(order(172945..172947,173014..173016,
                     173251..173253))
                     /locus_tag="BT0172"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(173532..174557)
                     /locus_tag="BT0173"
                     /db_xref="GeneID:4642477"
     CDS             complement(173532..174557)
                     /locus_tag="BT0173"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945180.1"
                     /db_xref="GI:119952971"
                     /db_xref="GeneID:4642477"
                     /translation="MKNLIEVIMLTFNEPLYLFLLIILPFIIYFGHFFKRRGGKVKFP
                     ISIYGNLGSIKLRDYGLNLLYFITYAFFYLAMTVMILTLAGPSISKKKTTYLSSGADI
                     VIVLDISPSMGAIEFSSKNRLEFAKELIKYFVYQRENDNIGLVAFAKEASLIVPLTID
                     RDFFSKKLDDIYIMDLGNGSALGLGISIALSHLKHSEAPKRSVIVLTDGVVNSDEVYK
                     DQVINLAQGLNVKIYSIGIGSSEELSVGFKLRSGRFYQGTLREIYDPSMLFEISGKTG
                     GLFYSVGDDFSFKLAIQDFSKKENVERKVKIAVDNDDIYNEFLLVIFFLLILYFILSK
                     VFLKEVL"
     misc_feature    complement(173613..174557)
                     /locus_tag="BT0173"
                     /note="Uncharacterized protein containing a von Willebrand
                     factor type A (vWA) domain [General function prediction
                     only]; Region: COG2304"
                     /db_xref="CDD:225187"
     misc_feature    complement(174300..174533)
                     /locus_tag="BT0173"
                     /note="Aerotolerance regulator N-terminal; Region: BatA;
                     pfam07584"
                     /db_xref="CDD:254301"
     misc_feature    complement(173694..174263)
                     /locus_tag="BT0173"
                     /note="VWA BatA type: Von Willebrand factor type A (vWA)
                     domain was originally found in the blood coagulation
                     protein von Willebrand factor (vWF). Typically, the vWA
                     domain is made up of approximately 200 amino acid residues
                     folded into a classic a/b...; Region: vWA_BatA_type;
                     cd01467"
                     /db_xref="CDD:238744"
     misc_feature    complement(order(173934..173936,174018..174020,
                     174225..174227,174231..174233,174237..174239))
                     /locus_tag="BT0173"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238744"
     gene            complement(174520..175419)
                     /locus_tag="BT0174"
                     /db_xref="GeneID:4642530"
     CDS             complement(174520..175419)
                     /locus_tag="BT0174"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945181.1"
                     /db_xref="GI:119952972"
                     /db_xref="GeneID:4642530"
                     /translation="MKNIIVFIMSFLSFYLFSYEIKNEIFIPTRYYVGDTVELKFSLI
                     LGENEKFIPAEFEEIKNEFVEVNSLLYRPESGEVIIYFVSFYVGSNTLPRIYVGDIIS
                     NDKSFKLILNNVKINTSKLIADDDVLKIQDIEGVLFLPGTSTYLVIFILALVVVPYFF
                     IKFLKLVKHLLVFLIMKHNLRKPYKVFQKQMIILSNYIKSDEEHVVFYNLLNSSLRVY
                     LSKKTGFDFNAITTTEISEILQNFNVPYEIRSTFVNMLRLSDFSKFSGMNLSGGNLSL
                     VLDDLREAAFNFEEFNRGDNVNI"
     gene            complement(175416..176297)
                     /locus_tag="BT0175"
                     /db_xref="GeneID:4642526"
     CDS             complement(175416..176297)
                     /locus_tag="BT0175"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical cytosolic protein"
                     /protein_id="YP_945182.1"
                     /db_xref="GI:119952973"
                     /db_xref="GeneID:4642526"
                     /translation="MQYDNESNASTKNKIKALKFFSRKMLLELNFGGYRSIFKGLGLE
                     FHEFRPYEETDDARLIDWNVSSKTDSIFSKVFREDKGMNLHLLVDNSLSMSLGSLTSK
                     KEIQDLLVSIFAHMAFFNNDKIGITFFSSETDKFISSRKGHSHLGRILNETINRRIKR
                     GSNLTYVFKNTAEYYKKRSLIIIISDFKASDYFKSLTVLSKRHNIIAIRLTDFFDENL
                     PQYGVLTYEDIETCEDFLTSGFSKTILNSYKNYWTLDKIKWRKECIKRGINFIEISTK
                     DDVFRKLKALLKKENDI"
     misc_feature    complement(175437..>176240)
                     /locus_tag="BT0175"
                     /note="Uncharacterized conserved protein (some members
                     contain a von Willebrand factor type A (vWA) domain)
                     [General function prediction only]; Region: COG1721"
                     /db_xref="CDD:224635"
     misc_feature    complement(175920..176174)
                     /locus_tag="BT0175"
                     /note="Protein of unknown function DUF58; Region: DUF58;
                     pfam01882"
                     /db_xref="CDD:250938"
     misc_feature    complement(<175692..176042)
                     /locus_tag="BT0175"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(175740..175742,175803..175805,
                     176031..176033))
                     /locus_tag="BT0175"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(176313..177305)
                     /locus_tag="BT0176"
                     /db_xref="GeneID:4642686"
     CDS             complement(176313..177305)
                     /locus_tag="BT0176"
                     /codon_start=1
                     /transl_table=11
                     /product="MoxR protein"
                     /protein_id="YP_945183.1"
                     /db_xref="GI:119952974"
                     /db_xref="GeneID:4642686"
                     /translation="MKSSFQIDSEVENALGLINKFRREVASRILGQREMIDAILMGIL
                     TEGHVLLEGVPGLAKTLTIQTVSDVLDLGFKRVQFTPDLLPSDLTGNMVYKSTTGTFK
                     VRKGPVFSNIILADEINRAPAKVQSALLEAMSERQVTLGDETHKLPDPFFVLATQNPI
                     EQEGTYNLPEAQLDRFLLKVNVKYPSIQDEIKLLKIFSVDGGLENIKVAKIMNAYSLA
                     DLKRTIGKVKVDDKIMLYIVTLIAASRENDKKTYPFTKYIEFGASPRASLSLLKCARV
                     NALYEGRLFVLPEDVKAVAYNVLRHRITPSYEAEVEEMNTDDIIKILLSAVALP"
     misc_feature    complement(176316..177287)
                     /locus_tag="BT0176"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    complement(176754..177215)
                     /locus_tag="BT0176"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(177126..177149)
                     /locus_tag="BT0176"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(176835..176837,176958..176960,
                     177123..177146))
                     /locus_tag="BT0176"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(176955..176972)
                     /locus_tag="BT0176"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(176781..176783)
                     /locus_tag="BT0176"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(177376..177999)
                     /locus_tag="BT0177"
                     /db_xref="GeneID:4642527"
     CDS             complement(177376..177999)
                     /locus_tag="BT0177"
                     /EC_number="2.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase GidB"
                     /protein_id="YP_945184.1"
                     /db_xref="GI:119952975"
                     /db_xref="GeneID:4642527"
                     /translation="MMNDFELSLKSLGVSFTSKSIDKLRFYIEKVLLFGTRFNLVSNN
                     DRNFDAVLLHVLDSVAGLPIIKDKNPRQVLDVGSGAGFPGIVLALFDNFRKYILLERS
                     NKKATFLRMISLELGLDNIEVLERDVDKEQNKYEFITIRAFRDIREYARILKLILKDG
                     GLIVAYKGKLNKIKFEVSHIESLFNKIEIKSSTMNDGKERNFLLLYK"
     misc_feature    complement(177379..177999)
                     /locus_tag="BT0177"
                     /note="Predicted S-adenosylmethionine-dependent
                     methyltransferase involved in bacterial cell division
                     [Cell envelope biogenesis, outer membrane]; Region: GidB;
                     COG0357"
                     /db_xref="CDD:223434"
     misc_feature    complement(177508..177783)
                     /locus_tag="BT0177"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(177616..177624,177697..177702,
                     177754..177774))
                     /locus_tag="BT0177"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(177996..179882)
                     /locus_tag="BT0178"
                     /db_xref="GeneID:4642064"
     CDS             complement(177996..179882)
                     /locus_tag="BT0178"
                     /note="GidA; glucose-inhibited cell division protein A;
                     involved in the 5-carboxymethylaminomethyl modification
                     (mnm(5)s(2)U) of the wobble uridine base in some tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme GidA"
                     /protein_id="YP_945185.1"
                     /db_xref="GI:119952976"
                     /db_xref="GeneID:4642064"
                     /translation="MFRKIDIDMDFDAIVIGGGHAGIEASLALSRLNFKTLLITQNLD
                     TIGKLSCNPAIGGLAKGNMVREIDALGGEMGCLVDFSMIQFRILNKSRGPAVQAPRAQ
                     ADKLVYQVKAKETLERQINLDLFQDTVSDFLLNSMRNRIEGVVTERGNKFTSRVVVLT
                     TGTFLRGKIFIGEYRACMGRISEPAAYGLEKILLELGFEMGRLKTGTPARVHRKSINF
                     AKTEIQFGDSDIIPFSFSNTKIDKVQLSCYITYTNKKTHAIISDNMHLSPLYSGEIIG
                     NGPRYCPSIEDKIVKFKDKDKHQIFIEPEGLSTEEMYLNGLSSSLPEDVQKRLINSID
                     GLENAVITRPGYAVEYDYINPIELYASLETKRVKGLFVAGQTNGSSGYEEAAAQGLMA
                     GINAALKLQGKDPMILPRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSD
                     KRLIKWGYEVGLVSEEKYSRYFFKEKQVEEIKELLRQRRLKEREASTLQLKKHISKDF
                     YHIIKDPYINLSDLIDIDPKLNASKVILEQVELDIKYEGYINRQKDLIRKMNNLELIK
                     LPLDFDYEIDGLSREAREKFVKIQPANLAQASRISGVRNTDIQVLLIYFSSPKNKVVL
                     NLAL"
     misc_feature    complement(178041..179861)
                     /locus_tag="BT0178"
                     /note="tRNA uridine 5-carboxymethylaminomethyl
                     modification enzyme GidA; Validated; Region: PRK05192"
                     /db_xref="CDD:235362"
     misc_feature    complement(<179673..179858)
                     /locus_tag="BT0178"
                     /note="Anaerobic glycerol-3-phosphate dehydrogenase [Amino
                     acid transport and metabolism]; Region: GlpB; cl17730"
                     /db_xref="CDD:248284"
     misc_feature    complement(178626..>178907)
                     /locus_tag="BT0178"
                     /note="tRNA (uracil-5-)-methyltransferase Gid; Reviewed;
                     Region: PRK05335"
                     /db_xref="CDD:235416"
     misc_feature    complement(178044..178256)
                     /locus_tag="BT0178"
                     /note="GidA associated domain 3; Region: GIDA_assoc_3;
                     pfam13932"
                     /db_xref="CDD:258194"
     gene            complement(179867..181261)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /db_xref="GeneID:4642310"
     CDS             complement(179867..181261)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="in Escherichia coli this protein is involved in the
                     biosynthesis of the hypermodified nucleoside
                     5-methylaminomethyl-2-thiouridine, which is found in the
                     wobble position of some tRNAs and affects ribosomal
                     frameshifting; shows potassium-dependent dimerization and
                     GTP hydrolysis; also involved in regulation of
                     glutamate-dependent acid resistance and activation of
                     gadE"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase TrmE"
                     /protein_id="YP_945186.1"
                     /db_xref="GI:119952977"
                     /db_xref="GeneID:4642310"
                     /translation="MSNLFQREDDIVALATPLLSSALCVIRSSGISSIEKFSKMFSDP
                     KRLLEASGHTIHYGYLIDKEICEKLDEVVVCIYRAPKSFTGQNSIEVMAHGSPIGIKR
                     IIGCFLKVGFRMAEPGEFTLRAFLAGKLDLTKAEAVNELISAKTNKTHSLAVNKLSGS
                     LFAKIDLIKKDILNFLSALSVHLDYETSEYEVAIPFEIISKSRDELKRLVDSYNTARK
                     LDYGIALVLAGSVNVGKSSLFNLLLKEDRAIVSSYAGTTRDYIQASFEFDGILFNVFD
                     TAGLRETTDFVEQLGIVKSNSLIKEASLVLYVIDLSARLTNDDLKFIDSYKGHSKVIF
                     VLNKMDLEPNRQTVEFFNSGNINSSNLVKISTKTLFGIDSLYDKIRSLTCFDYIDIDA
                     YDVIVSSSRQAELLKKAYTLIIELLNKIEKDISYDMLAFDVYEVLNFLGEITGEVTSE
                     DVLNNMFKNFCLGK"
     misc_feature    complement(179870..181249)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="tRNA modification GTPase TrmE; Reviewed; Region:
                     trmE; PRK05291"
                     /db_xref="CDD:235392"
     misc_feature    complement(180875..181231)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="GTP-binding protein TrmE N-terminus; Region:
                     TrmE_N; pfam10396"
                     /db_xref="CDD:204472"
     misc_feature    complement(180116..180598)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="trmE is a tRNA modification GTPase; Region: trmE;
                     cd04164"
                     /db_xref="CDD:206727"
     misc_feature    complement(180554..180577)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="G1 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(order(180161..180169,180242..180244,
                     180248..180253,180551..180562,180566..180568))
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206727"
     misc_feature    complement(180482..180532)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(180491..180493)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="G2 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(order(180359..180403,180407..180439))
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(180425..180436)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="G3 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(180242..180253)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="G4 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(180161..180169)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="G5 box; other site"
                     /db_xref="CDD:206727"
     misc_feature    complement(179879..180082)
                     /gene="trmE"
                     /locus_tag="BT0179"
                     /note="Catalytic cysteine-containing C-terminus of GTPase,
                     MnmE; Region: GTPase_Cys_C; pfam12631"
                     /db_xref="CDD:257176"
     gene            181397..181891
                     /locus_tag="BT0180"
                     /db_xref="GeneID:4642308"
     CDS             181397..181891
                     /locus_tag="BT0180"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlbF"
                     /protein_id="YP_945187.1"
                     /db_xref="GI:119952978"
                     /db_xref="GeneID:4642308"
                     /translation="MKTKLETELKNTLQEEVLLVEDIYNMYLNIKRYLDEKNEKMFKE
                     AINKTNIYLHKFKDIEHKRDELWKNFTDLEKFESTYMAIEKLCLVYKKEIYNYFHRLR
                     IGILNIQNLNYLISSYTETSLGILDLIFKDAQESVDNITYKNPYGPKSGSLNETSVLI
                     NKKL"
     gene            181910..183793
                     /gene="flgK"
                     /locus_tag="BT0181"
                     /db_xref="GeneID:4642296"
     CDS             181910..183793
                     /gene="flgK"
                     /locus_tag="BT0181"
                     /note="with FlgL acts as a hook filament junction protein
                     to join the flagellar filament to the hook"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgK"
                     /protein_id="YP_945188.1"
                     /db_xref="GI:119952979"
                     /db_xref="GeneID:4642296"
                     /translation="MDSTFSGIEIGKKSLFAHKDAMNTIGHNLTNTSKPGYSRQRVIM
                     KTEIPIYAPQLNRANKVGQLGQGIMVQSIERVRDDLLDIKIAEESHRLGYWSSKDKFI
                     SLLENVYNEPEEQSIRKRLNDFWDSWQDLSKQPQGLAERNIILERGQSFAEVVSNRFH
                     SLKRIYTMANDEVKITTEEINNYLRNISDLNRQIAKAIAMKDQPNDLMDERDLIVDKL
                     SNLISISIENKRDPNEFLIYVEGKHLIQGAIANEFILEAANGPTGTKWNVLWNNGEPA
                     NINTGKLGALINVRDNEIKNEINEIDNMAINITELVNEVHVSGHGLDQKNGRIFFDQE
                     YKLTDERGRYDSNGDGQFDSVHIFKINSTNEIFPEENLGFSGILKFQAINKNDFIEIP
                     YNTTDTVQDVINKINNSNSQVTARINAEGKFEIKAIKEEENDSAIFRIRYIEDSGLFL
                     TTYTGILNASGTEGAYNYQDVNTTNQLINTVSYSIAPLKNPAAWLKVSREIAEDPSKI
                     ASGIKTPTNNAPIGDNKAALRIASFVNSQIMIGKNATLNDYFANTASNIAIKGQTAEI
                     TKNSQEQILKNLTDLRLSISGVNKDEELANMIEFQQSFIAASKFITVSAELIDTIINK
                     MGV"
     misc_feature    181910..183790
                     /gene="flgK"
                     /locus_tag="BT0181"
                     /note="flagellar hook-associated protein FlgK; Validated;
                     Region: flgK; PRK06665"
                     /db_xref="CDD:180650"
     misc_feature    183041..183190
                     /gene="flgK"
                     /locus_tag="BT0181"
                     /note="Flagellin hook IN motif; Region: Flagellin_IN;
                     pfam07196"
                     /db_xref="CDD:254098"
     misc_feature    <183656..183778
                     /gene="flgK"
                     /locus_tag="BT0181"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            183797..185071
                     /locus_tag="BT0182"
                     /db_xref="GeneID:4642295"
     CDS             183797..185071
                     /locus_tag="BT0182"
                     /note="With FlgK acts as a hook filament junction protein
                     to join the flagellar filament to the hook"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgL"
                     /protein_id="YP_945189.1"
                     /db_xref="GI:119952980"
                     /db_xref="GeneID:4642295"
                     /translation="MINRVSHPLTYDNLKTSSTDKEVKITKLLGSLYQGGKRITNLRD
                     DPTGVTHAIRLDSDIFKLNTYVKNINSAKGKLRYMEGYLQSLANILTRAKEITVQGAS
                     GTYKTDDKKIIAKEINAILEDVLAIANVKGADGYSIFAGTKIDNEAFKVIRENRINKL
                     TQDKAETQIVRIDYNGNQAEQTTEIYNGIYIPTNYPGSEIFFSHNHYITSSKNVNGFI
                     VKENTKIYIDNIEIALTAGDTAADIIAKINESSAPVEATLDRILNSMVIQTTIPHQIW
                     ITEEEGSTVLKELGILTQNNETKEPPYNIANNTEVRNRTIFDSLIELRDNLEENREEI
                     IGSRGLAEIDASLNKIFATLADLGTKENRLDRSYERISKEIMDMKDDMVKYTDLDVTK
                     AITELNMTSLAYQVSLGVSARIMQTTLLDFLK"
     misc_feature    183800..185068
                     /locus_tag="BT0182"
                     /note="flagellar hook-associated protein FlgL; Validated;
                     Region: PRK06663"
                     /db_xref="CDD:180648"
     misc_feature    <183902..184225
                     /locus_tag="BT0182"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    184823..185065
                     /locus_tag="BT0182"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            185073..185465
                     /locus_tag="BT0183"
                     /db_xref="GeneID:4642278"
     CDS             185073..185465
                     /locus_tag="BT0183"
                     /note="binds to flagellin and appears to stabilize
                     flagellin during flagella assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein FliW"
                     /protein_id="YP_945190.1"
                     /db_xref="GI:119952981"
                     /db_xref="GeneID:4642278"
                     /translation="MKNEISIKFNFPEGILGFEEIKEFIIKDSEHKPFSIMQSINGEI
                     NFLVTSPFNFLEKYLPNIEEEDWLDIQTENEDEKVILCIINMHVKNYKEITANLKAPI
                     ILNKKKLIGKQAISTNEEHYLRYRVFKE"
     misc_feature    185097..185462
                     /locus_tag="BT0183"
                     /note="flagellar assembly protein FliW; Provisional;
                     Region: PRK13285"
                     /db_xref="CDD:237334"
     gene            185468..185704
                     /locus_tag="BT0184"
                     /db_xref="GeneID:4642914"
     CDS             185468..185704
                     /locus_tag="BT0184"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator"
                     /protein_id="YP_945191.1"
                     /db_xref="GI:119952982"
                     /db_xref="GeneID:4642914"
                     /translation="MLVLSRKANESIKIDSNIEISILEIKKDSVKIAIKAPANIKILR
                     SEIYDIIKEENKKSILQDKNNIHKIKNLFDYLSK"
     misc_feature    185468..185629
                     /locus_tag="BT0184"
                     /note="Global regulator protein family; Region: CsrA;
                     pfam02599"
                     /db_xref="CDD:251406"
     gene            complement(185689..186351)
                     /locus_tag="BT0185"
                     /db_xref="GeneID:4642312"
     CDS             complement(185689..186351)
                     /locus_tag="BT0185"
                     /EC_number="3.4.24.57"
                     /codon_start=1
                     /transl_table=11
                     /product="O-sialoglycoprotein endopeptidase"
                     /protein_id="YP_945192.1"
                     /db_xref="GI:119952983"
                     /db_xref="GeneID:4642312"
                     /translation="MNTLAIEYSHKTLLIHFEINGEVFSIIKSKDNINYTLSIPKLFN
                     DFVLEYGIDLKKLDLLINSSGPGSFTGLRISLSFIKGLSLGLSIPFVNVPTFDVFAKL
                     VNTSADTLTLSFTAGKYFLGCYKNSKFCGKIFCFSESELFEYLDSLDLKFVIVGNGIE
                     FIYEKLKNKFEIIIDMDSFGSVLTELGKFKYVENRQGDDILSGPFYVRLSDAEIKSYL
                     LR"
     misc_feature    complement(185707..186351)
                     /locus_tag="BT0185"
                     /note="Inactive homolog of metal-dependent proteases,
                     putative molecular chaperone [Posttranslational
                     modification, protein turnover, chaperones]; Region:
                     COG1214"
                     /db_xref="CDD:224135"
     gene            complement(186332..186760)
                     /locus_tag="BT0186"
                     /db_xref="GeneID:4642294"
     CDS             complement(186332..186760)
                     /locus_tag="BT0186"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP/GTP hydrolase"
                     /protein_id="YP_945193.1"
                     /db_xref="GI:119952984"
                     /db_xref="GeneID:4642294"
                     /translation="MTLSFETEKEMINFSKSFFNPLPIGKIFGLCGDMGTGKTTFLKG
                     LALNLGISYFTSPTYNIVNFYEFVDFKFYHIDLYRLNILDEFQLIGGMELLLDMSAII
                     AIEWPEIIIDVLPKNRLMFLTFKIKNTSRILEFSDEYPCN"
     misc_feature    complement(<186425..186688)
                     /locus_tag="BT0186"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    complement(186644..186667)
                     /locus_tag="BT0186"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(186425..186427,186500..186502,
                     186641..186649,186653..186658))
                     /locus_tag="BT0186"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(186500..186511)
                     /locus_tag="BT0186"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(186470..186499)
                     /locus_tag="BT0186"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(186425..186439)
                     /locus_tag="BT0186"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     gene            complement(186757..187071)
                     /locus_tag="BT0187"
                     /db_xref="GeneID:4642291"
     CDS             complement(186757..187071)
                     /locus_tag="BT0187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945194.1"
                     /db_xref="GI:119952985"
                     /db_xref="GeneID:4642291"
                     /translation="MKIFLCWLLGILFKGILFVKFISLDNISKQDSHIYYRRVYFADA
                     FYEYKGSSETKQVKFTIEVTPLGEKHITIDFVDPLNYPVLSLMVAIKRHVIDLDIKGE
                     LP"
     gene            complement(187221..187568)
                     /gene="rplT"
                     /locus_tag="BT0188"
                     /db_xref="GeneID:4642288"
     CDS             complement(187221..187568)
                     /gene="rplT"
                     /locus_tag="BT0188"
                     /note="binds directly to 23S ribosomal RNA prior to in
                     vitro assembly of the 50S ribosomal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="YP_945195.1"
                     /db_xref="GI:119952986"
                     /db_xref="GeneID:4642288"
                     /translation="MARVKNGIVHVARRKKILKKTKGFWGTKKSNYKKAKDTLRKGMM
                     YATRDRKTRKRDFRSLWIVRISAALTGMGINYSKFFESLKKSNIKLNRKILSNLAIED
                     IETFKKIVYEIKN"
     misc_feature    complement(187239..187553)
                     /gene="rplT"
                     /locus_tag="BT0188"
                     /note="Ribosomal protein L20; Region: Ribosomal_L20;
                     cd07026"
                     /db_xref="CDD:197305"
     misc_feature    complement(order(187287..187295,187317..187319,
                     187326..187331,187338..187343,187359..187361,
                     187371..187373,187380..187388,187392..187436,
                     187443..187448,187458..187463,187470..187481,
                     187485..187508,187521..187532,187536..187553))
                     /gene="rplT"
                     /locus_tag="BT0188"
                     /note="23S rRNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:197305"
     misc_feature    complement(order(187242..187247,187263..187268,
                     187284..187286,187293..187304,187419..187421,
                     187428..187433,187437..187442,187449..187451,
                     187461..187463))
                     /gene="rplT"
                     /locus_tag="BT0188"
                     /note="L21 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     misc_feature    complement(order(187269..187271,187278..187280,
                     187287..187289,187359..187361,187365..187370,
                     187377..187379,187386..187391,187398..187400))
                     /gene="rplT"
                     /locus_tag="BT0188"
                     /note="L13 binding site [polypeptide binding]; other site"
                     /db_xref="CDD:197305"
     gene            complement(187590..187787)
                     /gene="rpmI"
                     /locus_tag="BT0189"
                     /db_xref="GeneID:4642282"
     CDS             complement(187590..187787)
                     /gene="rpmI"
                     /locus_tag="BT0189"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="YP_945196.1"
                     /db_xref="GI:119952987"
                     /db_xref="GeneID:4642282"
                     /translation="MSKMKTCKSAKKRYAFTSKGKIKYKKQNLRHILTKKSSKRRRKL
                     GKSGLVSSFEVKRIKTLLPYA"
     misc_feature    complement(187593..187787)
                     /gene="rpmI"
                     /locus_tag="BT0189"
                     /note="50S ribosomal protein L35; Reviewed; Region: rpmI;
                     PRK00172"
                     /db_xref="CDD:234676"
     gene            complement(187804..188364)
                     /gene="infC"
                     /locus_tag="BT0190"
                     /db_xref="GeneID:4642775"
     CDS             complement(187804..188364)
                     /gene="infC"
                     /locus_tag="BT0190"
                     /note="IF-3 has several functions that are required and
                     promote translation initiation including; preventing
                     association of 70S by binding to 30S; monitoring
                     codon-anticodon interactions by promoting disassociation
                     of fMet-tRNA(fMet) from initiation complexes formed on
                     leaderless mRNAs or incorrectly bound noninitiatior tRNAs
                     and complexes with noncanonical start sites; stimulates
                     codon-anticodon interactions at P-site; involved in moving
                     mRNA to the P-site; and in recycling subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="YP_945197.1"
                     /db_xref="GI:119952988"
                     /db_xref="GeneID:4642775"
                     /translation="MINRSSGKDRDRSRSGDKELRINHKIKAREVRVIFDNGTQSVLP
                     IEDAIKCARDAELDLVEISPNSVPPVCKIIDYGKYKFHQEKRQKEQKRNQKIIKLKEV
                     RMQPKIDTHDLDFKYRNILGFLKEGNKVKVTIRFRGRELAHTHLGYGILESILERVGE
                     SNYVLESPAKMEGKTMFLIIAPKSKK"
     misc_feature    complement(187807..188337)
                     /gene="infC"
                     /locus_tag="BT0190"
                     /note="translation initiation factor IF-3; Reviewed;
                     Region: infC; PRK00028"
                     /db_xref="CDD:234582"
     misc_feature    complement(188092..188313)
                     /gene="infC"
                     /locus_tag="BT0190"
                     /note="Translation initiation factor IF-3, N-terminal
                     domain; Region: IF3_N; pfam05198"
                     /db_xref="CDD:191228"
     misc_feature    complement(187813..188079)
                     /gene="infC"
                     /locus_tag="BT0190"
                     /note="Translation initiation factor IF-3, C-terminal
                     domain; Region: IF3_C; pfam00707"
                     /db_xref="CDD:250071"
     gene            188542..189204
                     /locus_tag="BT0192"
                     /db_xref="GeneID:4642667"
     CDS             188542..189204
                     /locus_tag="BT0192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945198.1"
                     /db_xref="GI:119952989"
                     /db_xref="GeneID:4642667"
                     /translation="MNIFLLISLPLVFKIYMIINHPQLKLIKQNYIHATSILFAMTIF
                     SLLYLIEEFILYKSLLINYQTKFSLAYSIFIKEQIYYYVFPLFIFTFFFTFNPNSLLK
                     KNPIFLIYFAFGLILSKNLALIITNSKVFGTYEYIKIPLLHILELIFTAIICEKGIRL
                     HITQNINGYQLIFVPILILEAIITFLKVLILTNAQIYALITLIILLGITIVNKKAIGT
                     VK"
     gene            189204..189950
                     /locus_tag="BT0193"
                     /db_xref="GeneID:4642160"
     CDS             189204..189950
                     /locus_tag="BT0193"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945199.1"
                     /db_xref="GI:119952990"
                     /db_xref="GeneID:4642160"
                     /translation="MIHTIKTFIITIILILCFSCKNNKITDKNFSYIIIFSDTTEYFF
                     KIKNSPFIQDKTLFINEKDIEIIKDKLNNVKKILLTHKSNNEIFNINKIKKKTFYLSK
                     VKFSLKKAIDFIFSDPSIDLTTSLIMKDNTLNQTDSEHLEKSAKEQNINITTINDKNI
                     LYLKNLITPKITKVILFSMRNNHVFLKKLSESSFFKKIEFILIGSNKKNLKEINTKYI
                     ISMNELDLIEITKKINKDFQYEFNIYEKTI"
     gene            complement(190041..190838)
                     /locus_tag="BT0194"
                     /db_xref="GeneID:4642516"
     CDS             complement(190041..190838)
                     /locus_tag="BT0194"
                     /EC_number="3.1.21.-"
                     /codon_start=1
                     /transl_table=11
                     /product="sec-independent protein translocase protein
                     TatD"
                     /protein_id="YP_945200.1"
                     /db_xref="GI:119952991"
                     /db_xref="GeneID:4642516"
                     /translation="MNLNFERSIFLKKLIDTHVHFNELKKNSIDIHYLINECLKNGFS
                     YFLDIGLHPSDFYERKQLLDTYPNISLTVGIHPLNKALRDDFELIESILENENVVAVG
                     EIGLDYLKGDNKSEQIEALNIQLDLASKYKKPVILHVREAYDDIYNIIKSSNFISRGI
                     LHCYSGNYEYAKKFIDFGFKISFAGNLTFKNSEPLRGVLKKLNIEDILIETDSPFLAP
                     VPLRGKINAPCFLGYTCLEIAKIKNCDVDSVIIALYDNFKDLFNDLI"
     misc_feature    complement(190053..190799)
                     /locus_tag="BT0194"
                     /note="TatD like proteins;  E.coli TatD is a cytoplasmic
                     protein, shown to have magnesium dependent DNase activity;
                     Region: TatD_DNAse; cd01310"
                     /db_xref="CDD:238635"
     misc_feature    complement(order(190203..190205,190353..190355,
                     190425..190427,190779..190781,190785..190787))
                     /locus_tag="BT0194"
                     /note="active site"
                     /db_xref="CDD:238635"
     gene            complement(190835..191977)
                     /locus_tag="BT0195"
                     /db_xref="GeneID:4642435"
     CDS             complement(190835..191977)
                     /locus_tag="BT0195"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat family protein"
                     /protein_id="YP_945201.1"
                     /db_xref="GI:119952992"
                     /db_xref="GeneID:4642435"
                     /translation="MLDKKLLGEFGDISQISDNELLDVTEKSKRGYQLIKEERLPEAE
                     ALFNDILQKDYDNNYALVGLGDIERKKRNFDKAIIYYQKCLAKHSNNNYALFGLGDCY
                     RSLGDYKKATDVWEEYLKYDPENITVLTRVASSYRKLKNFQKSRQSYLRVLEFVPDND
                     YALVGIGHLYYDFKEYKEALKYWLRMYEINQVKIDVRVLTSIGNCYRKLKEFSKGIYF
                     FKRALEISPNNFYAIFGLADCYRGSKEYHEALKYWLTIIDKDPKNNLVLTRVGDTYRY
                     LKEYENSQIYYKKALDVDFDMFAILGLALLQKEQGQYEEALSAIKNLIKTNPKNSILY
                     VNAAECYEALGQIESAVDILSSFLQLGMKNVTIIDYINNLKKKMDA"
     misc_feature    complement(191606..191893)
                     /locus_tag="BT0195"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(191663..191668,191675..191680,
                     191687..191692,191768..191773,191780..191785,
                     191789..191794,191879..191884,191891..191893))
                     /locus_tag="BT0195"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(191624..191626,191633..191635,
                     191645..191647,191681..191683,191726..191728,
                     191735..191737,191747..191749,191783..191785,
                     191828..191830,191837..191839,191849..191851,
                     191885..191887))
                     /locus_tag="BT0195"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(191048..191869)
                     /locus_tag="BT0195"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    complement(191423..191701)
                     /locus_tag="BT0195"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(191459..191464,191471..191476,
                     191483..191488,191564..191569,191576..191581,
                     191585..191590,191675..191680,191687..191692,
                     191696..191701))
                     /locus_tag="BT0195"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(191429..191431,191441..191443,
                     191477..191479,191522..191524,191531..191533,
                     191543..191545,191579..191581,191624..191626,
                     191633..191635,191645..191647,191681..191683))
                     /locus_tag="BT0195"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(191096..191386)
                     /locus_tag="BT0195"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(191147..191152,191159..191164,
                     191171..191176,191252..191257,191264..191269,
                     191273..191278,191363..191368,191375..191380,
                     191384..191386))
                     /locus_tag="BT0195"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(191108..191110,191117..191119,
                     191129..191131,191165..191167,191210..191212,
                     191219..191221,191231..191233,191267..191269,
                     191312..191314,191321..191323,191333..191335,
                     191369..191371))
                     /locus_tag="BT0195"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(190898..191182)
                     /locus_tag="BT0195"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(190946..190951,190958..190963,
                     190970..190975,191051..191056,191063..191068,
                     191072..191077,191159..191164,191171..191176,
                     191180..191182))
                     /locus_tag="BT0195"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(190907..190909,190916..190918,
                     190928..190930,190964..190966,191009..191011,
                     191018..191020,191030..191032,191066..191068,
                     191108..191110,191117..191119,191129..191131,
                     191165..191167))
                     /locus_tag="BT0195"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(190886..191077)
                     /locus_tag="BT0195"
                     /note="Tetratricopeptide repeat; Region: TPR_16;
                     pfam13432"
                     /db_xref="CDD:257757"
     gene            192275..193348
                     /gene="prfA"
                     /locus_tag="BT0196"
                     /db_xref="GeneID:4642161"
     CDS             192275..193348
                     /gene="prfA"
                     /locus_tag="BT0196"
                     /note="RF-1; recognizes the termination signals UAG and
                     UAA during protein translation a specificity which is
                     dependent on amino acid residues residing in loops of the
                     L-shaped tRNA-like molecule of RF1; this protein is
                     similar to release factor 2"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="YP_945202.1"
                     /db_xref="GI:119952993"
                     /db_xref="GeneID:4642161"
                     /translation="MFLERLSPIESKIKILEEKLQDTNLIKNQKEYAKVIKEYNYLEK
                     IKEKKDEYENIISQIDENQKILSEEENLEMKELIKQELTHLNLKKDEIEHTIKILLLH
                     QDENDNKNIIIEIRAGTGGEEAALFAHNLYEMYTKYSEKKKWKTELINFNETELGGFK
                     EVSFEIKGKEVFKKLKHESGVHRVQRVPITESNGRLQTSAATVAVLPEVEETDIEINE
                     KDLRIDVYRSSGAGGQHVNTTDSAVRITHLPTGIVVQCQNERSQHKNKDQAMKILRAR
                     LYKFEDLKKQEQRSNDRKQQVGSGDRSERIRTYNFPQNRVTEHRANISLYKLEEIMQG
                     ELDLLLDTLALKLQEQALKDNPI"
     misc_feature    192275..193279
                     /gene="prfA"
                     /locus_tag="BT0196"
                     /note="peptide chain release factor 1; Validated; Region:
                     prfA; PRK00591"
                     /db_xref="CDD:234801"
     misc_feature    192464..192808
                     /gene="prfA"
                     /locus_tag="BT0196"
                     /note="PCRF domain; Region: PCRF; pfam03462"
                     /db_xref="CDD:251973"
     misc_feature    192893..193234
                     /gene="prfA"
                     /locus_tag="BT0196"
                     /note="RF-1 domain; Region: RF-1; pfam00472"
                     /db_xref="CDD:249886"
     gene            193358..194191
                     /locus_tag="BT0197"
                     /db_xref="GeneID:4642895"
     CDS             193358..194191
                     /locus_tag="BT0197"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide release factor-glutamine
                     N5-methyltransferase"
                     /protein_id="YP_945203.1"
                     /db_xref="GI:119952994"
                     /db_xref="GeneID:4642895"
                     /translation="MTINEAIKKSKQHNLNTLEILLLLEKILKSRKELILANINKNLT
                     KQEEHKLSCQINRIRSGTPINYILKTKEFMGIEFYINKHVLIPREDTECLVEEALIQI
                     KKHNLNKILDLCCGSGCIGLTIAHYLKCKVTLSDISNKALKVSLKNTQKLKLENYIEI
                     QYSDLLKYINKEFELIITNPPYLNKDELKIKEKLIKEPRIALLGFGKDGLEIPKKIIR
                     QAKHKLAKNGLLIIEMAPWQTKSLKDFAIQEGFDYLKTIYDIESRERALVLRIKNDTS
                     L"
     misc_feature    193445..194161
                     /locus_tag="BT0197"
                     /note="protein-(glutamine-N5) methyltransferase, release
                     factor-specific; Region: RF_mod_PrmC; TIGR03534"
                     /db_xref="CDD:234248"
     misc_feature    193682..194056
                     /locus_tag="BT0197"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(193694..193714,193763..193768,193844..193852,
                     193892..193894)
                     /locus_tag="BT0197"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            194175..196178
                     /locus_tag="BT0198"
                     /db_xref="GeneID:4642430"
     CDS             194175..196178
                     /locus_tag="BT0198"
                     /EC_number="3.1.7.2"
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /protein_id="YP_945204.1"
                     /db_xref="GI:119952995"
                     /db_xref="GeneID:4642430"
                     /translation="MIQVYEIAYLLKINDIDKLKNIFRKTVNNIYQDDIQKKLIFKAL
                     EISEQLHYGQYRESKEPYVIHPIMVSLFLIKFQLDFKTIIAGLLHDVLEDTSVKKEEI
                     IKEFDQEILSLIDGVTKIHDLHNKTRAIKEANTISKMFFAMTHDIRIIIIKLADKLHN
                     MATLSHLPKNRRERIARDCLATYVPIAERLGISSLKIYLEDLSLKYLYPKEYKEIKNF
                     LSATKIEREKKLYKGKLIIEKELKKIGIDVTITVRSKHFYSIFRKMKTRNNNISQIFD
                     TLGIRIICKQQKECYEILEIVHKVWKPIPGRLKDYIAIPKENKYQSLHTTVRIPEDNQ
                     LIEIQIRTEEMDKIAKYGVAAHWLYKEQVELKADDISFINRIKKWQQESVNKNQYSMH
                     DIHKELLNTFIYVYTPEGEIVELPFGSNSIDFAYTIHTDIGDQALYAKINGKISSLTK
                     PLKNEQIVEIFTSPEAKPDVIWLNSVRTKKARSKIRSWLNKNDNTIFVDNNIIAYLIG
                     ENKEQKRLFSLFKSLTKSKIKSITIAPDCNPLTGEDIIGIIQKDTIVVHKEHCREIAH
                     QKKSHLVEVEWEATPTRKVYHIIIFLKNLKGLFNYLDNLFTTFDVRLISEKIEDCGNG
                     HGIINIIISSNAKNVSMIFTSLKENPNVLQIMQVEEDIKNYDN"
     misc_feature    194301..196145
                     /locus_tag="BT0198"
                     /note="(p)ppGpp synthetase, RelA/SpoT family; Region:
                     spoT_relA; TIGR00691"
                     /db_xref="CDD:213552"
     misc_feature    194352..194672
                     /locus_tag="BT0198"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(194367..194369,194439..194444,194640..194642)
                     /locus_tag="BT0198"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    194442..194444
                     /locus_tag="BT0198"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    194880..195221
                     /locus_tag="BT0198"
                     /note="Nucleotidyltransferase (NT) domain of RelA- and
                     SpoT-like ppGpp synthetases and hydrolases; Region:
                     NT_Rel-Spo_like; cd05399"
                     /db_xref="CDD:143389"
     misc_feature    order(194931..194933,194937..194939,195000..195005,
                     195015..195017,195099..195101,195105..195107,
                     195120..195122,195126..195128,195132..195134,
                     195144..195146,195183..195185,195189..195191,
                     195195..195197,195219..195221)
                     /locus_tag="BT0198"
                     /note="synthetase active site [active]"
                     /db_xref="CDD:143389"
     misc_feature    order(194931..194933,195099..195101,195105..195107,
                     195120..195122,195126..195128,195132..195134,
                     195144..195146,195183..195185,195189..195191,
                     195219..195221)
                     /locus_tag="BT0198"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143389"
     misc_feature    order(195000..195002,195183..195185)
                     /locus_tag="BT0198"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143389"
     misc_feature    195381..195560
                     /locus_tag="BT0198"
                     /note="TGS_RelA_SpoT: The RelA (SpoT) protein, also
                     referred to as ppGpp hydrolase/synthetase, is a
                     ribosome-associated protein that is activated during amino
                     acid starvation and thought to mediate the stringent
                     response. RelA contains a TGS domain, named after...;
                     Region: TGS_RelA_SpoT; cd01668"
                     /db_xref="CDD:133438"
     gene            196168..198411
                     /locus_tag="BT0199"
                     /db_xref="GeneID:4642067"
     CDS             196168..198411
                     /locus_tag="BT0199"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="pili chemotaxis protein CheA-like PilL"
                     /protein_id="YP_945205.1"
                     /db_xref="GI:119952996"
                     /db_xref="GeneID:4642067"
                     /translation="MIIKTLLLILIQTLISHKIIKADEIEQCGKQIRKHITKINELNR
                     SLEKIKRIENTYDYIKKYFLENKIQHKEHSLQEIGFIGYSQKTIHVKIKGTEKTNYNI
                     IVPIEAQHDLKNNLAIAIVITLINNFKNKEIKNNLNIYFIEDDSHKQISTISSRLLLN
                     NNALDKNINTIYLMLNEDKENNLIEFKNQSNIINSKTSLGFLENFIKTFENHKVNFNV
                     SKINDKHINGIYNLYLKEEIPILIISNNKECSLLKHVKNNNLCDIYKSIEETVKAKKN
                     NQSENELHYIIINMPFKKWIINENTLIIIIYAICNFIILVFITKFKKTSIILRKTKEN
                     YHKIIKLFFILFLSTYISTLITNKMLTAYENFIDYKIINPIYLVNFFLTLFNFNIISY
                     FTYNFKIHLSLKELKYLAISISIIELIIMLYIKIEFILIIILKNILILIIPNKTKILK
                     KIVIMLIWITNLMLITSIQTTLMTTRPIALSYFISISLFSAILTNIVEHLKHKTETIR
                     QEFTKFEKIESIILFLIIAITIISHDIEKISTIKIDQIISFPEKTNKIRVEYLQDNRN
                     TIQISTKDFNLSLEKNKKYAEKEIQTQENLIDLFFQKIDVAERTIYDIKITTKKITKQ
                     INLFLKNASELIIYQSNTPYKIASNNVIFTINNIKSNTTNITFTVKSQEKIQYDIFAY
                     SDINTNYVKIYDQKTKKEVKNINIDYSYAIKYSGILPKSAKYNQNPFFKLQNDKEIEN
                     LKNLKLN"
     gene            complement(198408..199505)
                     /locus_tag="BT0200"
                     /db_xref="GeneID:4642272"
     CDS             complement(198408..199505)
                     /locus_tag="BT0200"
                     /EC_number="6.3.2.4"
                     /note="D-alanine--D-alanine ligase; DdlA; DdlB;
                     cytoplasmic; catalyzes the formation of D-alanyl-D-alanine
                     from two D-alanines in peptidoglycan synthesis; there are
                     two forms of this enzyme in Escherichia coli"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-alanine synthetase A"
                     /protein_id="YP_945206.1"
                     /db_xref="GI:119952997"
                     /db_xref="GeneID:4642272"
                     /translation="MMKKNLMLIFGGVSFEHEISLRSACGIYSALMKLDKYNVFSSFI
                     DKITGVWYLLDSVPDDPKLIKKDSSAIISLIPGYGIFVNNKDLKIDVVFPIVHGRTGE
                     DGAIQGFLKIMDIPCVGSGILGSAISINKYFCKLLLKSFNIPLVPFIGFKKYDYLLDK
                     EGIKKDIKQSLDYPVIVKPAMLGSSIGISIAYNETQIEKCIEEAFAYDLTVVIEKFMR
                     AREIECAVIGNEQIKIFTPGEIVIQDFVFYDYDAKYSTAPGNSVVFNIPAHLDTKHLL
                     DIKEYAFFTYKCLELRGMARIDFLIEKDTDLVYINEINTIPGFTDISMFSKMCEHDGL
                     DYGSLVDKLIALAFQSYAKRKERIDFHRLEN"
     misc_feature    complement(198411..199502)
                     /locus_tag="BT0200"
                     /note="D-alanyl-alanine synthetase A; Provisional; Region:
                     PRK14570"
                     /db_xref="CDD:173034"
     misc_feature    complement(199146..199496)
                     /locus_tag="BT0200"
                     /note="D-ala D-ala ligase N-terminus; Region:
                     Dala_Dala_lig_N; pfam01820"
                     /db_xref="CDD:250892"
     misc_feature    complement(198474..199097)
                     /locus_tag="BT0200"
                     /note="D-ala D-ala ligase C-terminus; Region:
                     Dala_Dala_lig_C; pfam07478"
                     /db_xref="CDD:254223"
     gene            complement(199507..201027)
                     /locus_tag="BT0201"
                     /db_xref="GeneID:4642271"
     CDS             complement(199507..201027)
                     /locus_tag="BT0201"
                     /EC_number="6.3.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamate--L-
                     ornithine ligase"
                     /protein_id="YP_945207.1"
                     /db_xref="GI:119952998"
                     /db_xref="GeneID:4642271"
                     /translation="MNMNKKMLNNVLSKLDKNFVKEIKGSCEVEILGLTYDSRCVLSH
                     FVFFALPGLHFDGQEFINSAIEQGSNVIVHTNDINFYDPNVTYIKIDSCNIKKFMSNF
                     AHIFYNEPSKNLKIIGVTGTDGKSSVCFYIYTLLKSMGVKVGFISTVFFEDGSGTLVK
                     NPYRQSTPESTEIHLVLSKMVENNVEYAIVESTSHGLDIRTSRLIDIAYFVAVLTNVS
                     HEHLEFHGTMQHYLNAKLNLFSSADANGGFGIINMDDKNFSTFLNTINRAYTYSLENK
                     NADFFVSKINEQMGFTEFEFYHKNVKYDARVNLTGSFNVENVMAALIVVSQVMNVDVS
                     ELIDKLVNIEGLFGRMQGVDFGQDFSLIIDYAHTPGAFLKIFPIFKRLSKNRLISVFG
                     SAGERDVLKRKLQGEIADRYSDIIILCDEDPRGEDSMQIIRDIAEGISGKTLNRDLFF
                     IPDRKSAIEKAINIAHTDDLVVTLGKGHENSIIYKDRSIFWDEQAVVKDIISRNRS"
     misc_feature    complement(199546..200940)
                     /locus_tag="BT0201"
                     /note="UDP-N-acetylmuramyl-tripeptide synthetase; Region:
                     murE; TIGR01085"
                     /db_xref="CDD:233265"
     misc_feature    complement(200707..200940)
                     /locus_tag="BT0201"
                     /note="Mur ligase family, catalytic domain; Region:
                     Mur_ligase; pfam01225"
                     /db_xref="CDD:250458"
     misc_feature    complement(200053..200673)
                     /locus_tag="BT0201"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    complement(199732..199986)
                     /locus_tag="BT0201"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            201169..201241
                     /locus_tag="BTT0002"
                     /db_xref="GeneID:4642270"
     tRNA            201169..201241
                     /locus_tag="BTT0002"
                     /product="tRNA-Cys"
                     /db_xref="GeneID:4642270"
     gene            201335..202576
                     /locus_tag="BT0202"
                     /db_xref="GeneID:4642268"
     CDS             201335..202576
                     /locus_tag="BT0202"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium and cobalt efflux protein CorC"
                     /protein_id="YP_945208.1"
                     /db_xref="GI:119952999"
                     /db_xref="GeneID:4642268"
                     /translation="MLELTIILIFIILSAIFSASETAYTSLSLIQLQDIKKKGKLGTV
                     VYNLAQNPSKLVTTILIGNNIANITASALTTKFVLDKYGNNALALSTGIITIIVLICS
                     EIFPKQIAILNNESIVLSTSILLKILTIIFTPAIYVINGIVKILLSLCKIKASQKMTK
                     DSIKNMLFLAEKLGILENDDRIFMQKMLNIGEVRASEVMTHRTEVFSLSSTSQLKDKI
                     KLIKKEGYSRIPVYKGQNREQIIGILITKDLIEISKKKLEQNIIKFVKPAVFVQQNKR
                     IKDILDIMRQKQKIMAIVIDEYGGFAGILTIEDIVEKIFGAIFDEYDFEEQKQLITKK
                     DENIYLISGETTFDEIEETVGIKIQHKDYINTIGGYIMDLLDKIPTGGEQVSTEHGEY
                     LIEEIQNHKIKKITFTKLDKE"
     misc_feature    201383..202573
                     /locus_tag="BT0202"
                     /note="Hemolysins and related proteins containing CBS
                     domains [General function prediction only]; Region: TlyC;
                     COG1253"
                     /db_xref="CDD:224173"
     misc_feature    201383..201874
                     /locus_tag="BT0202"
                     /note="Domain of unknown function DUF21; Region: DUF21;
                     pfam01595"
                     /db_xref="CDD:250731"
     misc_feature    201941..202270
                     /locus_tag="BT0202"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the CorC_HlyC domain. CorC_HlyC is a transporter
                     associated domain. This small domain is found in Na+/H+
                     antiporters, in proteins involved in...; Region:
                     CBS_pair_CorC_HlyC_assoc; cd04590"
                     /db_xref="CDD:239963"
     misc_feature    202328..202567
                     /locus_tag="BT0202"
                     /note="Transporter associated domain; Region: CorC_HlyC;
                     pfam03471"
                     /db_xref="CDD:251982"
     gene            202602..203534
                     /locus_tag="BT0203"
                     /db_xref="GeneID:4642267"
     CDS             202602..203534
                     /locus_tag="BT0203"
                     /codon_start=1
                     /transl_table=11
                     /product="protease activity modulator HflK"
                     /protein_id="YP_945209.1"
                     /db_xref="GI:119953000"
                     /db_xref="GeneID:4642267"
                     /translation="MLNDILKFFNKTYEYMIILIVLVIILLITIANIFVVGPSDEAIV
                     LRLGKLNRILEPGIHIKIPLIEEKLIVPVKIVQEVKFGFNTNNNTGPNLNEDDGIIIT
                     GDLNIIKVEWLVQYKISDPYSFMFKVEDPAKTITDIAKSSMNRLIGDNTIFEIINDNR
                     VGVTEGVKASMNEIIKTYDLGIDIVQVQIRNAMPPKGKVYEAFEDVNIAIQDKNKFIN
                     EGRKKFNQIIPKIRGEALKLIEEAKGYKENRINTALAETAIFNAILNAYIKDPEITRE
                     RIYNEAMKEILESKDNIEIIDKNLNNFLPFKEVK"
     misc_feature    202698..203531
                     /locus_tag="BT0203"
                     /note="HflK protein; Region: hflK; TIGR01933"
                     /db_xref="CDD:130988"
     misc_feature    202698..203462
                     /locus_tag="BT0203"
                     /note="High frequency of lysogenization K (HflK) family;
                     SPFH (stomatin, prohibitin, flotillin, and HflK/C)
                     superfamily; Region: SPFH_HflK; cd03404"
                     /db_xref="CDD:259802"
     gene            203536..204507
                     /locus_tag="BT0204"
                     /db_xref="GeneID:4642265"
     CDS             203536..204507
                     /locus_tag="BT0204"
                     /codon_start=1
                     /transl_table=11
                     /product="protease activity modulator HflC"
                     /protein_id="YP_945210.1"
                     /db_xref="GI:119953001"
                     /db_xref="GeneID:4642265"
                     /translation="MKYILKFLFSIAKILAFTLIFGLISLAIMQPLYILKENEISITT
                     RLGKIERTENTAGLKYKIPFIENVQIFPKNILRWDGEPQRIPTGGEEKQLIWIDTTAR
                     WKIVDINQFYTAIKTMNRASTIINAAIEPAVRGVIAKYPLLEIIRSSNDPIQRLSDGV
                     LTPQEITDNTTYKITKGRKIIENEIIEVSNKNTKDIGIEIVDVLIRKIGYDPSLIDSV
                     HNRMISERQQIAEEQRSTGIAEQTEILGSIEKEKLKLLSEAKAEAAKIKAEGDHEAAK
                     IYANAYGKNVEFYKFWQALESYKTTLKDKRKIFSTNMDFFRYLHNKK"
     misc_feature    203572..204495
                     /locus_tag="BT0204"
                     /note="HflC protein; Region: hflC; TIGR01932"
                     /db_xref="CDD:233644"
     misc_feature    203626..204462
                     /locus_tag="BT0204"
                     /note="High frequency of lysogenization C (HflC) family;
                     SPFH (stomatin, prohibitin, flotillin, and HflK/C)
                     superfamily; Region: SPFH_HflC; cd03405"
                     /db_xref="CDD:259803"
     gene            204839..204911
                     /locus_tag="BTT0003"
                     /db_xref="GeneID:4642263"
     tRNA            204839..204911
                     /locus_tag="BTT0003"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:4642263"
     gene            205033..206661
                     /locus_tag="BT0205"
                     /db_xref="GeneID:4642261"
     CDS             205033..206661
                     /locus_tag="BT0205"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945211.1"
                     /db_xref="GI:119953002"
                     /db_xref="GeneID:4642261"
                     /translation="MIKHRIKFLTRAFNCIRQQYLKLLRGLSMIFKEIKKVEDLTEKD
                     IIFSNIGNMAKLSTRVNEKIITFLNKGNVLHIPVINNYENIPHDKLINTINEEILNNE
                     INSLKEELIEALKDIYKPFSEKDKMFTISGRKTLINLNTLMEKEPDPIYLKEIIEGSF
                     KILPKHKIISIQKILLKIYDYFDFQKIIDKDNLNNTKTIKKLYLHSIRRDYEFCREQV
                     KTEGDSILIHAIDTTIYFLTTIAQLNKERAAKDAPRSTSKFFIDKSHYTEFTEFFYDN
                     DIILQAALGVLLHPIGLMHITILQKLREKISLKNKDTKEKYMSKIEILEKSINISKNL
                     FRMREDISAITKMIINGQKSYLNIKNRAETATKKFTHELIRIFCIIDTYDEMVNPIII
                     KEPVNPLEAIKFLTENSEQYYWTKDNPEEYLKNKKFDVEMLKNFLKVLAPFDHGTIVD
                     VYIKDCNEPLFKAVVLKYTIGILPIMSIIKHKDKSYKIGDILLNLESREIIIKGQNGE
                     IKTSPFKNTDQFELRHNIEELKSDEFQLLTSMQD"
     gene            complement(206667..207212)
                     /locus_tag="BT0206"
                     /db_xref="GeneID:4642256"
     CDS             complement(206667..207212)
                     /locus_tag="BT0206"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_945212.1"
                     /db_xref="GI:119953003"
                     /db_xref="GeneID:4642256"
                     /translation="MHVSAGKYKGWKVAFPKIGGVRPVMAIVREAFFSIFLNQILGSN
                     FLDVFAGTGIMSLEALSRGANLAHLVDCNKFSKNVLIKNFEVVSEPYKFFFRKAELFL
                     KKSDLFYDFIYLDPPFGYSFKENLLRIISENESLNKDAKIIIHYPSRENLDNNILRLS
                     KYDFRKYGGSKLDFFKVKSYV"
     misc_feature    complement(206775..207083)
                     /locus_tag="BT0206"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(206868..206870,206919..206927,
                     206997..207002,207051..207071))
                     /locus_tag="BT0206"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            207298..208128
                     /locus_tag="BT0207"
                     /db_xref="GeneID:4642254"
     CDS             207298..208128
                     /locus_tag="BT0207"
                     /EC_number="2.7.7.9"
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="YP_945213.1"
                     /db_xref="GI:119953004"
                     /db_xref="GeneID:4642254"
                     /translation="MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFTSS
                     GIKEILIITSRRKGVLDNYFDREIELETVFTKECKKDLLEKIKLKDINISFIRQNEMM
                     GTGHALLHAKPWIGTDNVIVAYPDDLHVGSPSLTTQLIELHKKTGKNILSVIENPKDI
                     NRYGVIKLNKDNIHVKDIVEKPEVGKEPSNKASIGRFLYTHEFFKFLEEGFKIHQKGE
                     YHHIYALKKLMSENKVLYKEIEGERLDIGDIGGYLEAIIKIAKRDDKLLQIIKDSLRN
                     "
     misc_feature    207298..208125
                     /locus_tag="BT0207"
                     /note="UDP-glucose pyrophosphorylase [Cell envelope
                     biogenesis, outer membrane]; Region: GalU; COG1210"
                     /db_xref="CDD:224131"
     misc_feature    order(207313..207315,207319..207321,207451..207453,
                     207667..207669,207673..207675)
                     /locus_tag="BT0207"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            208129..209814
                     /locus_tag="BT0208"
                     /db_xref="GeneID:4642495"
     CDS             208129..209814
                     /locus_tag="BT0208"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945214.1"
                     /db_xref="GI:119953005"
                     /db_xref="GeneID:4642495"
                     /translation="MKIAPKYQEFYNSLSILKKYININIEEKILRYSILSKLYKLNEE
                     EIQNLIKISQDYELKKNKINITLEEYYYEKIQDKKIKNWILEIIREKNSLQIKKETNL
                     ISKRSGITYKLHSTNFLKIIEIQNNSKYTQEKKELYKQLILNFSSNLKIENLEPTIDI
                     LIAVKHRNKEKIKRILKYNQSFQRLFKSSLGKKQSRVIKLKKLLILTYWPVGCLSKSL
                     FNKILTKNYRYIIDEVLTLKYDEILKYLKTIKTFSLNEIFYKGSNKNSNFNYFFSEFM
                     KYTPNDFQNTLKTYLFSLEKTAIKQYLEWFFKDKVPNEWEDFIFAIEYLETHKLLNLS
                     SNIKDIIIAKFKAEEFFVSFEKMNFNPYKSSKIFQNKNIKRIFLQNVINYIKDNSTKI
                     DTYGWIAFYIYADKNDKAKFSKDIKNFFENKNLEIQNQIFVYFLSFYPNIDKKHFEFI
                     SEIMIHLDKDKISIPQEIIKMQEISPYRLNYRKSYIFVKSLILRTRVFKILHKNIKLE
                     LLFKIEEFKTETLLPAICYITCYSKPNALKEEQTMSSEKKEEIMKFVTFLTKE"
     gene            209891..211579
                     /locus_tag="BT0209"
                     /db_xref="GeneID:4642746"
     CDS             209891..211579
                     /locus_tag="BT0209"
                     /codon_start=1
                     /transl_table=11
                     /product="mucin 2 precursor"
                     /protein_id="YP_945215.1"
                     /db_xref="GI:119953006"
                     /db_xref="GeneID:4642746"
                     /translation="MNKCLLLLKNLIVLLILLLNSNLAYSQRLIRIGQEEIKNKNYSQ
                     AIKILSEAIQKYPKVQNGYYFLAIAYRENNQLTEAEGALLDGIAIGGDIDYKLYFELG
                     NIMFKRGEGYYNLAIKYYSNSVKNMPNYDKALLNRANSYVEQGKINFKEKNYKNAWDS
                     YTMAIHDYSQFITLRYESEKKNAILHMIALLRNKKAALEELDKSLKNRSEYIATEHQK
                     DKENTQEHMNKKDNKNTQENMSKKDNKNTQEHMSKKDKENTQEHMNKKDKENTQENMS
                     KKDNTKTQEHMNKKDKENTQEHMSKKDKENTQEHMSKKDNKNTQEHMSKKDKENTQEH
                     MNKKDKENTQEHMSKKDKENTQEHMSKKDNKNTQENMNKKDKENTQENMSKKDNTKTQ
                     EHMNKKDKENTQEHMNKKDKENTQEHMSKKDNTNTQENMSKKDNKNTQEHMNKKDNKN
                     TQEHMSKKDNKNTQEHMNKKDKENTQEHMNKKDNKNTQEHMSKKDNKNTQEHMNKKDK
                     ENTQKHMSKKDNKNTQEHEKKKTMLKDKFEDNLKTDSLIELDKINWQEELNIDE"
     misc_feature    209975..210277
                     /locus_tag="BT0209"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(209978..209983,209990..209995,210080..210085,
                     210089..210094,210101..210106,210185..210190,
                     210197..210202,210209..210214)
                     /locus_tag="BT0209"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(209987..209989,210023..210025,210035..210037,
                     210044..210046,210089..210091,210125..210127,
                     210137..210139,210146..210148,210194..210196,
                     210236..210238,210248..210250,210257..210259)
                     /locus_tag="BT0209"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    209987..210139
                     /locus_tag="BT0209"
                     /note="Tetratricopeptide repeat; Region: TPR_16;
                     pfam13432"
                     /db_xref="CDD:257757"
     misc_feature    210176..210388
                     /locus_tag="BT0209"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     gene            211572..213929
                     /locus_tag="BT0210"
                     /db_xref="GeneID:4642729"
     CDS             211572..213929
                     /locus_tag="BT0210"
                     /codon_start=1
                     /transl_table=11
                     /product="surface-located membrane protein 1"
                     /protein_id="YP_945216.1"
                     /db_xref="GI:119953007"
                     /db_xref="GeneID:4642729"
                     /translation="MNKRKNLPTLIILIILLIASFGGLGYYVYKERLNKNNQAIMLNE
                     VKNSVMDRNYKKAHSITKMLKDKYPQNTDIAMLENTLSELANNSPFESKDLQRDTANQ
                     ILDKIQGKQQSIPINNENSEIAFNNRYIKDTTKIENYADRKDDTGIENEDILEFNQNT
                     IPENLRKNINKIAKQQESTPNNDKSIENKKNLFNLKKLKENLNKELNQTKTTQFNTIK
                     QVIKTHEQNEDKLIKKNTDDSRENKTKQIDKVIEISPSLKPKTKKETPNTKDAHKNQI
                     IEKIERPYSYVIKKVLYEILDNINTGNPSLAKERLNELIKKGLSNKFNKINDLIDKLQ
                     TQEAANLLIRLIKQDIEPNSISIEKAPFKKELLKQKKPKEKNFPTKDQLTNNQIKMQE
                     KPKTHANHLSQTSIDLQSLKMLASINEEQKDFKKAEAIYEKIANITNEAEDHYKVGIM
                     KFKLKKYEESIKAFDKTISLNPKHKKAYTNKGTSLILSHKPKQAIEAFKKAITIDQNY
                     DTAYYKKGIAEEQNNDKQNAFLSFKKAYEITKNPHYALKTGIIANYIGDFKNSEKYLD
                     KASTSIKEKNDIMFYNLAIAKFENDNLNESLISINKALDINPEKSEYLYLKASIYLTK
                     ENYNEAIPLYNSVILKNPENITAHINLARAYEKSGNEPKAIEILEKISNKNHLLALNN
                     LGILYKNQGNYQKAIEIFQKAEAHSSLEAKYNLATALIAIKDNKRAMEKLKEYIKINP
                     NNPEALHALGIIEYNDNGNDKILKEVINKFPNYKQNKTIIKIIGK"
     misc_feature    212886..213086
                     /locus_tag="BT0210"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    212895..213194
                     /locus_tag="BT0210"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(212895..212900,212904..212909,212916..212921,
                     213006..213011,213015..213020,213027..213032,
                     213108..213113,213120..213125,213132..213137)
                     /locus_tag="BT0210"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(212913..212915,212949..212951,212961..212963,
                     212970..212972,213015..213017,213051..213053,
                     213063..213065,213072..213074,213117..213119,
                     213153..213155,213165..213167,213174..213176)
                     /locus_tag="BT0210"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    212997..213185
                     /locus_tag="BT0210"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    213237..213500
                     /locus_tag="BT0210"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(213252..213254,213264..213266,213273..213275,
                     213321..213323,213357..213359,213369..213371,
                     213378..213380,213423..213425,213459..213461,
                     213471..213473,213480..213482)
                     /locus_tag="BT0210"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    213309..213497
                     /locus_tag="BT0210"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    order(213312..213317,213321..213326,213333..213338,
                     213414..213419,213426..213431,213438..213443)
                     /locus_tag="BT0210"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    213411..213680
                     /locus_tag="BT0210"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(213414..213419,213426..213431,213516..213521,
                     213525..213530,213537..213542,213612..213617,
                     213624..213629,213636..213641)
                     /locus_tag="BT0210"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(213423..213425,213459..213461,213471..213473,
                     213480..213482,213525..213527,213561..213563,
                     213573..213575,213582..213584,213621..213623,
                     213657..213659,213669..213671,213678..213680)
                     /locus_tag="BT0210"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    213492..213686
                     /locus_tag="BT0210"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     misc_feature    213606..213878
                     /locus_tag="BT0210"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(213606..213608,213612..213617,213624..213629,
                     213708..213713,213717..213722,213729..213734,
                     213810..213815,213822..213827,213837..213842)
                     /locus_tag="BT0210"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    213618..213800
                     /locus_tag="BT0210"
                     /note="Tetratricopeptide repeat; Region: TPR_16;
                     pfam13432"
                     /db_xref="CDD:257757"
     misc_feature    order(213621..213623,213657..213659,213669..213671,
                     213678..213680,213717..213719,213753..213755,
                     213765..213767,213774..213776,213819..213821,
                     213858..213860,213870..213872)
                     /locus_tag="BT0210"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            213926..215764
                     /locus_tag="BT0211"
                     /db_xref="GeneID:4642730"
     CDS             213926..215764
                     /locus_tag="BT0211"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="YP_945217.1"
                     /db_xref="GI:119953008"
                     /db_xref="GeneID:4642730"
                     /translation="MNKIKFLDRSLVQKIAAGEAIDRPCSILRELLDNSIDSGADKIE
                     VFLEEGGIRRILITDNGSGISKEDLKICYLPHTTSKINEEKDLEKIQTLGFRGEALSS
                     IAICSNLTITSSTTGEDSYQIEVENGTEKYFKKQSAINGTIVDVTNLFHNFPARKRFL
                     KKDSIETKMCLKVFEEKAVTHPGIDFKLSLNNELRKVYFKESLINRVQSVYGEIIENN
                     KFGKIETEYENVQMKIFFAPPNFSRKDRRNIKIFLNRRPVEEHNLSEAIIDGHSRILT
                     NRNFPICYLFLEIDPRYVDFNIHPQKKEVRFFNLPFLPKQVSSNINEFFDRERKEILQ
                     DYHNIIIKRQITNDAHLLHPEDDPTNSDFQTYEIIQNESLILDKPQNNKITNIIEDKV
                     KFESQNPIQKDKPSFKSYIQNILLETSTIANDFQKPIAKHEFKYRGQLFSEFLIVEKD
                     NEVFFIDQHALHEKIIYQTLINSEKITQKLLIPIEFQVDCEDTDKILASELEEYKKLD
                     IIVTKIKEQTYQLESIPNICNKYENVIIQFFKTRKSKTIDSLETDLYATIACRQAVKC
                     NDTISSEFSQFLINEFFNLKLKYCPHGRKIYHKISKFELEKSVNRK"
     misc_feature    213926..215758
                     /locus_tag="BT0211"
                     /note="DNA mismatch repair enzyme (predicted ATPase) [DNA
                     replication, recombination, and repair]; Region: MutL;
                     COG0323"
                     /db_xref="CDD:223400"
     misc_feature    214001..214276
                     /locus_tag="BT0211"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(214013..214015,214025..214027,214034..214036,
                     214094..214096,214100..214102,214106..214108,
                     214112..214117,214214..214225,214256..214258,
                     214262..214264)
                     /locus_tag="BT0211"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    214025..214027
                     /locus_tag="BT0211"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(214106..214108,214112..214114,214214..214216,
                     214220..214222)
                     /locus_tag="BT0211"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    214532..214900
                     /locus_tag="BT0211"
                     /note="MutL_Trans: transducer domain, having a ribosomal
                     S5 domain 2-like fold, conserved in the C-terminal domain
                     of DNA mismatch repair (MutL/MLH1/PMS2) family. This
                     transducer domain is homologous to the second domain of
                     the DNA gyrase B subunit, which is...; Region: MutL_Trans;
                     cd00782"
                     /db_xref="CDD:238405"
     misc_feature    214829..214831
                     /locus_tag="BT0211"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238405"
     misc_feature    215228..215632
                     /locus_tag="BT0211"
                     /note="MutL C terminal dimerization domain; Region:
                     MutL_C; pfam08676"
                     /db_xref="CDD:254967"
     gene            215785..216825
                     /locus_tag="BT0212"
                     /db_xref="GeneID:4642572"
     CDS             215785..216825
                     /locus_tag="BT0212"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945218.1"
                     /db_xref="GI:119953009"
                     /db_xref="GeneID:4642572"
                     /translation="MIKDIKSKIQELSPQRDKKLVELGKALKNSNVIELKKLKSYTSL
                     KLIEKEISQLKASLNKIEDNESKLKELYKKIKDYKESKKHILKAYEKKLKKITEITIN
                     KYPNNLSTILEYKMNFIKSTLEKHKYKTTEIIKLNEKINFFKRLIINIKLMLKDIINK
                     INIEKMSKEFEKKILKEHLFSDNLENLIDEFVENKDLSKAIVEEYRLMNEIQTEIVKI
                     NNEIKHKSIKDNINSKNKIECAINAVQTNRELILKKIAEEFVEMSKTEKGLNKTGTIN
                     SLLETIKNLNQQISKLNADLIKAIKIDEIVKVKSKMQQLIKNKESIEVKLNELNSKIE
                     IIQNEINELDNQ"
     misc_feature    215923..>216822
                     /locus_tag="BT0212"
                     /note="AAA domain; Region: AAA_13; pfam13166"
                     /db_xref="CDD:257537"
     gene            216924..216997
                     /locus_tag="BTT0004"
                     /db_xref="GeneID:4642656"
     tRNA            216924..216997
                     /locus_tag="BTT0004"
                     /product="tRNA-Met"
                     /db_xref="GeneID:4642656"
     gene            complement(217000..217656)
                     /locus_tag="BT0213"
                     /db_xref="GeneID:4642615"
     CDS             complement(217000..217656)
                     /locus_tag="BT0213"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945219.1"
                     /db_xref="GI:119953010"
                     /db_xref="GeneID:4642615"
                     /translation="MLRELKSNILLLFFIFFCSCEMSYPDIREVDYVINYYFAKDKFD
                     YFMTFDFAVKVLNSNDVIKFFVENIDSKEFIEVAKDKYTSSFINSVLGKNVLYCKDLR
                     FNLFDKTFENFMAQVHLIDSGMRVYSREIVINLSLSEEELTLIHYYIYNSKDKLKLNE
                     ISGNNLYLIKTPKDEIDFFYSIVKIEDLMNIQLDDDNLDVYLGFYYVGKHSNLFFRLN
                     "
     gene            complement(217634..218212)
                     /locus_tag="BT0214"
                     /db_xref="GeneID:4642703"
     CDS             complement(217634..218212)
                     /locus_tag="BT0214"
                     /codon_start=1
                     /transl_table=11
                     /product="protein translation elongation factor P (EF-P)"
                     /protein_id="YP_945220.1"
                     /db_xref="GI:119953011"
                     /db_xref="GeneID:4642703"
                     /translation="MGTIKSGDIEKGTFLLFKGMPHIVLEREFSKMGRGGSIVRLKLK
                     NLKNKSVVKETLKGADTVEEIEVLEVASQYLYRENENLIFMDLETYDQFDVNLREISN
                     IEDKVMFLQEAGIYSLVKWDNEVIDLRLPPKVAFEVVDAEIAVKGDTVTNAMKNVTLH
                     TGLVVKAPLFINVGDKILVNSETKEYAERVKE"
     misc_feature    complement(217640..218206)
                     /locus_tag="BT0214"
                     /note="elongation factor P; Validated; Region: PRK00529"
                     /db_xref="CDD:234788"
     misc_feature    complement(218027..218200)
                     /locus_tag="BT0214"
                     /note="Elongation factor P (EF-P) KOW-like domain; Region:
                     EFP_N; pfam08207"
                     /db_xref="CDD:254661"
     misc_feature    complement(217820..217996)
                     /locus_tag="BT0214"
                     /note="S1_like: Ribosomal protein S1-like RNA-binding
                     domain. Found in a wide variety of RNA-associated
                     proteins. Originally identified in S1 ribosomal protein.
                     This superfamily also contains the Cold Shock Domain
                     (CSD), which is a homolog of the S1 domain; Region:
                     S1_like; cl09927"
                     /db_xref="CDD:263921"
     misc_feature    complement(order(217925..217927,217931..217933,
                     217964..217966,217988..217990))
                     /locus_tag="BT0214"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:238094"
     misc_feature    complement(217646..217813)
                     /locus_tag="BT0214"
                     /note="S1_EF-P_repeat_2: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_2;
                     cd05794"
                     /db_xref="CDD:240220"
     misc_feature    complement(order(217655..217660,217673..217675,
                     217724..217726))
                     /locus_tag="BT0214"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240220"
     gene            218279..219184
                     /locus_tag="BT0215"
                     /db_xref="GeneID:4642723"
     CDS             218279..219184
                     /locus_tag="BT0215"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate-binding protein"
                     /protein_id="YP_945221.1"
                     /db_xref="GI:119953012"
                     /db_xref="GeneID:4642723"
                     /translation="MTYLRLMILYIVVKGVNLMQAIKVLFTISIAFLFSNCTNKDKEN
                     VIAIGGSTSTTSIMDEMILRYQKINNQLKVTYDAQGSSVGIKGLFDGIYKMAISSRDA
                     TEEEIAQGAKITIIAYDALIFITSPDVKITNITEEDLVKILNGNIRNWQQVGGHDAKI
                     NFINRDSSSGSHSSIKELVLDKILKNPEEAQFRQDSIMVKSNGEVIEKISLTPHSIGY
                     ISFGYARGAIEKGLHTLSINSIYPTKETITKDKYNIKRRLIAITNSISEDQNILDFIN
                     FMLSPNGQDIVEEQGFIKVHTTENI"
     misc_feature    218402..219157
                     /locus_tag="BT0215"
                     /note="ABC-type phosphate transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: PstS; COG0226"
                     /db_xref="CDD:223304"
     gene            219268..220176
                     /locus_tag="BT0216"
                     /db_xref="GeneID:4642586"
     CDS             219268..220176
                     /locus_tag="BT0216"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system permease protein
                     PstC"
                     /protein_id="YP_945222.1"
                     /db_xref="GI:119953013"
                     /db_xref="GeneID:4642586"
                     /translation="MKLTLKTKRNIVRLAFNCFIFTSAIISTLTILLLVLFIIKNGLA
                     PLLNNKIKIFNFLFSTNWDPTNKLQKSYGILSFIINSALTTFFSVLIALPIGLGFAIY
                     LSEKTKGIYQKTLQTIIELLAGIPSVVYGFFGSTFIATLIKNTFSREDNLGYNLITSV
                     IVLSIMILPTIISVSYTSLKAVPKSYKLASLALAATDWQTIYKVMIPSAGKGILAGVI
                     LAIGRAIGETIAVLMVGGGSPLFIQNIFSPIRTLTVNIAIDMGYASGTHKEALFSTAL
                     VLLLLVIIINSIKHFILSSSKRLKIK"
     misc_feature    219268..220161
                     /locus_tag="BT0216"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstC; COG0573"
                     /db_xref="CDD:223646"
     misc_feature    219499..219984
                     /locus_tag="BT0216"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(219547..219552,219559..219564,219577..219579,
                     219610..219621,219625..219654,219661..219666,
                     219670..219672,219760..219765,219769..219771,
                     219775..219777,219784..219789,219793..219795,
                     219805..219810,219817..219819,219868..219870,
                     219910..219915,219922..219924,219943..219954,
                     219961..219966)
                     /locus_tag="BT0216"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(219628..219672,219943..219960)
                     /locus_tag="BT0216"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(219670..219672,219745..219747,219961..219963)
                     /locus_tag="BT0216"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(219820..219858,219874..219879,219889..219891)
                     /locus_tag="BT0216"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            220173..221714
                     /locus_tag="BT0217"
                     /db_xref="GeneID:4642591"
     CDS             220173..221714
                     /locus_tag="BT0217"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transport system permease protein
                     PstA"
                     /protein_id="YP_945223.1"
                     /db_xref="GI:119953014"
                     /db_xref="GeneID:4642591"
                     /translation="MNTIQTNKLFNKISFCIIRFIAYFLITLLFFLISYIVYNSLFFT
                     SKKQTLFLDETKHFLPFTLKNKIIKIAFIINKSIKAEEITTQDIYNIYNNKISHWGSI
                     SDQSIDIVPIASSQSNLASTVVLQTFTKDNKFNNRYIKLVESNEKIIETVNKTTGAIG
                     YLTKEELEKLDFKKFSEIKSLKIKSMSILVGKKTLQKSENEIINILSLNQIKKLLIEK
                     TNWNNLISKNIKLNIIKYSDYDQNAIKTVEEHEGTIAVVPWHSFYKSDAPFLKLYYMK
                     KDMPLNLNFILSTPRNSGKYGGISYLIFNTFYVILLTAIISISIGIGTGIMLAEYTSN
                     KIFYKTVSMSVDILSSIPAIIFGLFGLIFFVPIFGMGILSGAITSSLMILPMIIKTTE
                     EALKSIPKSYKYASVALGANKTETIIKILLPASSPGILTGIVLAIGRALGETAVLLFT
                     MGTNLGLASSLNEPSRSLTVHLLLLFQEGYLDKGFATASILIIMILLINLTSKFLINK
                     LYRIK"
     misc_feature    <220380..>220658
                     /locus_tag="BT0217"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     misc_feature    221013..221711
                     /locus_tag="BT0217"
                     /note="ABC-type phosphate transport system, permease
                     component [Inorganic ion transport and metabolism];
                     Region: PstA; COG0581"
                     /db_xref="CDD:223654"
     misc_feature    221079..>221519
                     /locus_tag="BT0217"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(221127..221132,221139..221144,221157..221159,
                     221193..221204,221208..221237,221244..221249,
                     221253..221255,221313..221318,221322..221324,
                     221328..221330,221337..221342,221346..221348,
                     221358..221363,221370..221372,221421..221423,
                     221463..221468,221475..221477,221496..221507,
                     221514..221519)
                     /locus_tag="BT0217"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(221211..221255,221496..221513)
                     /locus_tag="BT0217"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(221253..221255,221298..221300,221514..221516)
                     /locus_tag="BT0217"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(221373..221411,221427..221432,221442..221444)
                     /locus_tag="BT0217"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            221715..222479
                     /locus_tag="BT0218"
                     /db_xref="GeneID:4642539"
     CDS             221715..222479
                     /locus_tag="BT0218"
                     /note="ATP-binding protein; PstABCS is an ATP dependent
                     phosphate uptake system which is responsible for inorganic
                     phosphate uptake during phosphate starvation"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter ATP-binding protein"
                     /protein_id="YP_945224.1"
                     /db_xref="GI:119953015"
                     /db_xref="GeneID:4642539"
                     /translation="MSQDKAIIKTENLNLFYTDFKALNNINISILRNSITALIGPSGC
                     GKSTFLRTLNRMNDLVEGVKIEGKVMYEGKSIYSNNFDVLELRRKIGMVFQTPNPFLM
                     SVYDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLC
                     IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDR
                     TAFFLNGYIEEESQTDELFFNPKNIKTEEYITGKFG"
     misc_feature    221715..222476
                     /locus_tag="BT0218"
                     /note="ABC-type phosphate transport system, ATPase
                     component [Inorganic ion transport and metabolism];
                     Region: PstB; COG1117"
                     /db_xref="CDD:224042"
     misc_feature    221736..222422
                     /locus_tag="BT0218"
                     /note="ATP-binding cassette domain of the phosphate
                     transport system; Region: ABC_PstB_phosphate_transporter;
                     cd03260"
                     /db_xref="CDD:213227"
     misc_feature    221832..221855
                     /locus_tag="BT0218"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    order(221841..221846,221850..221858,221997..221999,
                     222237..222242,222333..222335)
                     /locus_tag="BT0218"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213227"
     misc_feature    221988..221999
                     /locus_tag="BT0218"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213227"
     misc_feature    222165..222194
                     /locus_tag="BT0218"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213227"
     misc_feature    222225..222242
                     /locus_tag="BT0218"
                     /note="Walker B; other site"
                     /db_xref="CDD:213227"
     misc_feature    222249..222260
                     /locus_tag="BT0218"
                     /note="D-loop; other site"
                     /db_xref="CDD:213227"
     misc_feature    222321..222341
                     /locus_tag="BT0218"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213227"
     gene            complement(222480..223301)
                     /locus_tag="BT0219"
                     /db_xref="GeneID:4642824"
     CDS             complement(222480..223301)
                     /locus_tag="BT0219"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc uptake transporter"
                     /protein_id="YP_945225.1"
                     /db_xref="GI:119953016"
                     /db_xref="GeneID:4642824"
                     /translation="MFKHLGDYLLTLHPIFLGFLGSTFTWFTTAFGAAAVFCFRKVNN
                     KIMDAMLGFSAGIMIAASFFSLIKPAIEMAEELGYIAWMPAVFGFLLGAFFIYIVDVF
                     VPDLDKLAFIDEDLTRHGKKDFLLFTAVTLHNFPEGLAVGVAFGALASSPDIHTLVGA
                     MILTLGIGIQNMPEGAAISLPLRRGNVPLWKCFNYGQMSGLVEIVGGFLGSYAVYTFT
                     RILPFALSFSAGAMIYVSIEQLIPEAKRKDIDNKIPTIFGVIGFALMMFLDVSLG"
     misc_feature    complement(222483..223277)
                     /locus_tag="BT0219"
                     /note="Predicted divalent heavy-metal cations transporter
                     [Inorganic ion transport and metabolism]; Region: COG0428"
                     /db_xref="CDD:223505"
     gene            complement(223318..225099)
                     /locus_tag="BT0220"
                     /db_xref="GeneID:4642195"
     CDS             complement(223318..225099)
                     /locus_tag="BT0220"
                     /EC_number="6.1.1.7"
                     /note="catalyzes a two-step reaction, first charging an
                     alanine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="YP_945226.1"
                     /db_xref="GI:119953017"
                     /db_xref="GeneID:4642195"
                     /translation="MKLDELRKKYIEFFKSKGHCEIAGKSLIPDNDSTVLFNTAGMQP
                     LVPYLLGEIHPSGDMLVDVQKCLRTGDIDEVGDLSHLTFFEMLGNWSLGAYFKELSVK
                     YSFEFLTSPDYLNISKDRLYVSVFEGDENIPRDTKTASVWESLGIPKDRIFYLSREHN
                     FWGPVGNVGPCGPDTEIFVDTGKEKCSNECDITCSCGKYFEIWNNVFMQYKRDENGNY
                     EELNRKCVDTGMGIERTITFLQGKSSVYDTDAFKPIIDKIEKISGKIYGQNLEDDKSI
                     RIIADHIKASCFILADNFAVLPSNVGQGYVLRRIIRRAIRYAKKLGMESHVLADLVDP
                     VEEIYKSFYKELTENKDFIKAELNTEEKKFFKTLRHGEQEFIKLIQHLSSKLIPGEIA
                     FKLYDTYGFPYEITEELATEYGFSIDKTGFEEHFRKHRKVSKKGGDKVFKGGLADCTY
                     ETTKLHTATHLLHKALQLVLGDHVRQKGSNITAERLRFDFSHPYKMTDDEIKRVEDMV
                     NLQIKNKLSVNRTVMSLDDALAKGAMALFGEKYEEIVSVYEIDGFSIEVCGGPHVKNT
                     SELGIFKIQKEQASSSGVRRIKGILID"
     misc_feature    complement(223321..225099)
                     /locus_tag="BT0220"
                     /note="alanyl-tRNA synthetase; Provisional; Region:
                     PRK01584"
                     /db_xref="CDD:234962"
     misc_feature    complement(224374..225093)
                     /locus_tag="BT0220"
                     /note="Alanyl-tRNA synthetase (AlaRS) class II core
                     catalytic domain. AlaRS is a homodimer. It is responsible
                     for the attachment of alanine to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: AlaRS_core;
                     cd00673"
                     /db_xref="CDD:238360"
     misc_feature    complement(225025..225039)
                     /locus_tag="BT0220"
                     /note="motif 1; other site"
                     /db_xref="CDD:238360"
     misc_feature    complement(order(224398..224400,224407..224412,
                     224422..224427,224482..224484,224494..224499,
                     224830..224838,224842..224844,224848..224850,
                     224896..224898,224950..224952,224956..224958))
                     /locus_tag="BT0220"
                     /note="active site"
                     /db_xref="CDD:238360"
     misc_feature    complement(224893..224901)
                     /locus_tag="BT0220"
                     /note="motif 2; other site"
                     /db_xref="CDD:238360"
     misc_feature    complement(224398..224415)
                     /locus_tag="BT0220"
                     /note="motif 3; other site"
                     /db_xref="CDD:238360"
     misc_feature    complement(223339..223467)
                     /locus_tag="BT0220"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; smart00863"
                     /db_xref="CDD:197931"
     gene            complement(225099..226349)
                     /locus_tag="BT0221"
                     /db_xref="GeneID:4642165"
     CDS             complement(225099..226349)
                     /locus_tag="BT0221"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="YP_945227.1"
                     /db_xref="GI:119953018"
                     /db_xref="GeneID:4642165"
                     /translation="MLVYWFLQILRESMQDPRISKYQDAKNWGVKTFKESEKKELHND
                     LPEIQGSLLKSWVNLIKRGKREDFSNSSSLSKGVGKPGFIRKESKVSKIAKYFLAIGL
                     EKSSKIMAELDDADIIAITREITKIKYITPDDKKRIIQEFEDLVKSERKYLKIDDKFT
                     YELLNKSLSKAKAKEIYIKVTGIDPFLPFDYLSGVEDEQLWALIKDENIQTLLIIYNY
                     LTKEQKKYVFSMLEKDIKKQFVKELAKPRQLNMDMIEIISDRLKSRFAMQGKLKTEKL
                     DGSKILVDILSYMDSEDEKNLLSNIDMKVLNPVKDNEIKERIFDINVILRITDNDMHN
                     ILREFTDNDIAIIIKDKSDEIRDKILFNVSRRRKTLILEEESFLKEVKKRDIKAMTTS
                     FVNYIKELTLKGELMIYRKNEEFI"
     misc_feature    complement(225102..226088)
                     /locus_tag="BT0221"
                     /note="Flagellar motor switch protein [Cell motility and
                     secretion]; Region: FliG; COG1536"
                     /db_xref="CDD:224453"
     misc_feature    complement(225822..226088)
                     /locus_tag="BT0221"
                     /note="MgtE intracellular N domain; Region: MgtE_N;
                     cl15244"
                     /db_xref="CDD:265654"
     misc_feature    complement(225525..225764)
                     /locus_tag="BT0221"
                     /note="FliG middle domain; Region: FliG_M; pfam14841"
                     /db_xref="CDD:258978"
     misc_feature    complement(225123..225443)
                     /locus_tag="BT0221"
                     /note="FliG C-terminal domain; Region: FliG_C; pfam01706"
                     /db_xref="CDD:190075"
     gene            complement(226297..227016)
                     /locus_tag="BT0222"
                     /db_xref="GeneID:4642147"
     CDS             complement(226297..227016)
                     /locus_tag="BT0222"
                     /EC_number="3.1.1.31"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase"
                     /protein_id="YP_945228.1"
                     /db_xref="GI:119953019"
                     /db_xref="GeneID:4642147"
                     /translation="MLQGMVMEFLCSNKESDLKGRFFDFFLKNISRDDFTSIGVCGGR
                     NIISFLNVFDEQNYPIKKSHFFLVDERCVDLNSEYSNFRLLSEGFFSKMMKKNLICGS
                     NFHPFIYSEFDETSSIYNYNVEFNSRFTRLDLSILSVGEDGHVASLFPSRKLLFSEME
                     GYQYEYDAPKFPSKRMSLTPKSLLLSKASVLLFIGHEKKGALENFLSSEISLRECPAK
                     IFKDHARLLVLTNIEGVYAGS"
     misc_feature    complement(226318..227004)
                     /locus_tag="BT0222"
                     /note="6-phosphogluconolactonase/Glucosamine-6-phosphate
                     isomerase/deaminase [Carbohydrate transport and
                     metabolism]; Region: NagB; COG0363"
                     /db_xref="CDD:223440"
     misc_feature    complement(order(226600..226605,226813..226815,
                     226882..226887,226891..226893))
                     /locus_tag="BT0222"
                     /note="active site"
                     /db_xref="CDD:238258"
     gene            complement(227019..227720)
                     /locus_tag="BT0223"
                     /db_xref="GeneID:4642731"
     CDS             complement(227019..227720)
                     /locus_tag="BT0223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945229.1"
                     /db_xref="GI:119953020"
                     /db_xref="GeneID:4642731"
                     /translation="MKIMFAKKLLFLLSSLVFLIASVIMSIGIKNIGIKNGNYITVKG
                     LSEKEVLSTSSSWNLRYELGGNTIDEINKLNNANFLAIRDFFVSYGFHEDEISMKNMD
                     FHIANYSDALYKYNAYISLGIYTKDIDKMEQVSKNIIKLYNKGVLFTGNGGPSYYFDK
                     INDVKPAMLADSIKNALDAALEFSRNSGAVLGKIKTANQGYFEFLPVDRSSENHERYS
                     KKILRVVTTVSYYLD"
     misc_feature    complement(227022..227660)
                     /locus_tag="BT0223"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2859"
                     /db_xref="CDD:225414"
     gene            227792..228799
                     /locus_tag="BT0225"
                     /db_xref="GeneID:4642720"
     CDS             227792..228799
                     /locus_tag="BT0225"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="YP_945230.1"
                     /db_xref="GI:119953021"
                     /db_xref="GeneID:4642720"
                     /translation="MLINRKIAIAPMVAITDEHFRYIIRLLSKKVTLYTPMISAKSII
                     MGKLNTIVKQTPTDSPIAIQIATDCENDAAKAIEILENKFNFDEYNLNVGCPSSRVQD
                     ANYGACLMQTPTQVGKILQAMKKNTNKPVSIKHRIGIRHNKREYHETNYRELKQFVEK
                     IIEYEIKNFTIHARVAILNGYSPKDNQNIPKLRHELVYQLKQDHKNIFIEINGGIISS
                     NHIKTHLSYVDSVMIGRAAAKDPYFIAKISREFLEEKEKIPTREEVLLKMVEYIKEYN
                     EHLSINTILKHIMRIVFAKDNARKFRQILSAPFPKNLKNHEILLSAIEHLREDTLKSN
                     F"
     misc_feature    227807..228544
                     /locus_tag="BT0225"
                     /note="Dihydrouridine synthase-like (DUS-like) FMN-binding
                     domain. Members of this family catalyze the reduction of
                     the 5,6-double bond of a uridine residue on tRNA.
                     Dihydrouridine modification of tRNA is widely observed in
                     prokaryotes and eukaryotes, and also...; Region:
                     DUS_like_FMN; cd02801"
                     /db_xref="CDD:239200"
     misc_feature    order(227819..227827,227900..227902,227981..227983,
                     228065..228067,228191..228193,228305..228307,
                     228425..228427,228431..228433,228491..228496)
                     /locus_tag="BT0225"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239200"
     misc_feature    order(227981..227983,228074..228079,228191..228193,
                     228197..228199,228302..228307,228311..228316,
                     228428..228433,228494..228496)
                     /locus_tag="BT0225"
                     /note="active site"
                     /db_xref="CDD:239200"
     misc_feature    order(228074..228076,228197..228199,228305..228307,
                     228311..228313)
                     /locus_tag="BT0225"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239200"
     misc_feature    order(228077..228079,228191..228193,228302..228304,
                     228314..228316,228428..228433)
                     /locus_tag="BT0225"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239200"
     gene            complement(228789..230066)
                     /locus_tag="BT0226"
                     /db_xref="GeneID:4642690"
     CDS             complement(228789..230066)
                     /locus_tag="BT0226"
                     /EC_number="6.1.1.11"
                     /note="catalyzes a two-step reaction, first charging a
                     serine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="YP_945231.1"
                     /db_xref="GI:119953022"
                     /db_xref="GeneID:4642690"
                     /translation="MMLDLKFIRDNLELIQKNIKDRGLELDIDLLISLDDERKKLVTK
                     IGELNAIRNENANAMKGKIDDSRRHSFIETGKVLKSEIAILEEKLSHITSKLLIEHKR
                     IPNISAPDVPVGEGEDGNIVLKVSGSIPNFDFKPKDHLEIGIDLDLFDFERAREVSGN
                     KFYYLKNEAVFLELALINFALNKLKPKGFDLFITPDIAREFIVDGIGFNPRGTESNIY
                     KIEDTDKYLIGTAEITLGGYYYNTILDLKSPLKMAGLSHCFRKEAGAAGQFSKGLYRV
                     HQFSKVEMFCLCKSEDSDRIHNEFLALEEEIFTELEIPYRVLNVCSFDLGASAYKKYD
                     IEAWMPGRGDKGEYGEVTSTSNCTDYQSRRLKIRYKDDGQSKFVHMINGTALASTRTI
                     IAILENFQDARGGVRIPKNLVKYTGFDYISPKN"
     misc_feature    complement(228795..230063)
                     /locus_tag="BT0226"
                     /note="seryl-tRNA synthetase; Provisional; Region:
                     PRK05431"
                     /db_xref="CDD:235461"
     misc_feature    complement(229749..230063)
                     /locus_tag="BT0226"
                     /note="Seryl-tRNA synthetase N-terminal domain; Region:
                     Seryl_tRNA_N; pfam02403"
                     /db_xref="CDD:251274"
     misc_feature    complement(228819..229709)
                     /locus_tag="BT0226"
                     /note="Seryl-tRNA synthetase (SerRS) class II core
                     catalytic domain. SerRS is responsible for the attachment
                     of serine to the 3' OH group of ribose of the appropriate
                     tRNA. This domain It is primarily responsible for
                     ATP-dependent formation of the enzyme...; Region:
                     SerRS_core; cd00770"
                     /db_xref="CDD:238393"
     misc_feature    complement(order(228819..228824,229233..229235,
                     229296..229298,229341..229343,229353..229355,
                     229365..229367,229392..229394,229404..229406,
                     229410..229415,229470..229472,229476..229484,
                     229488..229499,229533..229535,229542..229544,
                     229548..229550,229554..229556,229566..229586,
                     229593..229610))
                     /locus_tag="BT0226"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238393"
     misc_feature    complement(order(228897..228899,228915..228917,
                     228921..228923,229008..229019,229218..229220,
                     229224..229226,229230..229232,229239..229241,
                     229245..229247,229254..229256,229263..229265,
                     229281..229283,229287..229289,229371..229373,
                     229377..229379,229587..229589))
                     /locus_tag="BT0226"
                     /note="active site"
                     /db_xref="CDD:238393"
     misc_feature    complement(229476..229499)
                     /locus_tag="BT0226"
                     /note="motif 1; other site"
                     /db_xref="CDD:238393"
     misc_feature    complement(229281..229292)
                     /locus_tag="BT0226"
                     /note="motif 2; other site"
                     /db_xref="CDD:238393"
     misc_feature    complement(order(228897..228899,228906..228914))
                     /locus_tag="BT0226"
                     /note="motif 3; other site"
                     /db_xref="CDD:238393"
     gene            230211..230927
                     /locus_tag="BT0227"
                     /db_xref="GeneID:4642666"
     CDS             230211..230927
                     /locus_tag="BT0227"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945232.1"
                     /db_xref="GI:119953023"
                     /db_xref="GeneID:4642666"
                     /translation="MIKVSTAQKLFILTSLLMIFIGCTKKTKKINFNEIDTLYNEKDE
                     IIIQSILAEEENEFFEYKIRIPKVIDARTKNNKIKTFNDEVENYSNEIVNNLESAAQN
                     IKQESKKPSLNIDYEIYHGYGIYTIIVSATQTINDTSITNHRSYYISDNGDYIYNIDE
                     IINVEEAFPYFTQRIKEKIEQTYPNKLLFDLQQAVIYFENKKIIIKFPFYVFNLDDIK
                     DTENIFEFNEEEAQKYIKQG"
     gene            230940..233858
                     /locus_tag="BT0228"
                     /db_xref="GeneID:4642644"
     CDS             230940..233858
                     /locus_tag="BT0228"
                     /codon_start=1
                     /transl_table=11
                     /product="metalloprotease, insulinase family"
                     /protein_id="YP_945233.1"
                     /db_xref="GI:119953024"
                     /db_xref="GeneID:4642644"
                     /translation="MKRKKIFNLISKTYLEEYDTEGCYFKHESGLEIFELKNTTFKEN
                     AFGIAFKTIPLNNTGVAHILEHTIFCGSNKYRIKDPFLYLMKGSLNTFLNAMTFPDKT
                     LYPAASTIQKDYFNLFKIYADAVFNPLLKKEAFMQEGYNINPNNFKLSGIVLNEMKGN
                     YSNKNSLINEIATNSLFSEGTYQYDSGGNPINIIDLTYEEFIEFYRKHYTLENCKIFL
                     FGNIDTNKNLNFIEKYIIRPYTKEKLNINYNIKKTTRWNKGKTLNFDIPKETENTLGV
                     YAINWLCTDIKNIKENIGLEILSEILLDSSCQFTINMLKSNIGDVIADVSGINTDIKE
                     CVFSFGLQNVVPGKMEEFKNMVFNELKNLVKVKISEELIQGILFGYEFALKEEKGQGW
                     PISLMIKSFKGWLHGMHPTETLKINCHLDEIKNKLEKGEPYFENLIEKYLLNNNHYTL
                     IQFNPSDTVLKEMEEKIEKKLMDREIDIKKNPEKFAEFTKDYNQFKDYQKKEDLKSDI
                     TKLPMLKIEDLPKEVEKSLILNETPELKTHTFELKKNNNIFNVHLFFKLNFLQKEDFM
                     HLSLLKRAIQDLSTQNYSYVDLNNKIQNTLGQLNIHESYEEDIQGNMINLFNINFKSF
                     NNKIQESFILIKEILININFHDYDRLKEIVLSLKNDFKSILIPKGHIFATIRSESKLS
                     QSKYLKELQVGLTGREYWQKVKTDIESLRELASNLERLRDKIIFKDNLSSLLIGSTND
                     VIKRLESELFTLRESLSKKTYINNPITIQPSGNILTEIIIIPSKISFNSISFASYKIT
                     DENYPKINFLTHILKSGILWEKIRVMGGAYGAFASITNGIFSFASYRDPNFVKTYQAF
                     ETSLEELANNEIKNEELYTYLVGVIGLSTNVKTKSIEILESHKRKMLNISDQLRQDIR
                     NSYFKITSTDIKNISEQVLNQLKQKNSITSLVNHATYEDEKEKLEAFIGTNYKVKKIY
                     "
     misc_feature    230949..233855
                     /locus_tag="BT0228"
                     /note="Predicted Zn-dependent peptidases, insulinase-like
                     [General function prediction only]; Region: COG1026"
                     /db_xref="CDD:223957"
     misc_feature    231099..>231344
                     /locus_tag="BT0228"
                     /note="Insulinase (Peptidase family M16); Region:
                     Peptidase_M16; pfam00675"
                     /db_xref="CDD:250047"
     misc_feature    231522..232067
                     /locus_tag="BT0228"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     misc_feature    232425..233051
                     /locus_tag="BT0228"
                     /note="Peptidase M16C associated; Region: M16C_assoc;
                     pfam08367"
                     /db_xref="CDD:116948"
     misc_feature    233085..233558
                     /locus_tag="BT0228"
                     /note="Peptidase M16 inactive domain; Region:
                     Peptidase_M16_C; pfam05193"
                     /db_xref="CDD:253075"
     gene            complement(233875..234165)
                     /gene="rpmE2"
                     /locus_tag="BT0229"
                     /db_xref="GeneID:4642596"
     CDS             complement(233875..234165)
                     /gene="rpmE2"
                     /locus_tag="BT0229"
                     /note="RpmE2; there appears to be two types of ribosomal
                     proteins L31 in bacterial genomes; some contain a CxxC
                     motif while others do not; Bacillus subtilis has both
                     types; the proteins in this cluster do not have the CXXC
                     motif; RpmE is found in exponentially growing Bacilli
                     while YtiA was found after exponential growth; expression
                     of ytiA is controlled by a zinc-specific transcriptional
                     repressor; RpmE contains one zinc ion and a CxxC motif is
                     responsible for this binding; forms an RNP particle along
                     with proteins L5, L18, and L25 and 5S rRNA; found
                     crosslinked to L2 and L25 and EF-G; may be near the
                     peptidyltransferase site of the 50S ribosome"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31 type B"
                     /protein_id="YP_945234.1"
                     /db_xref="GI:119953025"
                     /db_xref="GeneID:4642596"
                     /translation="MKFRLNFYQIKRGIMKKDIHPVSNLVIFKDSSNGTMFLTRSTLT
                     SKETIKYSDNKEYPLITVEITSKSHPFYTGQQKFVDAAGRIDKFNKKYKKLK"
     misc_feature    complement(233908..234123)
                     /gene="rpmE2"
                     /locus_tag="BT0229"
                     /note="50S ribosomal protein L31 type B; Reviewed; Region:
                     rpmE2; PRK01678"
                     /db_xref="CDD:234969"
     gene            complement(234181..235725)
                     /gene="rho"
                     /locus_tag="BT0230"
                     /db_xref="GeneID:4642484"
     CDS             complement(234181..235725)
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="An RNA-DNA helicase that actively releases nascent
                     mRNAs from paused transcription complexes"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="YP_945235.1"
                     /db_xref="GI:119953026"
                     /db_xref="GeneID:4642484"
                     /translation="MDKKCAEFDLEDEMKRLNSSKELKIEDNSKKKIVKVVTKKESVA
                     SGLKNSNIDKLRESNGVSSGFDYDISDPDLENSIKTLEQSNIINFLGGKDFIVIDSLY
                     DKPITEIRKVVEGLGTNHTIAVTMKKTELIFLLVKILTEHNINVLFTGVLDVLSDGYG
                     FLRTASNSYLSGGNDVYVSPSQIRLFNLRTGDILYGQIRSPRDGERFFAMIKIKSIND
                     QDPTFAQNRIPFDNLTPLYPSSKLDLEYENCNISTRLINLFSPIGKGQRALIVSPPKA
                     GKTTLLQKIANAITTNYPDIVLMILLIDERPEEVTDMIRGVKGEVIASNFDEQASRHV
                     QVAEMVIEKAKRLVENKKDVVILLDSITRLARAYNQTMPTSGKILSGGVDSNALHKPK
                     RFFGSARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKSTGNMELILDRSLADRRLFP
                     AINIKKSGTRKEELLLSEEERSKILLIRKILGGVDDYEGVEALVEKMKKSKNNEIFLK
                     TMSNGD"
     misc_feature    complement(234190..235434)
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="transcription termination factor Rho; Region: rho;
                     TIGR00767"
                     /db_xref="CDD:162030"
     misc_feature    complement(235081..235284)
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="Rho_CSD: Rho protein cold-shock domain (CSD). Rho
                     protein is a transcription termination factor in most
                     bacteria. In bacteria, there are two distinct mechanisms
                     for mRNA transcription termination. In intrinsic
                     termination, RNA polymerase and nascent mRNA...; Region:
                     Rho_CSD; cd04459"
                     /db_xref="CDD:239906"
     misc_feature    complement(order(235105..235113,235120..235122,
                     235195..235197,235201..235203,235237..235239,
                     235243..235245,235249..235251,235261..235263,
                     235267..235269))
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239906"
     misc_feature    complement(234232..234978)
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="Transcription termination factor rho is a bacterial
                     ATP-dependent RNA/DNA helicase. It is a homohexamer. Each
                     monomer consists of an N-terminal domain of the OB fold,
                     which is responsible for binding to cysteine rich
                     nucleotides. This alignment is of the...; Region:
                     rho_factor; cd01128"
                     /db_xref="CDD:238548"
     misc_feature    complement(order(234289..234291,234301..234303,
                     234343..234348,234418..234420,234424..234438,
                     234442..234447,234520..234522,234529..234531,
                     234538..234540,234547..234552,234559..234561,
                     234592..234594,234925..234927))
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="multimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238548"
     misc_feature    complement(234889..234912)
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238548"
     misc_feature    complement(order(234379..234381,234886..234897,
                     234901..234903))
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238548"
     misc_feature    complement(234649..234663)
                     /gene="rho"
                     /locus_tag="BT0230"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238548"
     gene            complement(235814..236221)
                     /locus_tag="BT0231"
                     /db_xref="GeneID:4642536"
     CDS             complement(235814..236221)
                     /locus_tag="BT0231"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical cytosolic protein"
                     /protein_id="YP_945236.1"
                     /db_xref="GI:119953027"
                     /db_xref="GeneID:4642536"
                     /translation="MPVNIKDSYKWDCKLDSSLIFRGKLKFEGALYLDSSFEGEIFSK
                     SGILFIGKNSKVITDVVICDTLIIEGILKGNINASNKVYLNSGCKIYGDVKTKKIFIN
                     DNIVFDGKCEMIKSNESIDLFSFTVSQLKDTFQ"
     misc_feature    complement(235841..236221)
                     /locus_tag="BT0231"
                     /note="Integral membrane protein CcmA involved in cell
                     shape determination [Cell envelope biogenesis, outer
                     membrane]; Region: CcmA; COG1664"
                     /db_xref="CDD:224578"
     gene            complement(236225..236551)
                     /locus_tag="BT0232"
                     /db_xref="GeneID:4642534"
     CDS             complement(236225..236551)
                     /locus_tag="BT0232"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein HbbU"
                     /protein_id="YP_945237.1"
                     /db_xref="GI:119953028"
                     /db_xref="GeneID:4642534"
                     /translation="MSFSRRPKVTKSDIVNQISLNIKNSNEKLEKKYIRLVVDAFFEE
                     LKNSLCLNNVIEFRSFGTFELRKRKGRQNARNPQTGEYVNVDDHHVAYFRPGKDLKER
                     VWGIKG"
     misc_feature    complement(236246..236527)
                     /locus_tag="BT0232"
                     /note="Beta subunit of integration host factor (IHFB);
                     Region: IHF_B; cd13836"
                     /db_xref="CDD:259858"
     misc_feature    complement(order(236255..236257,236267..236269,
                     236273..236275,236279..236281,236285..236290,
                     236372..236374,236378..236395,236405..236434,
                     236438..236446,236453..236455,236465..236467,
                     236477..236479,236498..236503,236510..236512,
                     236519..236521))
                     /locus_tag="BT0232"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259858"
     misc_feature    complement(order(236261..236266,236270..236272,
                     236276..236278,236345..236350,236354..236356,
                     236372..236374,236378..236386,236516..236521))
                     /locus_tag="BT0232"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259858"
     gene            complement(236563..236820)
                     /gene="rpsT"
                     /locus_tag="BT0233"
                     /db_xref="GeneID:4642258"
     CDS             complement(236563..236820)
                     /gene="rpsT"
                     /locus_tag="BT0233"
                     /note="binds directly to the 16S rRNA and is involved in
                     post-translational inhibition of arginine and ornithine
                     decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="YP_945238.1"
                     /db_xref="GI:119953029"
                     /db_xref="GeneID:4642258"
                     /translation="MGNNPSALKRARQNLKRNLRNVSVKSELKTIEKRCMNLIREGKK
                     EEALEFFKFVSKKLDTAARKRIIHRNKAARKKSNLSILLLR"
     misc_feature    complement(236572..236820)
                     /gene="rpsT"
                     /locus_tag="BT0233"
                     /note="30S ribosomal protein S20; Reviewed; Region: rpsT;
                     PRK00239"
                     /db_xref="CDD:178943"
     gene            complement(236894..237715)
                     /locus_tag="BT0234"
                     /db_xref="GeneID:4642351"
     CDS             complement(236894..237715)
                     /locus_tag="BT0234"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane associated protein"
                     /protein_id="YP_945239.1"
                     /db_xref="GI:119953030"
                     /db_xref="GeneID:4642351"
                     /translation="MNEFFFYKIRLIFIFLLNLSFSVFYMLLYKNIFGIFVLFLILIN
                     LFLIIFYLRYFYELDCKGDKIFYKKFYPKVNFTFNDILWFEKRLSGSILILGLNNKRK
                     IKICFLRKKYLSNFFRKLKIMRSDLFIAKNEELPIRYYISGLYLLMFLCRILINMSVC
                     YIAFGSIIVFFFIFLIGIKVLIDDILVIKDLVIFYEFRKDSVYEKKIFSHKEYFYKFF
                     NSIFVHVSELSRDGYLSFVYNHRGTLKKVYINNEGMSYSMQKVFAYIDKYCRQCV"
     gene            complement(237733..238839)
                     /locus_tag="BT0235"
                     /db_xref="GeneID:4642103"
     CDS             complement(237733..238839)
                     /locus_tag="BT0235"
                     /note="probable translation factor; translation-associated
                     GTPase; the crystal structure of the Haemophilus
                     influenzae YchF protein showed similarity to the yeast
                     structure (PDB: 1NI3); fluorescence spectroscopy revealed
                     nucleic acid binding; the yeast protein YBR025c interacts
                     with the translation elongation factor eEF1"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-dependent nucleic acid-binding protein EngD"
                     /protein_id="YP_945240.1"
                     /db_xref="GI:119953031"
                     /db_xref="GeneID:4642103"
                     /translation="MALNVGIVGLPNVGKSTLFSSLTASKSEIANYPFCTIDPNIGIV
                     EIPDERLSRIASLVVSKKTVPAVIEFVDIAGLVKGASRGEGLGNKFLANIREVSIIVH
                     VVRCFEDREVIHVDGDVNPQRDISTINTELCLADLDTVQKSILKNEKNVKSVDKKISE
                     NAKKIVSMLKSLEKHLMDVRPVIEFEFDEFGYDFIKSLNLLTIKKVIYVCNVDENSLC
                     GNKYTDTVKNIALGEGNDYLILCAKVEAELIEIKDLRERREMLESMGINDSGLSNLIR
                     TTYYALGLRTYFTAGEQEVKAWTFMDGMKAPEAAGIIHSDFQRGFIKAEVYSFNDLIE
                     YQSVQGVKEKGRFRLEGKDYLVRDGDIIFFKFNV"
     misc_feature    complement(237736..238839)
                     /locus_tag="BT0235"
                     /note="GTP-binding protein YchF; Reviewed; Region:
                     PRK09601"
                     /db_xref="CDD:236583"
     misc_feature    complement(237994..238827)
                     /locus_tag="BT0235"
                     /note="YchF GTPase; Region: YchF; cd01900"
                     /db_xref="CDD:206687"
     misc_feature    complement(238792..238815)
                     /locus_tag="BT0235"
                     /note="G1 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(238111..238119,238198..238200,
                     238204..238209,238789..238800,238804..238806))
                     /locus_tag="BT0235"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206687"
     misc_feature    complement(238723..238746)
                     /locus_tag="BT0235"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(238732..238734)
                     /locus_tag="BT0235"
                     /note="G2 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(order(238552..238581,238600..238629))
                     /locus_tag="BT0235"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(238615..238626)
                     /locus_tag="BT0235"
                     /note="G3 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(238198..238209)
                     /locus_tag="BT0235"
                     /note="G4 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(238111..238119)
                     /locus_tag="BT0235"
                     /note="G5 box; other site"
                     /db_xref="CDD:206687"
     misc_feature    complement(237742..237990)
                     /locus_tag="BT0235"
                     /note="TGS_YchF_C: This subfamily represents TGS
                     domain-containing YchF GTP-binding protein, a universally
                     conserved GTPase whose function is unknown. The N-terminal
                     domain of the YchF protein belongs to the Obg-like family
                     of GTPases, and some members of the...; Region:
                     TGS_YchF_C; cd04867"
                     /db_xref="CDD:133440"
     gene            complement(238865..240928)
                     /locus_tag="BT0236"
                     /db_xref="GeneID:4642366"
     CDS             complement(238865..240928)
                     /locus_tag="BT0236"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat family protein"
                     /protein_id="YP_945241.1"
                     /db_xref="GI:119953032"
                     /db_xref="GeneID:4642366"
                     /translation="MFCITISNLYSICLSIKRMILIFNLFVLFFLSTFVLNSQGIVTN
                     KDAQEEFKLALNSYNNGLYDDALLSFKRVLSFDPSNLDYRFWIGNVYYRLGYVEEALR
                     EWRNLQSQGYKAAYLRQLISIIEQRRGISLSNELDVERFIQVAFLNNSIYRRPNGYQI
                     TSLKADQYGGYYAVNFVGNEILHFDANNNVSVLIKDGITSLKSPYDVIELGDLLYVTL
                     CSNDEIGIYDKTFGIKRGSIGKKGTDPGELLAPQYMTVDERGYIYVSEWGNKRVSKFD
                     AKGNFILHFGVKTVGYMGLLGPTGVTYLNGNIYVADTSKNSIEVFDTSGNHLYSIATS
                     LEGIEGLSSDFTGNNIIISSKYGVYKYSVLRKTFVKLLKADKIDSKISSSIIDVNNQV
                     IVSDFDNAQISVYKSDVSVYDSLNVDVRRVIRVGGPKIYVELNVSNRNGLPVIGLKSE
                     NFAIANEEYYIVNPKIAYDINTSNDMNIAIVFDKSFAMKNYESEQIMGVNTLIKSRAN
                     KKFSFINATSVPLVDNIESLLSTIHKTNSLGAYDSNYVKTDVSLKLAGSELMSKSARR
                     AVLYFSNGNLSRSAFNRYSIDTILSYYKNNDIRFYLILFGNNPVDSKLQYLVNETGGA
                     IIPFSSYEGVSRVYDLMMKQKTGTYLLEYDYPGLQEPDGYYNLSVEVNFNQQIGRGEF
                     AYLVN"
     misc_feature    complement(240626..>240778)
                     /locus_tag="BT0236"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(240647..240652,240659..240664,
                     240671..240676,240752..240757,240764..240769,
                     240773..240778))
                     /locus_tag="BT0236"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(240629..240631,240665..240667,
                     240710..240712,240719..240721,240731..240733,
                     240767..240769))
                     /locus_tag="BT0236"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(240563..240751)
                     /locus_tag="BT0236"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     misc_feature    complement(238907..240178)
                     /locus_tag="BT0236"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3391"
                     /db_xref="CDD:225926"
     misc_feature    complement(238913..239665)
                     /locus_tag="BT0236"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cl00057"
                     /db_xref="CDD:260163"
     gene            241028..242581
                     /gene="lnt"
                     /locus_tag="BT0237"
                     /db_xref="GeneID:4642347"
     CDS             241028..242581
                     /gene="lnt"
                     /locus_tag="BT0237"
                     /EC_number="2.3.1.-"
                     /note="Transfers the fatty acyl group on membrane
                     lipoproteins"
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="YP_945242.1"
                     /db_xref="GI:119953033"
                     /db_xref="GeneID:4642347"
                     /translation="MKTRYFLLATFSGMLTTLAIPNEIKNMGYSSIGLVAYIPLFIAL
                     IKVKDKKTLIGLTIFYFLVANSLQNFWLAFFHSFGLITFLGAVSGYIPYAFVLGYFLY
                     YALKTFKNKTLTLAILFTFYDYSKSIGFAAYPWGFSAFMVNNFNDLIQVADIFGVFFV
                     CFIVYFFNAGIANFLIRQNKINTLNVLFSVLLVSTSFAYGIMKKIELNPILNKEIDTL
                     NIAAIQLNIDPWLPGNHKKGIQTSIKLTKQALRKHPDTELVLWSEGALALPFNSYKDY
                     IYYDEELIELYDSVNELISNSKAHFVIGSPSKPDKRSLTHQNSVYAIKPNLKIENIYS
                     KIFLVPFSEKIPFYEYKFVRKFFRQNFNITGQINGNKLEIFKLKKFNLGLLICYDDAF
                     PDLARNYKKQNANLLLNFSNDSWSHTDSSEWQHFVVAKFRSIENGIKTVRATNSGITA
                     IINEYGENVKSLATFKKGYLISRIKLPPRFTTIYEHIGDLFIYVLAIVIVIMTLRFYF
                     IEKSTHLSS"
     misc_feature    241043..242566
                     /gene="lnt"
                     /locus_tag="BT0237"
                     /note="apolipoprotein N-acyltransferase; Reviewed; Region:
                     lnt; PRK00302"
                     /db_xref="CDD:234721"
     misc_feature    241679..242521
                     /gene="lnt"
                     /locus_tag="BT0237"
                     /note="Apolipoprotein N-acyl transferase (class 9
                     nitrilases); Region: ALP_N-acyl_transferase; cd07571"
                     /db_xref="CDD:143595"
     misc_feature    order(241814..241816,242030..242032,242042..242044,
                     242054..242056,242186..242191,242195..242200,
                     242261..242263)
                     /gene="lnt"
                     /locus_tag="BT0237"
                     /note="putative active site [active]"
                     /db_xref="CDD:143595"
     misc_feature    order(241814..241816,242030..242032,242186..242188)
                     /gene="lnt"
                     /locus_tag="BT0237"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143595"
     misc_feature    order(242033..242044,242051..242053,242078..242086,
                     242189..242191,242195..242209,242216..242221,
                     242306..242311,242315..242323,242327..242332,
                     242366..242371,242498..242512)
                     /gene="lnt"
                     /locus_tag="BT0237"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143595"
     gene            complement(242545..243321)
                     /locus_tag="BT0238"
                     /db_xref="GeneID:4642403"
     CDS             complement(242545..243321)
                     /locus_tag="BT0238"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945243.1"
                     /db_xref="GI:119953034"
                     /db_xref="GeneID:4642403"
                     /translation="MEVSMKKLVLLFFSFAFISLFAKNGSVVDEQQKELAIFYYEVGQ
                     RYIDVGKVRKGKIFQKKALEIYPRLKEEVNLKVAVEEIDSKIKLEGETNFLAFDDVKL
                     DDIPGIIHSKIEISEITNAPKIEYIANREREKYKEQAVKFQFSKFVRALLLQDLNLLD
                     SVVADEVKVLGRIEPKTDFISSLELVSNDISKDDVSYLAVDDFYDLKSLNIIKNTDVS
                     YSVRVKAKKNDVTKNIPFWRDVQTLCFENQDDKWVLFSIK"
     gene            complement(243379..243996)
                     /locus_tag="BT0239"
                     /db_xref="GeneID:4642374"
     CDS             complement(243379..243996)
                     /locus_tag="BT0239"
                     /EC_number="2.7.1.113"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosine kinase"
                     /protein_id="YP_945244.1"
                     /db_xref="GI:119953035"
                     /db_xref="GeneID:4642374"
                     /translation="MEAGLVIVIEGLIGVGKTTLGHVLSKEFNIPFYSELNNEFTLSM
                     LDKFYKDKSRWAFLVQINFLNERFKLIKSIFKTKGGILDRSIYGDRVFASLLNDSGYI
                     SNDEYKIYLDLLDNMLEHSQKPVLMIYLDCSVDEAERRIKNRNRSFETGIPREYLEGL
                     NEKYLSWYDSYDLSPKLSFDYNSINIFDDKHKSKLIAFIKDKLVI"
     misc_feature    complement(243385..243996)
                     /locus_tag="BT0239"
                     /note="Deoxynucleoside kinases [Nucleotide transport and
                     metabolism]; Region: COG1428"
                     /db_xref="CDD:224345"
     misc_feature    complement(243427..243981)
                     /locus_tag="BT0239"
                     /note="Deoxyribonucleoside kinase (dNK) catalyzes the
                     phosphorylation of deoxyribonucleosides to yield
                     corresponding monophosphates (dNMPs). This family consists
                     of various deoxynucleoside kinases including deoxyribo-
                     cytidine (EC 2.7.1.74), guanosine (EC 2.7.1; Region: dNK;
                     cd01673"
                     /db_xref="CDD:238836"
     misc_feature    complement(order(243550..243552,243565..243567,
                     243718..243720,243817..243822,243850..243852,
                     243943..243948,243952..243954))
                     /locus_tag="BT0239"
                     /note="Substrate-binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     misc_feature    complement(243796..243798)
                     /locus_tag="BT0239"
                     /note="Substrate specificity [chemical binding]; other
                     site"
                     /db_xref="CDD:238836"
     gene            244234..244650
                     /locus_tag="BT0239A"
                     /db_xref="GeneID:4642255"
     CDS             244234..244650
                     /locus_tag="BT0239A"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945245.1"
                     /db_xref="GI:119953036"
                     /db_xref="GeneID:4642255"
                     /translation="MNSKYNLNSQITLFKAIIKKSIKERCKKFFISKRFTNKIKELIK
                     SFNLYSTNHIILNDQKGNGHNWHKFITHNLIPLITKNLLMNKNLCYKNKYKEHINGLI
                     SSFTNSKIMNIEISNEKRAISQHKKTSLKFSYLAII"
     gene            244795..245556
                     /locus_tag="BT0240"
                     /db_xref="GeneID:4642480"
     CDS             244795..245556
                     /locus_tag="BT0240"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator protein"
                     /protein_id="YP_945246.1"
                     /db_xref="GI:119953037"
                     /db_xref="GeneID:4642480"
                     /translation="MIYIRFKEFIAEFLGTFILLALGTGSVAMTTLFPSNPSVTGEII
                     KGGYTNIVLGWGLGVTFGVYTAARISGAHLNPAISIGLATIGRFPTAKLFHYISAQIL
                     GAFSGALMTLIVFYPKWIEIDPAFENTQGIMSTFPAVPGFWPGFIDQIFGTFLLMFLV
                     LVVGKFIKGDTQNPFFPFIIGSIVLAIGISFGGMNGYAINPARDLGPRILLLLAGFKN
                     HGFDEMNVFIIPILGPIIGTILGAIVYEFTLEDKE"
     misc_feature    244810..245463
                     /locus_tag="BT0240"
                     /note="Glycerol uptake facilitator and related permeases
                     (Major Intrinsic Protein Family) [Carbohydrate transport
                     and metabolism]; Region: GlpF; COG0580"
                     /db_xref="CDD:223653"
     misc_feature    order(244957..244959,245011..245019,245380..245385,
                     245392..245394,245401..245403)
                     /locus_tag="BT0240"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    order(245017..245025,245392..245400)
                     /locus_tag="BT0240"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            245612..247111
                     /locus_tag="BT0241"
                     /db_xref="GeneID:4642441"
     CDS             245612..247111
                     /locus_tag="BT0241"
                     /EC_number="2.7.1.30"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="YP_945247.1"
                     /db_xref="GI:119953038"
                     /db_xref="GeneID:4642441"
                     /translation="MNMKYILSIDQGTTSSRAIIFDKKANIKGFAQKEFKQIYPYPSW
                     VEHNPNEIWSSILGVMAEALANARTFPNEIEAIGITNQRETTIIWDRQTGHPIYNAIV
                     WQDRRTAQLCDELKARGQDKNFLKKTGLVLDAYFSGTKIKWILDNVAGARKRAEKGEL
                     CFGTIDTWIVWNLTKGKIHITDYSNASRTLLLNIKSLEWDEELLQILNIPKSILPELK
                     QSSEVYGKTDSSILGTEITISGIAGDQFAATFGQACLQKGMAKNTYGTGCFVTVNIGK
                     NPIINEQQTLLTSIAWGRKNSITYVLEGSVFIGGAVIQWLKDNLELFRKNSDAEALAA
                     SVNNNGGVYFVPAFVGLGTPHWDSYARGTIIGLTRSSTKEHITRAALESIALQSFDVL
                     TEMQNSIQGFAIKELRVDGKASQNNLLMQFQADILQCNVVRPKITETTALGSAYLAGL
                     AVGYWESTEEITSLWKSDKIFEPSMENSKREDLIYNWHKAIKRAKDWIQ"
     misc_feature    245612..247102
                     /locus_tag="BT0241"
                     /note="glycerol kinase; Provisional; Region: glpK;
                     PRK00047"
                     /db_xref="CDD:234594"
     misc_feature    245624..247087
                     /locus_tag="BT0241"
                     /note="Escherichia coli glycerol kinase-like proteins;
                     belongs to the FGGY family of carbohydrate kinases;
                     Region: FGGY_EcGK_like; cd07786"
                     /db_xref="CDD:198361"
     misc_feature    order(245624..245629,245633..245635,245639..245641,
                     245648..245653,245660..245662,245666..245668,
                     245672..245677,245684..245686,245690..245692,
                     245738..245740,245834..245860,245918..245923,
                     245927..245929,245936..245938,245948..245950,
                     245984..245986,245993..246004,246008..246010,
                     246014..246019,246158..246163,246170..246175,
                     246191..246196,246200..246202,246266..246277,
                     246326..246331,246347..246352,246407..246409,
                     246416..246418,246443..246445,246449..246451,
                     246470..246490,246503..246505,246509..246511,
                     246518..246520,246524..246526,246530..246535,
                     246551..246553,246656..246658,246677..246679,
                     246683..246688,246692..246694,246923..246925,
                     246929..246937,246941..246946,246950..246967,
                     246971..246976)
                     /locus_tag="BT0241"
                     /note="N- and C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(245639..245641,245645..245653,245660..245662,
                     245855..245863,245918..245920,246014..246016,
                     246341..246346,246401..246409,246416..246418,
                     246539..246544,246548..246553,246587..246592,
                     246596..246598,246842..246850,246857..246859)
                     /locus_tag="BT0241"
                     /note="active site"
                     /db_xref="CDD:198361"
     misc_feature    order(245639..245641,245645..245653,245660..245662,
                     246401..246409,246539..246544,246548..246553,
                     246587..246592,246596..246598,246842..246850,
                     246857..246859)
                     /locus_tag="BT0241"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(245639..245641,245648..245650,246341..246343)
                     /locus_tag="BT0241"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198361"
     misc_feature    order(245639..245641,246341..246343)
                     /locus_tag="BT0241"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(245648..245650,245855..245863,245918..245920,
                     246014..246016,246341..246346,246416..246418)
                     /locus_tag="BT0241"
                     /note="glycerol binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(245708..245710,245759..245761,245768..245773,
                     245783..245785,245792..245797,245894..245896,
                     246125..246127,246134..246136,246293..246298)
                     /locus_tag="BT0241"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(245726..245728,245735..245737,245744..245746,
                     245921..245923,246533..246535,246542..246544,
                     246551..246556,246563..246565,246632..246634,
                     246638..246640,246653..246655,246692..246718,
                     246728..246730,246737..246739)
                     /locus_tag="BT0241"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:198361"
     misc_feature    order(246305..246310,246314..246316)
                     /locus_tag="BT0241"
                     /note="FBP binding site [chemical binding]; other site"
                     /db_xref="CDD:198361"
     misc_feature    order(246818..246820,246824..246826,247028..247030,
                     247034..247036,247040..247051,247055..247057)
                     /locus_tag="BT0241"
                     /note="protein IIAGlc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198361"
     gene            247216..248580
                     /locus_tag="BT0241A"
                     /db_xref="GeneID:4642467"
     CDS             247216..248580
                     /locus_tag="BT0241A"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate transporter"
                     /protein_id="YP_945248.1"
                     /db_xref="GI:119953039"
                     /db_xref="GeneID:4642467"
                     /translation="MKKLFDFLKPAPHIKRVHKEIEDSLYKKLRLQIFISIFIGYAGF
                     YLTRKIFSFAIPELEKEGFNKGQLGIALSGVSIAYGFSKFIMGNISDRSNPRYFLALG
                     LLLTAIITLLFGLFSWQLLDPTTAIMLMFILMFANGWVQGMGWPACGRTMVHWWAKKE
                     RGITVATWNLAHNIGGGAAGIISAWALIHFKEWQAIFYVPAILVLGIAIFILITLRDT
                     PQSVGLPPIEEYKNDYPDDYTEEAEKELNAKDIFIKYVLNNKLLWYIATANAFIYFVR
                     YGVLDWAPSYLSQVKNFSIKNSGWAYSLYEFSAIPGTIICGWISDKIFKGRRSETGII
                     FMTAALITIIIYWQLPENNPTLTTILLAIIGFLIYGPVMLIGLHALDLAPKKAAGTAA
                     GFTGLFGYIGGSVTASAITGLVLQHFNWNVYFYLLITACIFSILFISLTLKQEKKINN
                     TNKQ"
     misc_feature    247225..248556
                     /locus_tag="BT0241A"
                     /note="sn-glycerol-3-phosphate transporter; Provisional;
                     Region: glpT; PRK11273"
                     /db_xref="CDD:236889"
     misc_feature    247315..248529
                     /locus_tag="BT0241A"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(247357..247359,247366..247374,247378..247383,
                     247429..247431,247438..247443,247450..247452,
                     247462..247467,247471..247476,247636..247641,
                     247648..247653,247660..247665,247672..247674,
                     247708..247713,247720..247725,247741..247743,
                     248032..248034,248041..248046,248053..248058,
                     248065..248067,248107..248109,248119..248121,
                     248131..248133,248140..248142,248152..248154,
                     248308..248310,248317..248322,248329..248331,
                     248341..248346,248353..248355,248386..248391,
                     248398..248403,248410..248415,248422..248424)
                     /locus_tag="BT0241A"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            248654..249670
                     /locus_tag="BT0241B"
                     /db_xref="GeneID:4642844"
     CDS             248654..249670
                     /locus_tag="BT0241B"
                     /EC_number="3.1.4.46"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="YP_945249.1"
                     /db_xref="GI:119953040"
                     /db_xref="GeneID:4642844"
                     /translation="MKLIKTKLLMLTMNIFLIIACQNEKMSMTNKKPPLIIAHRGASG
                     YLPEHTLEAKAFAYALGADYLEQDIVLTKDNVPIIMHDPELDTTTNVAKLFPERAREN
                     GRYYSVDFTLDELKSLSLSERFDLETRKPIYPNRFPLNEYNFKIPTLEEEIQFIQGLN
                     KSTGRNVGIYPEIKKPLWHKQQGKDISKIVIEILNKYGYKSKEDKIYLQTFDFDELKR
                     IREELGYQGKLIMLVGENDWDEAPTDYEYIKSQEGMTEVAKYADGIGPWIPQIIIDGK
                     ITDLTSLAHKYNMEVHAYTFRIDSLPSYVKDANELLDLLFNKAKIDGLFTDFTDTVVK
                     FVKQ"
     misc_feature    248654..249667
                     /locus_tag="BT0241B"
                     /note="glycerophosphodiester phosphodiesterase;
                     Provisional; Region: glpQ; PRK11143"
                     /db_xref="CDD:236859"
     misc_feature    248753..249643
                     /locus_tag="BT0241B"
                     /note="Glycerophosphodiester phosphodiesterase domain of
                     Escherichia coli (GlpQ) and similar proteins; Region:
                     GDPD_EcGlpQ_like; cd08600"
                     /db_xref="CDD:176542"
     misc_feature    order(248768..248770,248849..248851,248855..248857,
                     248894..248896,249167..249169,249278..249280,
                     249533..249535)
                     /locus_tag="BT0241B"
                     /note="active site"
                     /db_xref="CDD:176542"
     misc_feature    order(248768..248770,248894..248896)
                     /locus_tag="BT0241B"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176542"
     misc_feature    order(248849..248851,248855..248857,249167..249169)
                     /locus_tag="BT0241B"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:176542"
     gene            249712..251274
                     /locus_tag="BT0243"
                     /db_xref="GeneID:4642156"
     CDS             249712..251274
                     /locus_tag="BT0243"
                     /EC_number="1.1.5.3"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="YP_945250.1"
                     /db_xref="GI:119953041"
                     /db_xref="GeneID:4642156"
                     /translation="MGKNKKKELRDIDNQDFDLIIVGGGATGLGIGIDSITRGYKTLL
                     IEKFDYAKGTSSRSTKLIHGGVRYLAQLNVPLVKEALYEKALLETNAPHLVSKCEFVT
                     PIYNILNIPYYYFGLSWYHNLLGKHKKSQYKTKLLSKSKTIEKMPNIKTKGLKCSVLY
                     YDASFDDARMAISMLRTFTEKGGIAFNYTEPTNFIKKNGKISGAIIKDRMTKEQVIIN
                     SKCIINATGIFADEIRKLDDTNAANIIKPSQGTHLVINKDKLHTEYAMLMPKTSDKRI
                     LFAVPWYDVIVCGTTDIAINKIEEEPKRLESEIEFIIKNINNYLDIKITKNDILSVYS
                     GIRPLIVAPKEKKNTSKISRNDKIFVSDSNLITIAGGKYTTYRKMAEKVLKRAIEENL
                     IPDSKSITENLKLHGYIEREEALKIPEYFRAYGSDFEHLSQMKDFNKKIHTDLPLNEA
                     QITFAIEFEQAKTVEDILSRRTRSLLFNAKATIESTPKVAEIMMHKLGKSKEWKTEQI
                     KNFKEVATKYLV"
     misc_feature    249736..251271
                     /locus_tag="BT0243"
                     /note="Glycerol-3-phosphate dehydrogenase [Energy
                     production and conversion]; Region: GlpA; COG0578"
                     /db_xref="CDD:223651"
     misc_feature    249811..251130
                     /locus_tag="BT0243"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(251360..251854)
                     /locus_tag="BT0244"
                     /db_xref="GeneID:4642192"
     CDS             complement(251360..251854)
                     /locus_tag="BT0244"
                     /EC_number="1.1.1.158"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="YP_945251.1"
                     /db_xref="GI:119953042"
                     /db_xref="GeneID:4642192"
                     /translation="MKINNLVAGVLNLDSKDYKAAKKKVNVNRANIFSSIFKAELVRE
                     DKHFIVFENGEFNLELIKDMLDKINDVGEKLLSEPSRQNVIFYKKTIGEFLSIVLSFS
                     ISLKEQKGGNNGELKRPKYRIIRIINEKLDRLAYSVLQNQVSQIKLLSSIEEIQGLLI
                     NLLK"
     misc_feature    complement(251363..251854)
                     /locus_tag="BT0244"
                     /note="Protein of unknown function (DUF327); Region:
                     DUF327; cl00753"
                     /db_xref="CDD:260606"
     gene            complement(251851..252393)
                     /locus_tag="BT0245"
                     /db_xref="GeneID:4642676"
     CDS             complement(251851..252393)
                     /locus_tag="BT0245"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical cytosolic protein"
                     /protein_id="YP_945252.1"
                     /db_xref="GI:119953043"
                     /db_xref="GeneID:4642676"
                     /translation="MLNLLSIKKDKKISSSFIFADVKTIVGKGDFFKGELISNNFIRI
                     DGDFLGTINSTKRVIIGEAGRVKSNINANEVVVSGIVLGNVQASNKIKIFQSGCIIGN
                     ISCKSIEVEEGAIIDGYMNIGIGSLSFSEKDVLIYTGSYKVDEDVLIEVNKEMSREES
                     TKDACIDECDKYLFDDEQDR"
     misc_feature    complement(252028..252393)
                     /locus_tag="BT0245"
                     /note="Integral membrane protein CcmA involved in cell
                     shape determination [Cell envelope biogenesis, outer
                     membrane]; Region: CcmA; COG1664"
                     /db_xref="CDD:224578"
     gene            complement(252394..253422)
                     /locus_tag="BT0246"
                     /db_xref="GeneID:4642748"
     CDS             complement(252394..253422)
                     /locus_tag="BT0246"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall endopeptidase, family M23/M37"
                     /protein_id="YP_945253.1"
                     /db_xref="GI:119953044"
                     /db_xref="GeneID:4642748"
                     /translation="MMRDRKGFRILSFFKKLDKIFFTIFSSFLKLLSNVYSIFRQNIS
                     FMIIPHVKGDVKNIKISFLTLFLFFLFFLFIFIGFVLLSINYVTLKSIVKSTEKNYAL
                     AESEIEDFRNTVVEINSVASNFSKVLDELNVSLKIKESNIDLNRSKLDGDLADFLDLQ
                     MLEANALKELNDLKNVKNTIEGSISPLKSIVKLLHSQNKLLNDIPSLWPIVKGDGIVS
                     LHFGPAIEPFTRQWYIHKGIDLAGVRIGTAIVAAADGEVIRASYQVTGYGNFVQIKHK
                     YGLSTLYAHMSRLNISKGSYVRKGQVIGFLGQTGYSTGPHLHYEVRIGSQVVNPDMYL
                     NLATGASK"
     misc_feature    complement(252397..253182)
                     /locus_tag="BT0246"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(252433..252726)
                     /locus_tag="BT0246"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            253649..254248
                     /locus_tag="BT0247"
                     /db_xref="GeneID:4642630"
     CDS             253649..254248
                     /locus_tag="BT0247"
                     /EC_number="3.6.1.15"
                     /note="HAM1-like protein; Rec-dependent growth; RgdB;
                     yggV; it is suspected that this protein functions to
                     remove misincorporated bases such as xanthine or
                     hypoxanthine"
                     /codon_start=1
                     /transl_table=11
                     /product="putative deoxyribonucleotide triphosphate
                     pyrophosphatase"
                     /protein_id="YP_945254.1"
                     /db_xref="GI:119953045"
                     /db_xref="GeneID:4642630"
                     /translation="MKTLFFATTNINKINEVKQILDIPNIKIKIPKNFDVKETGKTFK
                     ENSLLKAKTLFESLDKKKPVFSEDSGLCIKALNLEPGIYSKRYDQYKLGKKLGTNEKN
                     HLIIDLMKDKENRTAYFICIVSHISIDGTITNFEGILNGTIALDIDCYKKNGFGYDPI
                     FLTANNKRLSELTLTEKNKISHRGIAFAKFKKFLMQSLN"
     misc_feature    253658..254227
                     /locus_tag="BT0247"
                     /note="NTPase/HAM1.  This family consists of the HAM1
                     protein and pyrophosphate-releasing xanthosine/ inosine
                     triphosphatase. HAM1 protects the cell against mutagenesis
                     by the base analog 6-N-hydroxylaminopurine (HAP) in E.
                     Coli and S. cerevisiae. A...; Region: HAM1; cd00515"
                     /db_xref="CDD:238285"
     misc_feature    order(253676..253678,253682..253687,253694..253696,
                     253853..253861,253898..253903,254003..254005,
                     254111..254113,254117..254122,254192..254197)
                     /locus_tag="BT0247"
                     /note="active site"
                     /db_xref="CDD:238285"
     misc_feature    order(253760..253768,253874..253879,253886..253888,
                     253895..253897,253904..253906)
                     /locus_tag="BT0247"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238285"
     gene            254382..256154
                     /locus_tag="BT0248"
                     /db_xref="GeneID:4642704"
     CDS             254382..256154
                     /locus_tag="BT0248"
                     /EC_number="3.4.24.-"
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="YP_945255.1"
                     /db_xref="GI:119953046"
                     /db_xref="GeneID:4642704"
                     /translation="MIERSKINEDDKWDLSSLFKNNEEYKETVEKIKLKLQDFKEYEK
                     LEFNLNIFKQALNDYYEIEEELERTVYYTQIQLETDVSNQTSNELRAININLETYASN
                     STSFFIPKILKTDTNQIREWLQDIELKDKKIAIEKILREKEHVLSKDEERILANYTSL
                     YSSYNDIFSVLTNADMEFGEIDGKPLSNATYSLFLQNENQEIRREAFLKFYQEYKKHE
                     NTLSNLLIADINKNKFLAKTRKFKDTISMKLFQNNIDKKVYMNLIETVNENLSVLHEY
                     YEFRKNILNQEYLNHYDVYVPLTKNIKFKNSFKEACDKILKSLEILGSEYTEVLRKGL
                     LEERWVDKYENKGKRAGAFSAGSYNGKPYILMNYKDESIRDMFTLAHEAGHSMHSYFS
                     IKNNPFPQYQYSIFEAEIASTVNEQILADYLLKNENDIEKIKYIKLNQIDDLLATFFR
                     QTMFAEFEYIIHEMINKDEPVVKETLKQTYLNLLKKYFGPNFKLDENSSLECLRIPHF
                     YSPFYVYQYATGITAALLIYKNIKNNKKDATKNYINFLKIGGSKYPLESLKVTGVDLS
                     LKSTIKNTINIFKERLEDVKKLFE"
     misc_feature    254391..256145
                     /locus_tag="BT0248"
                     /note="oligoendopeptidase F; Region: pepF; TIGR00181"
                     /db_xref="CDD:232861"
     misc_feature    254535..256133
                     /locus_tag="BT0248"
                     /note="Peptidase family M3B Oligopeptidase F (PepF);
                     Region: M3B_PepF_3; cd09608"
                     /db_xref="CDD:189015"
     misc_feature    order(255522..255527,255534..255536,255606..255608,
                     255900..255902,255918..255920,255930..255932)
                     /locus_tag="BT0248"
                     /note="active site"
                     /db_xref="CDD:189015"
     misc_feature    order(255522..255524,255534..255536,255606..255608)
                     /locus_tag="BT0248"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:189015"
     gene            256166..256873
                     /locus_tag="BT0249"
                     /db_xref="GeneID:4642181"
     CDS             256166..256873
                     /locus_tag="BT0249"
                     /EC_number="2.7.8.-"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylcholine synthase"
                     /protein_id="YP_945256.1"
                     /db_xref="GI:119953047"
                     /db_xref="GeneID:4642181"
                     /translation="MKKLLNLILAWSVHILTASGLIVSLYSIISIINTDYNLLLKLTI
                     LGLLIDGIDGTLARKLKIKEIIPTINGELLDNIVDYINYTFIPTIFFYYGNFISNEYK
                     IITCIGILLASAYQFSRLDAKTSDDYFRGFPSLWNFLIIFNIIFKLDQITNLSIILLC
                     IIFSFVPIKVIYPSKTKEFKYITLPVTVIAALSVILITFAKLPDTYLKIGKTLIIFYC
                     LYLILMSIYLTYKTKKK"
     misc_feature    256181..256870
                     /locus_tag="BT0249"
                     /note="Phosphatidylserine synthase [Lipid metabolism];
                     Region: PssA; COG1183"
                     /db_xref="CDD:224104"
     misc_feature    256190..256456
                     /locus_tag="BT0249"
                     /note="CDP-alcohol phosphatidyltransferase; Region:
                     CDP-OH_P_transf; pfam01066"
                     /db_xref="CDD:250337"
     gene            256883..257491
                     /locus_tag="BT0250"
                     /db_xref="GeneID:4642503"
     CDS             256883..257491
                     /locus_tag="BT0250"
                     /codon_start=1
                     /transl_table=11
                     /product="alkaline phosphatase like protein"
                     /protein_id="YP_945257.1"
                     /db_xref="GI:119953048"
                     /db_xref="GeneID:4642503"
                     /translation="MHIILEFIDLNIAYSPIVFFGLLILAGFNIPISEDAIVIMGGIL
                     SSRKNEYTILIFLGIFWGAYIGDIISFYIGKFLANKFLKQKKQTNKLIDKMNYYYKRY
                     GSLTLLFGRFIPFGFRNAIFISAGMGNMSTSNFLITDFFAAMISITTYFTLSFKIGES
                     FKLIFPKIRIISLIALIIITIIILIIYIIRKKKIKKVDKLFK"
     misc_feature    256883..257368
                     /locus_tag="BT0250"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            257510..257593
                     /locus_tag="BTT0005"
                     /db_xref="GeneID:4642639"
     tRNA            257510..257593
                     /locus_tag="BTT0005"
                     /product="tRNA-Leu"
                     /db_xref="GeneID:4642639"
     gene            257736..260264
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /db_xref="GeneID:4642688"
     CDS             257736..260264
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /EC_number="6.1.1.4"
                     /note="leucine--tRNA ligase; LeuRS; class-I aminoacyl-tRNA
                     synthetase; charges leucine by linking carboxyl group to
                     alpha-phosphate of ATP and then transfers
                     aminoacyl-adenylate to its tRNA; due to the large number
                     of codons that tRNA(Leu) recognizes, the leucyl-tRNA
                     synthetase does not recognize the anticodon loop of the
                     tRNA, but instead recognition is dependent on a conserved
                     discriminator base A37 and a long arm; an editing domain
                     hydrolyzes misformed products; in Methanothermobacter
                     thermautotrophicus this enzyme associates with prolyl-tRNA
                     synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="YP_945258.1"
                     /db_xref="GI:119953049"
                     /db_xref="GeneID:4642688"
                     /translation="MSEYNFTKIEKKWQNYWDKHKTYKVNEDPNIPKEKRIYILDMFP
                     YPSANGLHVGHPEGYTATDILTRYKLLNGFNVLHPMGFDSFGLPAENYAIQTGEHPKK
                     ITEKNIEKFKEQIKALGFAYDWDREIRTHDENYYKWTQWIFLKLYKKGLAYIKEMPVW
                     YCPDLGTVLSNEEVIQTPDGPRSERGFHKVQRKPLRQWVLKITEYAERLIKDLEEIDW
                     PESVKEMQKNWIGKSIGAEIEFSIKASKEKIKVFTTRPDTIFGVTYLVLAPEHNIVDK
                     ITKDELKTIIAEYKDKEILKSDLERTSLEKDKTGVFTGAYAINPITEEEIPIWIGSYV
                     LGIYGTGAVMSVPAHDERDFEFAKKYNLPIKQVVSQTGNNEILTKPFTENGISINTPE
                     EFNNLKTEKVKTKVIEWLTKNKKGQKKVNYKLRDWIFSRQRYWGEPIPIIIDDDLNEI
                     PLEEDELPLRLPEIENYKPSDTGESPLSKVQNWVNVKRNGKIYKRETNTMPQWAGSCW
                     YYIRYLDPNNEKEFASKEKINYWMPVDLYIGGAEHSVLHLLYARFWHKVLYDLGYVNT
                     KEPFKKLINQGMITSFAYQDENGILIPNDEVKKRDNKFFSKTNNKELKQIIAKMSKSL
                     KNIINPDDIIKEYGADSMRIYEMFMGPLTDSKPWNTQGLIGIFRFLNKIWAIKNKELT
                     KESAAKEIISGLHKTIKKVTEDIENLNFNTAISSLMIFINELLKHDKNYLEIFKPLTI
                     ILAPFAPHLGEELWEYMGEQPSIFKNAKWPKYDPNLIIDNTREIVLQVNGKIKDKIIL
                     NKGINEDTLKDIALKNHKIMQNIQNKQIIKIITVKDKLINIVTK"
     misc_feature    257736..260261
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="leucyl-tRNA synthetase; Validated; Region: leuS;
                     PRK00390"
                     /db_xref="CDD:234743"
     misc_feature    257847..259709
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="catalytic core domain of leucyl-tRNA synthetases;
                     Region: LeuRS_core; cd00812"
                     /db_xref="CDD:173906"
     misc_feature    order(257862..257864,257868..257870,257889..257891,
                     257898..257900,257982..257984,258006..258008,
                     259353..259355,259359..259364,259374..259376,
                     259461..259463,259470..259472,259593..259595,
                     259599..259601)
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="active site"
                     /db_xref="CDD:173906"
     misc_feature    257889..257900
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    258414..258968
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="Leucyl-tRNA synthetase, Domain 2; Region:
                     tRNA-synt_1_2; pfam13603"
                     /db_xref="CDD:257918"
     misc_feature    259590..259604
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173906"
     misc_feature    259707..260006
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="Anticodon-binding domain of bacterial and
                     eukaryotic mitochondrial leucyl tRNA synthetases; Region:
                     Anticodon_Ia_Leu_BEm; cd07958"
                     /db_xref="CDD:153412"
     misc_feature    order(259716..259718,259725..259730,259737..259739,
                     259749..259751,259866..259868,259878..259880,
                     259887..259892,259899..259901,259908..259910,
                     259920..259922)
                     /gene="leuS"
                     /locus_tag="BT0251"
                     /note="tRNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:153412"
     gene            260275..262560
                     /locus_tag="BT0252"
                     /db_xref="GeneID:4642560"
     CDS             260275..262560
                     /locus_tag="BT0252"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter, RND superfamily"
                     /protein_id="YP_945259.1"
                     /db_xref="GI:119953050"
                     /db_xref="GeneID:4642560"
                     /translation="MDLETLSIKYRVFILIIFTLITIFLGFFLKNIKFDSNILKLIPK
                     NKKTEKIIDIDKSNSLLSTIVMFKDKKSIFNKETFGKINKVANDITKILKVTPNSVTS
                     IFTYFPQFKKDVYTDEDITEIRNKVNSSSFIKNIFLNDDATLIYFIVISTTDDKTNFS
                     RSLKNELEAMEAAIKRYETDDLKLYLTGDLIVREKILNYMADDFKLLGPLATLVVILS
                     LYFIVKNVLGAILPVLIATFALIWTFGIKSIVMSPITVPETTMVVLLISIGCANAVHI
                     INGILKRIKNEPFTEKTIITTIKTLRTPIILTSLTTAFGFLSLISSSIQAYKTMGIFM
                     STGVIIAMLMSLLVLPGILTYIPFKYKNKENKNAKNDFLEKLSLINQTVTQWILNNKY
                     LSSIITLIILLTSIIGLFKIEINFDEKDYFKENTSVKQTLNLMQKEIGGTSIIKIEIN
                     GTTGEFKNEKNMKNLDLITDNLDKFTEKTQSSSINGIIRLMNFKFKKENPKEYRLPEN
                     QAILNKLILLISRSNSIKNMTKMYINDDWSQISIIVRTDQNSTEEIKNFANYASNLIE
                     EYMPGHEYNFSGAYDKILISKTMVVEQVTNIITTLSAITILLMLFFKSIKTGIIIVIP
                     VAWSVFLNFAVMKLFGITLNPATATIASVSMGIGVDYSIHFFNAFILNYQTTKDYKKA
                     LIKSIPNVFNGIFANSISVGIGFLTLIFSTYKIIATLGAIIAFTMLTTSLASLTLLPL
                     LIYLFKPTVKTLKTTNEILTE"
     misc_feature    260275..262467
                     /locus_tag="BT0252"
                     /note="Predicted exporters of the RND superfamily [General
                     function prediction only]; Region: COG1033"
                     /db_xref="CDD:223964"
     misc_feature    <260683..261342
                     /locus_tag="BT0252"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <262063..262485
                     /locus_tag="BT0252"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(262619..265066)
                     /locus_tag="BT0253"
                     /db_xref="GeneID:4642852"
     CDS             complement(262619..265066)
                     /locus_tag="BT0253"
                     /EC_number="3.4.21.53"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease La"
                     /protein_id="YP_945260.1"
                     /db_xref="GI:119953051"
                     /db_xref="GeneID:4642852"
                     /translation="MKLKEIKYSMEEVKNTVSKGKKRSKNSGGILPHFDKPVRVPLIA
                     VPSHPVFPGMFIPIVIVSDTDMKAVDYVIKGNGIISLFVLRDKFLEKSRTKNDKLIIN
                     YKKDIYSVGITAKIVKKINLPDGGYNIFVSTIDRVKFVKVVLNEDFPIIEVDYLKQIP
                     IKKDDVQSKAIYSSILLRTKEIFSHRKMPEFQLNMVNIEDKGRLCDVVAGMISSSKDA
                     HQEVLETLSVKDRLKKVLELIYEELNLIEIQNKIAKGIQEKLEKQQKEFFLKEQLKAI
                     KAELGVGDEKSNEFLKLKAKIDSLALKGEALEAVERELEKFSFLEKHSSEYIVVRNYL
                     ELITNLPWGESKVNFDKFNLQRAEKILDKTHYGMREVKDRIIEYISVLKLRKSQKGAI
                     MLLVGPPGVGKTSIGTAIAEVLKTKFFRFSVGGMKDESEIKGHRRTYVGALPGKIIQG
                     LRITKTNSPVFLIDEIDKVSASNYGDPFSALLEVLDPEQNINFRDHYLDLPFDISNVF
                     FILTANSLETIPTPLLNRMEIIQLSGYVDDEKIEIARKYLIPKVLNENGVNKDSLKFQ
                     GSALVQIAREYARDNGLRNFEKYLKQIVRKVARKLIEDKSVKAYQISKENLEEYIGIP
                     VFRKEEFLHKVMSPGMVMGLAWTNYGGSTLVIETVKTESKSPGIKLTGRLGDVMKESA
                     NIAFTYVNSISNELKLNKSFFEKYMIHLHIPEGAIPKDGPSAGITIASAFISLALNKV
                     VRPHLAMTGELSLTGNVMAIGGLRAKIIAAKRSGLEHIIIPKSNKVDLDDIPINIKNG
                     INFHLVDNMREVIKLLF"
     misc_feature    complement(264344..264952)
                     /locus_tag="BT0253"
                     /note="ATP-dependent protease La (LON) domain; Region:
                     LON; pfam02190"
                     /db_xref="CDD:251146"
     misc_feature    complement(262622..264946)
                     /locus_tag="BT0253"
                     /note="ATP-dependent protease La; Region: lon; TIGR00763"
                     /db_xref="CDD:233119"
     misc_feature    complement(264176..>264427)
                     /locus_tag="BT0253"
                     /note="Protein of unknown function (DUF1151); Region:
                     DUF1151; pfam06625"
                     /db_xref="CDD:253829"
     misc_feature    complement(263477..263971)
                     /locus_tag="BT0253"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(263855..263878)
                     /locus_tag="BT0253"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(263525..263527,263675..263677,
                     263852..263875))
                     /locus_tag="BT0253"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(263672..263689)
                     /locus_tag="BT0253"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(263489..263491)
                     /locus_tag="BT0253"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(262622..263236)
                     /locus_tag="BT0253"
                     /note="Lon protease (S16) C-terminal proteolytic domain;
                     Region: Lon_C; pfam05362"
                     /db_xref="CDD:191262"
     gene            265134..265820
                     /locus_tag="BT0253A"
                     /db_xref="GeneID:4642851"
     CDS             265134..265820
                     /locus_tag="BT0253A"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945261.1"
                     /db_xref="GI:119953052"
                     /db_xref="GeneID:4642851"
                     /translation="MQFNKVNAIITNLYHKKSYSLLNLFHSKGIIHTIIYNSTIKKFK
                     SNINNLVKANFEIVKEKNLCKIIEVNDEEFIMQDLIYEKLIIIYLWIKLINLSFDDGE
                     CFKLFIEATEILNTTSLEKAQLIDLQYKTRFLIIKGFLYLSKLCFQCNKQIDKHYYYD
                     IHINGFNCIKCTNNQNNYINTGSFKYLEYTTQKNIKETLNVNLISKSKELIKIMIKNK
                     INTEFEQTLL"
     gene            265843..267957
                     /locus_tag="BT0254"
                     /db_xref="GeneID:4642819"
     CDS             265843..267957
                     /locus_tag="BT0254"
                     /EC_number="3.1.-.-"
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded-DNA-specific exonuclease RecJ"
                     /protein_id="YP_945262.1"
                     /db_xref="GI:119953053"
                     /db_xref="GeneID:4642819"
                     /translation="MKIWEKKEIDIKKENIINIAKKYNISILEATLLLRREIKEEDFL
                     FFIESSVNLMHNPFLLKNINKFIYRMNEAIAEKENVLIFGDKDADGITATIIMYETLK
                     DFGINVTYKIPSNGEFYGLTKEIIDKALEDKISIIITVDCGISNIEEANYARSKNIEV
                     IITDHHLPNKEIDIENIIIDPHLKGDLSPFKEIAGCYVSFKACLALYLSTTNLYNKNM
                     VFLFLERLNNNITLHAIEINNYILKKYITLESNNDLQININKLEEFSQSKYIIVFNKD
                     EQNQLLNEFFNHKIDIETIDISENFVKKYPKFAKKTLKELMQITKYFKYREINIKEKL
                     YYIFYNIIFAINKDLLKNCLKRLKFVAIGTIADNMPIINENRIVVREGLKEIALRENI
                     SINYLLKEANILTKPMITATDIAFKIAPILNSTGRLEKADITIQFLLTEDINQIENKF
                     KEIKNINILRKRKEDISWNTHNENIIFKNDKFIVCYDKHTPKGISSRMATRLSTYYQK
                     VAVFLTRQENIIKGSIRSNNKVNSKELISMIPNHLIINSGGHKAAAGFTLYESVLNEF
                     IKELENALEKIEYKELYEDSILIDAIIPKDFNKKELLKIINLFEPYGHGFREFVFMME
                     NVYIQDLRTIDKNGNSKHISMKIKNNKDYYKAIYFNGTQNIQKLGIKDGQNIDIICTI
                     SEDLYNQNDKILKIIDIKKRQN"
     misc_feature    265915..267912
                     /locus_tag="BT0254"
                     /note="single-stranded-DNA-specific exonuclease RecJ;
                     Region: recJ; TIGR00644"
                     /db_xref="CDD:233070"
     misc_feature    266059..266463
                     /locus_tag="BT0254"
                     /note="DHH family; Region: DHH; pfam01368"
                     /db_xref="CDD:250564"
     misc_feature    267364..267555
                     /locus_tag="BT0254"
                     /note="DHHA1 domain; Region: DHHA1; pfam02272"
                     /db_xref="CDD:251196"
     gene            267957..268895
                     /locus_tag="BT0255"
                     /db_xref="GeneID:4642151"
     CDS             267957..268895
                     /locus_tag="BT0255"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall endopeptidase, family M23/M37"
                     /protein_id="YP_945263.1"
                     /db_xref="GI:119953054"
                     /db_xref="GeneID:4642151"
                     /translation="MINIKSLLFTFITGLLNINAVSNDTIKSYYKKETFQGDNIYFAS
                     NKNFKKLSLLGTNQKPILSASPFKFNAGNREYHIALIGITPMIKEGKRKIKIEFEHKT
                     YIKEIEIKKLKFKKTTVKLNKNKSKLIKSQQSPKEKKQALTLWNIIGNIGDTTIYHYD
                     TLVYPIKDQYKITSPYGDQRIYMQDKKKISSHKMHNGKDYAPLKREKTPIFAAGRGKV
                     VFARDREITGKTVIIQHLPGVFTIYLHLSKFGVKENTIVNTGEYIGHVGNTGISTGPH
                     LHFEVRINGVAVNPDFFLEQMLIDKNQIINNTKRIE"
     misc_feature    <268197..268877
                     /locus_tag="BT0255"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    268533..268826
                     /locus_tag="BT0255"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            268906..269124
                     /gene="rpsU"
                     /locus_tag="BT0256"
                     /db_xref="GeneID:4642694"
     CDS             268906..269124
                     /gene="rpsU"
                     /locus_tag="BT0256"
                     /note="a small basic protein that is one of the last in
                     the subunit assembly; omission does not prevent assembly
                     but the subunit is inactive; binds central domain of 16S
                     rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="YP_945264.1"
                     /db_xref="GI:119953055"
                     /db_xref="GeneID:4642694"
                     /translation="MIFLITVNVDKNEGLEKALKRFKRMIEKEAIIREWKRREYYEKP
                     STIRVKKEKAFKRKQAKKVRKLKQKIGK"
     misc_feature    268915..269115
                     /gene="rpsU"
                     /locus_tag="BT0256"
                     /note="Ribosomal protein S21 [Translation, ribosomal
                     structure and biogenesis]; Region: RpsU; COG0828"
                     /db_xref="CDD:223898"
     gene            complement(269164..271506)
                     /locus_tag="BT0257"
                     /db_xref="GeneID:4642693"
     CDS             complement(269164..271506)
                     /locus_tag="BT0257"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="YP_945265.1"
                     /db_xref="GI:119953056"
                     /db_xref="GeneID:4642693"
                     /translation="MKNFYHYFHFLFFFMLAVISFSLFVALTPVGNIFIFFVFNLIGH
                     MLLNTFSFLSFYLILYPLVNWYAYRNNIFSKKFVFNWNYTVILFFTLTFWLRINSDLE
                     GSNFINWFLSNFGIMLGNFFVFLILILELVIWIYLNYVLFKDASFVLNTFHFIVFKLK
                     ILFESMFAFLPFLNTLKIKKNIKVYKDCDGNLDAAKTSDKGDNIINDEEYQALWSFKA
                     FLRKPNKPLDVNLDKTIFCQSEVSDDNLSEEQSFQDSQCDLNVTDDSKYKALTEFEDN
                     KLVSSGKIKVGDIRHKGIISNLVKIDYGNLLVGEGSDNYLIDISVFDQREPKSETEDI
                     EYDREIQKQSMILQETFKEFNINAKLIDVIKGPVVTMYAVRPDKGIKLSRITSISDNI
                     ALRLAAVRVRIIAPIPGKEAVGIEIPNKRREFILISEIINSKEFQSDFKVPFALGKEI
                     NGSNVVFDLINAPHLLIAGATGAGKSVCVNSLIASIIFSKSPDDVKLVLIDPKVVELK
                     LFNDIPHLLTPVITDVNRALEALRWCLDEMERRYVLLDNFLVRDINAYNKKILEEGLN
                     EAPLPYLVIIIDEFADLILSARKDLENLISRLAAMARAVGMHLVLATQRPSVDVITGV
                     IKANFPSRISFMVASSMDSRIILGASGAEKLLGKGDMLYVNPTTPFPQRIQGGFLNEK
                     EVYRLVEEVKKFGTPNYIDDEIFIDSIVGADTVVLNPSDEPMFEEALEIIRSTKKASA
                     SYLQRRLKIGYNRAARIIELMEEMGYIGPVNGSKPRDVFI"
     misc_feature    complement(<270997..271461)
                     /locus_tag="BT0257"
                     /note="Vault protein inter-alpha-trypsin domain; Region:
                     VIT; cl02699"
                     /db_xref="CDD:261411"
     misc_feature    complement(269167..271458)
                     /locus_tag="BT0257"
                     /note="DNA segregation ATPase FtsK/SpoIIIE and related
                     proteins [Cell division and chromosome partitioning];
                     Region: FtsK; COG1674"
                     /db_xref="CDD:224588"
     misc_feature    complement(269653..270222)
                     /locus_tag="BT0257"
                     /note="FtsK/SpoIIIE family; Region: FtsK_SpoIIIE;
                     pfam01580"
                     /db_xref="CDD:250719"
     misc_feature    complement(269167..269349)
                     /locus_tag="BT0257"
                     /note="This domain directs oriented DNA translocation and
                     forms a winged helix structure; Region: Ftsk_gamma;
                     smart00843"
                     /db_xref="CDD:197911"
     gene            complement(271520..272317)
                     /locus_tag="BT0258"
                     /db_xref="GeneID:4642579"
     CDS             complement(271520..272317)
                     /locus_tag="BT0258"
                     /EC_number="2.7.1.66"
                     /note="putative undecaprenol kinase; BacA; phosphatase
                     activity in Escherichia coli not kinase; involved in
                     bacitracin resistance as bacitracin supposedly sequesters
                     undecaprenyl disphosphate which reduces the pool of lipid
                     carrier available to the cell"
                     /codon_start=1
                     /transl_table=11
                     /product="undecaprenyl pyrophosphate phosphatase"
                     /protein_id="YP_945266.1"
                     /db_xref="GI:119953057"
                     /db_xref="GeneID:4642579"
                     /translation="MMENVLRVMILGFVQGISEFLPISSSGHLLLLKKFMHIDLPMVF
                     DIYLHFATVLVVVIYYRKRILELVVVLVKFVLRKTTKLDFVKLRLILLISIITLITAF
                     VGIFIENFKELFTLDLVLVNFILTSILLFLLEFKILIFDFKKNILFAGCLIGTMQGIG
                     AMPGISRSGITIFASVLLGFSRSESFEISFLSLIPIVFGSLLLKYKELFESDMLFSVF
                     EINLGAIIAFMVGLFSISLFVKMLKDSKLYYFSVYLIILVSLVYFLF"
     misc_feature    complement(271523..272317)
                     /locus_tag="BT0258"
                     /note="undecaprenyl pyrophosphate phosphatase; Reviewed;
                     Region: PRK00281"
                     /db_xref="CDD:234712"
     gene            complement(272330..274522)
                     /locus_tag="BT0259"
                     /db_xref="GeneID:4642434"
     CDS             complement(272330..274522)
                     /locus_tag="BT0259"
                     /EC_number="3.2.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="soluble lytic murein transglycosylase"
                     /protein_id="YP_945267.1"
                     /db_xref="GI:119953058"
                     /db_xref="GeneID:4642434"
                     /translation="MQFMIVLFIKKKKLLNVKTVIMFKQIICLFLLSLFSCSFGKGSL
                     NSNIVKRNVDNFDLSHLNWLWNFDYAGKNFDEYFGIDSNSYVYIAYLFKKIGYDEKFK
                     EYMYKAIKSSNDIASQFAGIKLLEYYNARREYFEAELVGRKLYKRYDNNKFIILGYFK
                     SLYWQKKNDEALLVLNKLEKMNFAQSQENENLLFKAVLYFNASDINSSLIYFSKLFED
                     LPAEYLHVRAHDYLVLEERSNLLSSVFFNLVKFKSLVANGDLKGAISILNDDFKKYYN
                     NFVFLNDVYKAFLGSGYISKALSFFSSLNSVYKDYYLGLINLRLKKDVGFFTIVKYLE
                     NASLENEPYRLEILNEIFGNLIFLQNTRNYFAQNVARFYTDKDRNNLGFIKILDEYIL
                     EAVQLKDYDNLYALYHNGQNIIDGAVLSRLAFINARLIYHKFIASKSRNEYDELLRSS
                     IKYNRISYASFMSKYLLNQSINDFFENDLNIHYDQSDYERFLEGFLKFNLHSYVSAFV
                     ASDFNNGYRFSPNFYRNLYDELVRHEYYYESTLAINYLVKQDNSALSRDDYKRLYPCL
                     YNDLIRYWSKRRKLEPSLVFSLIKAESSFKGNAVSKPGAIGLMQIMPLTSVDVSREIK
                     YYDYDLKQPKDNVIIGTYYLSKRIKMIGEVYKALASYNGGIGNVRKWERDYGHLPKEF
                     FIEAIPFGQTRNYVKKILVYCVLYDALYESKGMDFIIEYIMGEFPKSF"
     misc_feature    complement(272384..>272824)
                     /locus_tag="BT0259"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    complement(272417..272779)
                     /locus_tag="BT0259"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    complement(order(272540..272542,272594..272596,
                     272687..272689,272747..272749))
                     /locus_tag="BT0259"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    complement(272747..272749)
                     /locus_tag="BT0259"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            complement(274452..275735)
                     /locus_tag="BT0260"
                     /db_xref="GeneID:4642433"
     CDS             complement(274452..275735)
                     /locus_tag="BT0260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945268.1"
                     /db_xref="GI:119953059"
                     /db_xref="GeneID:4642433"
                     /translation="MNIVLIILYYCYSLIIYKFVFYKRTKRLEFLKGFLAIRLSNDEY
                     FSILSLDDTAVKRVVLGKIADEPNVKLDFYISEHDDFSNSVIIGSFFLDNLRKESANI
                     NVYFKIDSMMLYVYGECDGIANKSKFDLSLINLAVDSEEINDLESAKSSDLPVGFSGV
                     EREEEFVKEFGSVAGQYDSLDGDLDNFNDLPNSQNLSADEKLFSNENNFNLLSDSLNS
                     DNGTLVSENLDSDSDLNLENFDFGLTGDGFENNIDEGNDLEEHVLNDKDTVSRDDFDL
                     DNISVDISDSSAASDNSAANAVKLVEDKDTDFKSVNVYTLQDSYSDNWDVEDIITDLD
                     NGLGESEFDDVALDFSKEDFATDIEESRLDLDSEEGLIQTSMLYLSLISLFLLIFFSL
                     FLIFSKVLNPRNFAIYDCPFYKEEKITKCENSNYV"
     misc_feature    complement(<274629..275282)
                     /locus_tag="BT0260"
                     /note="Mpp10 protein; Region: Mpp10; pfam04006"
                     /db_xref="CDD:252311"
     gene            275835..277205
                     /locus_tag="BT0261"
                     /db_xref="GeneID:4642535"
     CDS             275835..277205
                     /locus_tag="BT0261"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide repeat family protein"
                     /protein_id="YP_945269.1"
                     /db_xref="GI:119953060"
                     /db_xref="GeneID:4642535"
                     /translation="MLPLFIILSSAAISLLIFLFFKIAISNTKIRKKGKHNKTKKLTD
                     KAANILKTNPNEISALQTLNDYYYSNKDFENGIKYAKKLCQLIEENPTNQRIDSFKAF
                     LSYGFYNLERNFNSEALVFLKKAYIMKKTDVDANYYLGIAFLRNAHYKEALHYLTKIY
                     KFDKNNKDALKYIGITLFHMENYTKAVGIFNSISKYIQNDVNALLAYAQSLSQLNQDR
                     LAFSIANKIRNKDGRIYEALLIESEINSKNNNLTKLEDNIREMMKIKPDLPTKTFLKL
                     FYKLGELYIEHENYKKATEAFTRVERIDPHYQKITEKLEFSKRLNENLALRIYLRSPK
                     EKFDNLANAIILKLYKNKFQVRDKKINEITSQFIDINFQLSNNQWEENLIVRFVRTDQ
                     KNFGELFLKDLIAKTKESKLKGLCIAPATFSDKAKQIIEGRLIDLIEGKKLIQILKTL
                     DISKYV"
     misc_feature    276009..276329
                     /locus_tag="BT0261"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(276009..276011,276015..276020,276027..276032,
                     276141..276146,276150..276155,276162..276167,
                     276243..276248,276255..276260,276267..276272)
                     /locus_tag="BT0261"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(276024..276026,276060..276062,276072..276074,
                     276081..276083,276150..276152,276186..276188,
                     276198..276200,276207..276209,276252..276254,
                     276288..276290,276300..276302,276309..276311)
                     /locus_tag="BT0261"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    276243..276494
                     /locus_tag="BT0261"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(276243..276248,276255..276260,276345..276350,
                     276354..276359,276366..276371,276447..276452,
                     276459..276464,276471..276476)
                     /locus_tag="BT0261"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(276252..276254,276288..276290,276300..276302,
                     276309..276311,276354..276356,276390..276392,
                     276402..276404,276411..276413,276456..276458,
                     276492..276494)
                     /locus_tag="BT0261"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(277207..278472)
                     /locus_tag="BT0262"
                     /db_xref="GeneID:4642437"
     CDS             complement(277207..278472)
                     /locus_tag="BT0262"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall endopeptidase, family M23/M37"
                     /protein_id="YP_945270.1"
                     /db_xref="GI:119953061"
                     /db_xref="GeneID:4642437"
                     /translation="MSHIMIIPKKDQNVLKRNRNFLFDRAIKGDFELRDFGNIRNFHR
                     KKRKKFFRFMNIPNKLLDVIKLLFLTLFGRMVIIDNYKYRSSYNKIRLKMINDYDINL
                     TYIFIFRFNAIIFVLVLVFYLNIFSYYGSYIFLSRLSFPKDYFIDTFLYYSDQDLSQI
                     NNHLFGVDTNSYEATVRKPFVLKVVKHKINPGETLSHIAARYSITSETLISYNDIKDV
                     RSIRPNFVINVPNMKGVLYTVEKSDSLSSIAKKYKIPKVDILDANNLDNEVLYLGQKL
                     FIPGGKMAKELLRNALGETFLFPTQGVITSGYGYRPDPFTKIISFHNGIDIANVANTP
                     IFATKEGIVVTAGFSVGGYGKYIIISHNNGFQTLYAHLGSFAVKVGQRVSRGQIIGRM
                     GSTGYSTGNHLHFTIFKDGKTGNPMKYLR"
     misc_feature    complement(277210..277914)
                     /locus_tag="BT0262"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(277786..277914)
                     /locus_tag="BT0262"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    complement(277639..277764)
                     /locus_tag="BT0262"
                     /note="Lysine Motif is a small domain involved in binding
                     peptidoglycan; Region: LysM; cd00118"
                     /db_xref="CDD:212030"
     misc_feature    complement(277225..277515)
                     /locus_tag="BT0262"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            278525..279028
                     /locus_tag="BT0263"
                     /db_xref="GeneID:4642429"
     CDS             278525..279028
                     /locus_tag="BT0263"
                     /EC_number="3.4.21.89"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase I"
                     /protein_id="YP_945271.1"
                     /db_xref="GI:119953062"
                     /db_xref="GeneID:4642429"
                     /translation="MIKTHKQVLIPIILALLLMIAIIKISLSFHLVKGSSMSPKILEK
                     HWIINNKLAYGIRLKNSKTYIILWGLPKKNEMVLIKDPITKKISIKKIFAIPGEKFIK
                     LKQNVISIHNLNFNIDKEHLKILENIYIPKDYYLVVGENKKVSLDSREYGFININDII
                     GKIIYCL"
     misc_feature    278618..279013
                     /locus_tag="BT0263"
                     /note="The S26 Type I signal peptidase (SPase; LepB;
                     leader peptidase B; leader peptidase I; EC 3.4.21.89)
                     family members are essential membrane-bound serine
                     proteases that function to cleave the amino-terminal
                     signal peptide extension from proteins that are...;
                     Region: S26_SPase_I; cd06530"
                     /db_xref="CDD:119398"
     misc_feature    order(278630..278632,278828..278830)
                     /locus_tag="BT0263"
                     /note="Catalytic site [active]"
                     /db_xref="CDD:119398"
     gene            complement(279074..280585)
                     /locus_tag="BT0264"
                     /db_xref="GeneID:4642781"
     CDS             complement(279074..280585)
                     /locus_tag="BT0264"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaK"
                     /protein_id="YP_945272.1"
                     /db_xref="GI:119953063"
                     /db_xref="GeneID:4642781"
                     /translation="MMEKWIGIDLGTTNTVASYFDANSRVILNDRGERMTPSIVSFTD
                     SGIIVGSIARHQILVNPDKTFYNFKVDIGTEVSYEVGNNTYRAEDIASYLLLNVKMNA
                     EKFLGTEICDVVITVPAYFSEIQRRGVVEAASLAGLKCRAILNEPTAAALSYAFEKQI
                     DGLFLVYDLGGGTFDVTLLEKQNDTYTVLAIKGENKLGGNNFNEVIERHVLTSFEEEY
                     PDIDLDDIVILEQIRDKIEEAKKSLSIMDEVSIVLPFLDGKHLNYKLKRNDFNSMIKE
                     FIEKTISLTNECIADSGVDLERISKIILSGGSTRIPLVKERLKEIFPKIEVLDSLNQD
                     EVVANGAGIHACSLSNNSTLIDFKDVTPYSLGIETCNDGFFTLIKRNTLLPVCERKIF
                     TTTNDYQEEIEIHVLQGEYKKASLNYSIGRFFFSNIQKALRGMPKIEILFSLDESGIL
                     SISAKDLDTHVSKSIQIRMTSSSFDSGFENEGVLASLEDMRSSRVLEDSIELT"
     misc_feature    complement(279557..280585)
                     /locus_tag="BT0264"
                     /note="rod shape-determining protein MreB; Provisional;
                     Region: PRK13930"
                     /db_xref="CDD:237564"
     misc_feature    complement(279551..280570)
                     /locus_tag="BT0264"
                     /note="Nucleotide-binding domain of the HSP70 family;
                     Region: HSP70_NBD; cd10170"
                     /db_xref="CDD:212667"
     misc_feature    complement(order(279584..279586,279653..279658,
                     279662..279670,279863..279868,279875..279877,
                     279986..279991,280061..280063,280067..280084,
                     280148..280150,280232..280234,280379..280381,
                     280544..280555,280559..280561))
                     /locus_tag="BT0264"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212667"
     misc_feature    complement(order(279821..279826,279830..279832,
                     279872..279874,279884..279886,279893..279898,
                     279905..279907,280271..280276,280421..280426,
                     280433..280435,280445..280447,280493..280495))
                     /locus_tag="BT0264"
                     /note="putative NEF/HSP70 interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:212667"
     misc_feature    complement(order(280019..280030,280151..280153,
                     280157..280162,280205..280210,280214..280219))
                     /locus_tag="BT0264"
                     /note="SBD interface [polypeptide binding]; other site"
                     /db_xref="CDD:212667"
     gene            complement(280582..281079)
                     /locus_tag="BT0265"
                     /db_xref="GeneID:4642614"
     CDS             complement(280582..281079)
                     /locus_tag="BT0265"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945273.1"
                     /db_xref="GI:119953064"
                     /db_xref="GeneID:4642614"
                     /translation="MFVVFCFILIIFIFIYFHIYISLKIKSNSILRKFRSEVDKTIIE
                     INQATDRNINIIEIKIESLNRIIKEVDERIEILDQRLLGFNAHSISMGSNNFSMKGDS
                     SVYKSNLDYSIPTIEKNIIKEGYNIRQQVISLYEQGMSLEVIAKKLKLDLGEIELIVS
                     IHRGT"
     gene            complement(281101..281412)
                     /locus_tag="BT0266"
                     /db_xref="GeneID:4642438"
     CDS             complement(281101..281412)
                     /locus_tag="BT0266"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945274.1"
                     /db_xref="GI:119953065"
                     /db_xref="GeneID:4642438"
                     /translation="MDINGSSEVVKIITQGAFKASEISNEDLRKKKIRENKNLSLNQS
                     KSYHVDSEINSIYPADESMDGNVNFITMSKIKTAKRNSPGIYDINFHDPKIGRNIDIE
                     R"
     gene            complement(281437..283335)
                     /locus_tag="BT0267"
                     /db_xref="GeneID:4642089"
     CDS             complement(281437..283335)
                     /locus_tag="BT0267"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945275.1"
                     /db_xref="GI:119953066"
                     /db_xref="GeneID:4642089"
                     /translation="MATISDFADFRNRIKNYLERENRINLIEVESDTLEEALNDASLE
                     LSVPYKDLNYEVLVRGNNGLFGYGKKNWKIVAYKNSYSKFGVTDVLSSQSEFEEVASL
                     DGKFFIRRTAKGVFLKVTPAQGDGSVVKFKDVMDKFASYSNIKDLDENFVRSVIEDAN
                     GKYEQVSVFEADLVESVTMMVHISEDSMSVTVEFTVPGPNGAEVLEKDIYSILKKYGV
                     SDRALLKNKIKEFVDYPFYGEPVEMARGVNPVKGRDAYINFIAKSKSSGEYGAVGNEF
                     RNVNRGDELAEIIPLSEGIEGYTVFGKILRAEHGRELDLILGDNTFMEGNKIIAGCDG
                     YISISNGIISVHDVYVVEGDVGPGTGNIVNNGMVLVKGSVLDGYNVMAKSGIEVNGLV
                     GRCNLRTDGSIVLRSGANGKGGSEIYAKKSIKSKFLENVNVRCEGNIEVVRGIVNSFV
                     SCTKKVLCIGKKSKIVGSDVRAREEVRAYSIGSEGNAETSICVGCDPEIKVLLSRFTE
                     YLVKIEKRLEVLTKDISALKKNIQLTVDKAEKSLKIDSCNELINERDILILEIKMVKD
                     KQESLQDALEDSKIDGKIFVEYIAYTGVKLHIKDAYYELPRDYNNITFVEDDNIIKML
                     AYVPFKSK"
     misc_feature    complement(283099..283254)
                     /locus_tag="BT0267"
                     /note="Jag N-terminus; Region: Jag_N; pfam14804"
                     /db_xref="CDD:258941"
     misc_feature    complement(281443..283026)
                     /locus_tag="BT0267"
                     /note="Protein of unknown function (DUF342); Region:
                     DUF342; cl19219"
                     /db_xref="CDD:267572"
     gene            complement(283338..283823)
                     /locus_tag="BT0268"
                     /db_xref="GeneID:4642221"
     CDS             complement(283338..283823)
                     /locus_tag="BT0268"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945276.1"
                     /db_xref="GI:119953067"
                     /db_xref="GeneID:4642221"
                     /translation="MLFTKRRKYVLLFSAFAFVLAVILGIFARVPFITVLFRAVFQFI
                     VFFCIGLLLEFIYKKYLYDLFKDDSLSNDTRKKDIDENSNCKPETDDKNSFSKNIHLD
                     NNKSGDNDNYSLSDKLSKYDTVAKESKLSSKLLDQISHVENTDPKIVAETIKSLINKK
                     E"
     gene            complement(283829..284719)
                     /locus_tag="BT0269"
                     /db_xref="GeneID:4642227"
     CDS             complement(283829..284719)
                     /locus_tag="BT0269"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar synthesis regulator FleN"
                     /protein_id="YP_945277.1"
                     /db_xref="GI:119953068"
                     /db_xref="GeneID:4642227"
                     /translation="MIEDQAQSLRDIMRLNNRASFVVDDKIQNNRTRFIAVTSGKGGV
                     GKSNIAVGLALKYANLGKKVLVFDADIGMANINILLGVIPKYSIYHMIMQGRGIKDVI
                     TKTEYNIDLLAGASGTTELLDLSETEMNQFIKELLKVYEYDIVIIDTSAGISRQVISF
                     LFSSDDVVIVTTPEPTSITDAYGIIKVLSHKMENLKNLRLVVNRVANVSEGKGVAKKV
                     IDISSQFLNLNIDYLGYVYEDQNIRNSVFKQRPFILLNPNSKASYCLDSIVAALEEIT
                     LDNKKRRGVIGFISKFFGME"
     misc_feature    complement(283832..284629)
                     /locus_tag="BT0269"
                     /note="Antiactivator of flagellar biosynthesis FleN, an
                     ATPase [Cell motility]; Region: flhG; COG0455"
                     /db_xref="CDD:223531"
     misc_feature    complement(284009..284620)
                     /locus_tag="BT0269"
                     /note="FleN is a member of the Fer4_NifH superfamily. It
                     shares the common function as an ATPase, with the
                     ATP-binding domain at the N-terminus. In Pseudomonas
                     aeruginosa, FleN gene is involved in regulating the number
                     of flagella and chemotactic motility by...; Region:
                     FleN-like; cd02038"
                     /db_xref="CDD:238995"
     misc_feature    complement(<284273..284617)
                     /locus_tag="BT0269"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(284579..284602)
                     /locus_tag="BT0269"
                     /note="P-loop; other site"
                     /db_xref="CDD:238995"
     gene            complement(284729..285910)
                     /locus_tag="BT0270"
                     /db_xref="GeneID:4642197"
     CDS             complement(284729..285910)
                     /locus_tag="BT0270"
                     /note="Positive regulator of class III flagellar genes"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis regulator FlhF"
                     /protein_id="YP_945278.1"
                     /db_xref="GI:119953069"
                     /db_xref="GeneID:4642197"
                     /translation="MKSSIMVQYFTERGPTYNEVIETVKKKYGKNARVMTYKTIAHGG
                     IFGLFSRDWIEVSGYVRYDIGQQQINVEEEKRKILQSIKKEESSSIEDVIKEVKSLKN
                     ELAHKKEEINHPTILKIEDILRSNDFSESYIRDINDFIKREFSLSDLDDYDKVRDSVI
                     IYIAKTIKCSGSIIDNLKKRIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIIT
                     IDNYRIGAKKQIQTYGDIMGIPVKAIESFKDLKEEITQSKDFDLVLIDTIGKSPKDFM
                     KLAEMKELLNACGRDAEFHLAVSSTTKTADIKEIFHQFSPFSYKTVIFTKLDETTCVG
                     NLISLIHEMRKEVSYVTDGQIVPHNISIAEPLTFIKKINGYRISDDIEFIRKLKGKSY
                     Y"
     misc_feature    complement(284732..285895)
                     /locus_tag="BT0270"
                     /note="flagellar biosynthesis regulator FlhF; Provisional;
                     Region: PRK12723"
                     /db_xref="CDD:183702"
     misc_feature    complement(<285311..285466)
                     /locus_tag="BT0270"
                     /note="Protein of unknown function, DUF258; Region:
                     DUF258; pfam03193"
                     /db_xref="CDD:251789"
     misc_feature    complement(284789..285373)
                     /locus_tag="BT0270"
                     /note="SRP54-type protein, GTPase domain; Region: SRP54;
                     smart00962"
                     /db_xref="CDD:214940"
     gene            complement(285900..287990)
                     /gene="flhA"
                     /locus_tag="BT0271"
                     /db_xref="GeneID:4642858"
     CDS             complement(285900..287990)
                     /gene="flhA"
                     /locus_tag="BT0271"
                     /note="membrane protein involved in the flagellar export
                     apparatus"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="YP_945279.1"
                     /db_xref="GI:119953070"
                     /db_xref="GeneID:4642858"
                     /translation="MLDARKNSVLVYFGLNNKADLVVSVGLILVVASFILPLPAFILD
                     ALIAVNLVISLLVMLIVLYSKRSLDFSVFPTLLLVMTIFGLVLNISSTRLILIKGISF
                     DGQMIRAFGTFVVGSSGTQGLFVGFIIFLIIIAVQFIVITKGSTRVAEVAARFALDAL
                     PGKQMAIDSAYSSGNLTEEEATRQKNDLQAEVNFYGAMDGASKFVSGNVKVGFLITLI
                     NILGGLIIGVTLQGLSFSDAVNNYVSLTVGDGLVSQLPALLISTATGLIVTRSISKNS
                     FGVEIIEQFTSYSGIYWIVSGFLLFLAFLPGFPTLILILLGMLIAFLAYSLSNLDRNR
                     ELHEKQKAEEQILSYADKEIAPVVPLDPLALEIGYNLVPIVDDSKTSELLDRIVKIRR
                     EIALELGIVVPKIRIVDNMRLEPNEYSFKLRGVEIGHGEIKLGKFLVINVGSDSGIEG
                     DLTKDPSFGLPSLWVNDNGREIAEKLGYTVVDPPSIIATHMTELIKRHACEILTRQDV
                     QNILDIFKKDYGAIVEEVLKDFSVGEIQRVLQGLLKEQVSIRNLVTIFETIADFTSIT
                     KDTFFLIEKCRQAIGRQIVSGYLNSNLELNVITINPEFEQKIIDSRFETNNDLISSLD
                     PNLKTKFIYELFRLVNEVQSQGYYPVILSSESARPVIRVLTSRELPDIVVISVLEVPK
                     NVKVNVLKTVEVEE"
     misc_feature    complement(285906..287990)
                     /gene="flhA"
                     /locus_tag="BT0271"
                     /note="flagellar biosynthesis protein FlhA; Validated;
                     Region: flhA; PRK06012"
                     /db_xref="CDD:235672"
     gene            complement(287999..289120)
                     /gene="flhB"
                     /locus_tag="BT0272"
                     /db_xref="GeneID:4642767"
     CDS             complement(287999..289120)
                     /gene="flhB"
                     /locus_tag="BT0272"
                     /note="membrane protein responsible for substrate
                     specificity switching from rod/hook-type export to
                     filament-type export"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="YP_945280.1"
                     /db_xref="GI:119953071"
                     /db_xref="GeneID:4642767"
                     /translation="MNTRNEFLSKNWYIPLNFFASEDEGRTELPTEQKKQKAREEGQV
                     LKSTEINMAVTLCILFAVFFFMLSYFAYELMDVFRWQAGKLPEIMSISIYSLGFAYIR
                     SMLGYVIVFLLISFIVVFLINVVQVGFLITFKPIVPKWDRVNPNFSKWIKNSFGSFDA
                     FFNLFKSLSKIAIISFIYYIMLRSNIGKISRMFEYSLEDGISVILSLAYRICFFSVIV
                     LMGISILDYLFQRTRYIENLKMTKEEVKQERKEMEGDPLLRSRMRERMREILNANLKV
                     TVPQADVVITNPEHFAVAIKWDSNTMLAPRVLAKGQDEIAFVIKQIARENNIPVMENK
                     PLARDLYANVDVNEEIPREYWEIVSKILVKVYSIAKKFN"
     misc_feature    complement(288008..289069)
                     /gene="flhB"
                     /locus_tag="BT0272"
                     /note="flagellar biosynthesis protein FlhB; Reviewed;
                     Region: flhB; PRK05702"
                     /db_xref="CDD:235569"
     gene            complement(289117..289905)
                     /locus_tag="BT0273"
                     /db_xref="GeneID:4642475"
     CDS             complement(289117..289905)
                     /locus_tag="BT0273"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliR"
                     /protein_id="YP_945281.1"
                     /db_xref="GI:119953072"
                     /db_xref="GeneID:4642475"
                     /translation="MNMNFLVLKSFVILPVFVRIFLFLRFSPFFATIRMSYLNFFFAL
                     ILSIIVVDKINVVYPLDNLIAFTLILAGEAILGLIQAFFVSIIFSVFHLLGFFFSNQM
                     GLAYANIFDVFAEEDNLVISQIFTCLFLLLFLSNNVLLRFFMIGVHDSVLNVRVENMV
                     NIKNYEFIELMFYSFVILFEKALIISLPILGVLLLLYLILGILSKTAPQINLLMISFA
                     VSLGLGLIILYIGFPSLVMSVKRVIELALESMRNALNLFSETLK"
     misc_feature    complement(289132..289905)
                     /locus_tag="BT0273"
                     /note="Bacterial export proteins, family 1; Region:
                     Bac_export_1; cl00734"
                     /db_xref="CDD:260596"
     gene            complement(289921..290184)
                     /locus_tag="BT0274"
                     /db_xref="GeneID:4642208"
     CDS             complement(289921..290184)
                     /locus_tag="BT0274"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FliQ"
                     /protein_id="YP_945282.1"
                     /db_xref="GI:119953073"
                     /db_xref="GeneID:4642208"
                     /translation="MTTGQIIYLIRISIENIIILSAPMLITALIVGLLISIFQAVTSI
                     QDQTLSFIPKIIIILLTLVIFGPWILKKLMLFAFMVFSQIQNI"
     misc_feature    complement(289924..290184)
                     /locus_tag="BT0274"
                     /note="Bacterial export proteins, family 3; Region:
                     Bac_export_3; cl00867"
                     /db_xref="CDD:260668"
     gene            complement(290194..290964)
                     /gene="fliP"
                     /locus_tag="BT0275"
                     /db_xref="GeneID:4642215"
     CDS             complement(290194..290964)
                     /gene="fliP"
                     /locus_tag="BT0275"
                     /note="FliP, with proteins FliQ and FliR, forms the core
                     of the central channel in the flagella export apparatus"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliP"
                     /protein_id="YP_945283.1"
                     /db_xref="GI:119953074"
                     /db_xref="GeneID:4642215"
                     /translation="MNLSKKLSFFLFFGVINFAFAQTKSLQTTTGLNFPFVDLVNSVG
                     GGIIFPLQLLLILTIITLSPAFLVLMTSFLRIAIVLDFIRRALSLQQSPPNQVIMGLA
                     LFLTLFTMWPTFNIIYKEAYLPLQDSKIGFNEFYDRGIAPLRNFMYKQMSNSKHEEIR
                     LFMSISNYPRPKNFSEVPTHVLIASFVLHELKVAFKMGILIFLPFIVIDIIVAAVLMA
                     MGMIMLPPVMISLPFKLMLFVMVDGWTLITSGLVKSFM"
     misc_feature    complement(290197..>290778)
                     /gene="fliP"
                     /locus_tag="BT0275"
                     /note="flagellar biosynthesis protein FliP; Reviewed;
                     Region: fliP; PRK05699"
                     /db_xref="CDD:235566"
     gene            complement(290968..291612)
                     /locus_tag="BT0276"
                     /db_xref="GeneID:4642747"
     CDS             complement(290968..291612)
                     /locus_tag="BT0276"
                     /note="possible structural component of the flagellum that
                     anchors the rod to the membrane"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliZ"
                     /protein_id="YP_945284.1"
                     /db_xref="GI:119953075"
                     /db_xref="GeneID:4642747"
                     /translation="MSRLTLFKFVFLIIFIFFFKNLFAQENGVDLDISSSSLENEVNL
                     PIFEGDKANLNNKDIQNISLFNISDLVTIFLFFLFFLICIFLFKKMILNHKKVKNSYK
                     SNFIRELAFYEIDNKNSVRVINILGNVYVFLVSSNSSILLREIKQGEELDNLKFELDK
                     AKSLSDITSFKSIFNKILRKNKKDELSFDKTEYAALENDIETSLKSKQDRLKKF"
     misc_feature    complement(290971..291543)
                     /locus_tag="BT0276"
                     /note="flagellar biosynthesis protein FliZ; Provisional;
                     Region: PRK13414"
                     /db_xref="CDD:139556"
     gene            complement(291605..291949)
                     /locus_tag="BT0277"
                     /db_xref="GeneID:4642736"
     CDS             complement(291605..291949)
                     /locus_tag="BT0277"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="YP_945285.1"
                     /db_xref="GI:119953076"
                     /db_xref="GeneID:4642736"
                     /translation="MAIDDKSDIGEEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVS
                     MQVTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKVIAKGEVVVIDENFG
                     VRITEIIKIKNE"
     misc_feature    complement(291626..>291886)
                     /locus_tag="BT0277"
                     /note="Flagellar motor switch/type III secretory pathway
                     protein [Cell motility and secretion / Intracellular
                     trafficking and secretion]; Region: FliN; COG1886"
                     /db_xref="CDD:224798"
     gene            complement(291999..293057)
                     /gene="fliM"
                     /locus_tag="BT0278"
                     /db_xref="GeneID:4642201"
     CDS             complement(291999..293057)
                     /gene="fliM"
                     /locus_tag="BT0278"
                     /note="with FliG and FliN makes up the switch complex
                     which is involved in switching the direction of the
                     flagella rotation"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="YP_945286.1"
                     /db_xref="GI:119953077"
                     /db_xref="GeneID:4642201"
                     /translation="MAGNPGALSQDDIDSLLESINSSDNLSSDDSLSNIISSPMGKKQ
                     KIKVYDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEE
                     FIRSIPNPTTLAIINMDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTIKDKSRDLTEIE
                     QSVMESVIIRILANMREAWSQVVDLRPRFGHIEVNPQFAQIVPPTEMVILVTLEVKIG
                     KVEGLMNFCLPYITIEPIVSKLSTRYWHSLIGVGTTSENLDILREKLENTDMLLVAEI
                     GEVKLKVREILSLAKGDVLNLENSPIDKDLILKVGTKQKFKCRMGLVGNKISVQVTEK
                     VGEVEDFDLLKELTEEVE"
     misc_feature    complement(292029..293036)
                     /gene="fliM"
                     /locus_tag="BT0278"
                     /note="flagellar motor switch protein FliM; Validated;
                     Region: fliM; PRK06666"
                     /db_xref="CDD:235849"
     misc_feature    complement(292053..292271)
                     /gene="fliM"
                     /locus_tag="BT0278"
                     /note="Surface presentation of antigens (SPOA); Region:
                     SpoA; pfam01052"
                     /db_xref="CDD:250325"
     gene            complement(293077..293610)
                     /gene="fliL"
                     /locus_tag="BT0279"
                     /db_xref="GeneID:4642716"
     CDS             complement(293077..293610)
                     /gene="fliL"
                     /locus_tag="BT0279"
                     /note="interacts with the cytoplasmic MS ring of the basal
                     body and may act to stabilize the MotAB complexes which
                     surround the MS ring"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body-associated protein FliL"
                     /protein_id="YP_945287.1"
                     /db_xref="GI:119953078"
                     /db_xref="GeneID:4642716"
                     /translation="MPERDDGSIDVGGADSKRMGLLPDVIIKILQILAIGLFTVVIMI
                     IVAYFVSKMVVSQSGAPNNFPIFSNEYLGKPPMLIWYESIDEIRGTTQDTPPKTFVIK
                     LALGYAENNVNILSELGRQKVRLKDIIREYFSQRTGQEIKNESQIKAEIKARINSILR
                     NGEIKEIALTQIDIFDM"
     misc_feature    complement(293080..293610)
                     /gene="fliL"
                     /locus_tag="BT0279"
                     /note="flagellar basal body-associated protein FliL;
                     Reviewed; Region: fliL; PRK06654"
                     /db_xref="CDD:235846"
     gene            complement(293652..294440)
                     /gene="motB"
                     /locus_tag="BT0280"
                     /db_xref="GeneID:4642523"
     CDS             complement(293652..294440)
                     /gene="motB"
                     /locus_tag="BT0280"
                     /note="with MotA forms the ion channels that couple
                     flagellar rotation to proton/sodium motive force across
                     the membrane and forms the stator elements of the rotary
                     flagellar machine"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="YP_945288.1"
                     /db_xref="GI:119953079"
                     /db_xref="GeneID:4642523"
                     /translation="MMSLRDRKKRSKCAEGTPEYMLTYGDMVTLLLVFFVTMFSLNDI
                     ILKENVLKIMSASFTGSGFFKGGKTLDINKLSYLSNSFMSLPSTEKNKQASQASKNKS
                     IIEFIEKIQSNRVIVRHYERGVVVSLLADAFFDSASAEVKLDDNRETIQKIASFIGFL
                     DNQGYNFKIEGHTDNVDVNINGIWKSNWELSSARAVNMLEQILNYTDQSKIQSIESKF
                     EVSGFAGSRPVATDDTPEGRAYNRRIDILITSDASLSSTKGINH"
     misc_feature    complement(293658..294431)
                     /gene="motB"
                     /locus_tag="BT0280"
                     /note="flagellar motor protein MotB; Validated; Region:
                     motB; PRK06667"
                     /db_xref="CDD:180652"
     misc_feature    complement(294258..294428)
                     /gene="motB"
                     /locus_tag="BT0280"
                     /note="Membrane MotB of proton-channel complex MotA/MotB;
                     Region: MotB_plug; pfam13677"
                     /db_xref="CDD:257982"
     misc_feature    complement(293697..294044)
                     /gene="motB"
                     /locus_tag="BT0280"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    complement(order(293715..293717,293727..293729,
                     293871..293873,293880..293885,293895..293897,
                     293919..293924,294030..294035))
                     /gene="motB"
                     /locus_tag="BT0280"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(294437..295222)
                     /locus_tag="BT0281"
                     /db_xref="GeneID:4642826"
     CDS             complement(294437..295222)
                     /locus_tag="BT0281"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis MotA protein"
                     /protein_id="YP_945289.1"
                     /db_xref="GI:119953080"
                     /db_xref="GeneID:4642826"
                     /translation="MNLASIVGWGVGFGAILISMAFTPTGLGVFWDLSSVFITVVGSF
                     SALVASSEIPTVKRIPTYLGLFFKKSSFGKVFIIKTLVELSEKARKEGLLSLDDELDQ
                     INDPFFKSGMRLVVDGADPEIIRTMLYLELDQMQERHKIGADLFGTWAKLAPAFGMTG
                     TLIGLIALLGNLEDRSALGSSMAVALITTLYGTIMANLMLLPIQIKLESIDIEEASVK
                     TMIVEGILSIQAGDNPRILEQKLVTFLTPKDRSQLGSGILGGE"
     misc_feature    complement(294473..295222)
                     /locus_tag="BT0281"
                     /note="Flagellar motor component [Cell motility and
                     secretion]; Region: MotA; COG1291"
                     /db_xref="CDD:224210"
     gene            complement(295219..295440)
                     /locus_tag="BT0282"
                     /db_xref="GeneID:4642822"
     CDS             complement(295219..295440)
                     /locus_tag="BT0282"
                     /codon_start=1
                     /transl_table=11
                     /product="motility protein"
                     /protein_id="YP_945290.1"
                     /db_xref="GI:119953081"
                     /db_xref="GeneID:4642822"
                     /translation="MIYVTKLNGDGYYLNPCHIESIEANPDTTILLMNGKKLIVKEDV
                     VEVVDKIKMCRREIALLDRIIQENKGVEL"
     misc_feature    complement(295258..295440)
                     /locus_tag="BT0282"
                     /note="Flagellar protein (FlbD); Region: FlbD; cl00683"
                     /db_xref="CDD:242026"
     gene            complement(295458..296786)
                     /gene="flgE"
                     /locus_tag="BT0283"
                     /db_xref="GeneID:4642606"
     CDS             complement(295458..296786)
                     /gene="flgE"
                     /locus_tag="BT0283"
                     /note="the hook connects flagellar basal body to the
                     flagellar filament"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FlgE"
                     /protein_id="YP_945291.1"
                     /db_xref="GI:119953082"
                     /db_xref="GeneID:4642606"
                     /translation="MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDM
                     ISQSISGASRPTDGRGGVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFF
                     ILRDGNNSFYTRAGAFDVDSNRCLVNPANGMRIQGWMAKSIGGEQVINTSADVEDLVI
                     PIGDKESAKATEHITFACNLDKRLPIIEEGASEVDVARGTWVVNKTIYDSFGNTSVVE
                     LRVVKDTTTPNLWNATVLVNGETNSNFTIGFNNEGALLSLNGQAGQPGDLLEFPITFG
                     VVNANAGEVGEQQTINLRLGNVGSYTDSITQFADASTTKAIIQDGYGMGYMENYEIDQ
                     NGIIMGVYSNGIRRDIGKIALASFVNPGGLAKVGDTNFSETSNSGQARIGETGLAGLG
                     TIRAGVLEMANVDLAEQFTDMIVTQRGFQANAKTITTSDQLLQELVRLKN"
     misc_feature    complement(295464..296780)
                     /gene="flgE"
                     /locus_tag="BT0283"
                     /note="flagellar hook protein FlgE; Validated; Region:
                     flgE; PRK05682"
                     /db_xref="CDD:235557"
     misc_feature    complement(296682..296774)
                     /gene="flgE"
                     /locus_tag="BT0283"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    complement(295821..296204)
                     /gene="flgE"
                     /locus_tag="BT0283"
                     /note="Flagellar basal body protein FlaE; Region: FlaE;
                     pfam07559"
                     /db_xref="CDD:254288"
     misc_feature    complement(295467..295700)
                     /gene="flgE"
                     /locus_tag="BT0283"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            complement(296791..297225)
                     /gene="flgD"
                     /locus_tag="BT0284"
                     /db_xref="GeneID:4642702"
     CDS             complement(296791..297225)
                     /gene="flgD"
                     /locus_tag="BT0284"
                     /note="acts as a scaffold for the assembly of hook
                     proteins onto the flagellar basal body rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod modification protein"
                     /protein_id="YP_945292.1"
                     /db_xref="GI:119953083"
                     /db_xref="GeneID:4642702"
                     /translation="MGRVDYIDNLVGIGRAKEISNSKVQRGVKGNNLGRDDFLKLLIT
                     QLKYQDPTDPMKDKEFIAQMAQFSALEQMTNMSKSFESLSSVLGINKDLDLLGKIVEF
                     EHVDGEIIKGKVTNIKTGIVPQIMIDGKYYVYNNILSVGLEE"
     misc_feature    complement(296794..297219)
                     /gene="flgD"
                     /locus_tag="BT0284"
                     /note="flagellar basal body rod modification protein;
                     Provisional; Region: flgD; PRK09618"
                     /db_xref="CDD:236594"
     misc_feature    complement(296977..>297141)
                     /gene="flgD"
                     /locus_tag="BT0284"
                     /note="Flagellar hook capping protein - N-terminal region;
                     Region: FlgD; pfam03963"
                     /db_xref="CDD:252280"
     gene            complement(297238..298407)
                     /locus_tag="BT0285"
                     /db_xref="GeneID:4642888"
     CDS             complement(297238..298407)
                     /locus_tag="BT0285"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-length control protein"
                     /protein_id="YP_945293.1"
                     /db_xref="GI:119953084"
                     /db_xref="GeneID:4642888"
                     /translation="MDNVSKIIVSLPSLNKDFNFVNVGGIFSQAKKGVFSDLISSEIQ
                     NLSKFRDSILDFLKFLKSNGLISKDFKNISLKKPFAFEKFSDNGFVSDLKSLIKKVNN
                     LFDFDSLKVLSESLSFDSELSDKIKILKNFEKVLSDLNILFDNVTSLFNFDVLSVDLN
                     SNHRDLNIVKREREKNVIGIDVKNFKKNDSVKEFFNSGFRFRLIDSENCVRKYGLKET
                     FDGLTESIGDLSSFNAKPVKGSFIGHIADNLMSEWNLKINHNIVNKAKIVLKSNDTGE
                     IRLILKPKRLGSIRINLNLDSNNNLLGKIIVDNHNVRTLFEQNMYSISKMLNDNGFNT
                     SLNLSLAGSGSGFFSGNFEDDVESQSSSLNKNNIFKIEDNVEISGDLEKSINFIV"
     misc_feature    complement(297382..297618)
                     /locus_tag="BT0285"
                     /note="Flagellar hook-length control protein FliK; Region:
                     Flg_hook; pfam02120"
                     /db_xref="CDD:251099"
     gene            complement(298411..299025)
                     /locus_tag="BT0286"
                     /db_xref="GeneID:4642624"
     CDS             complement(298411..299025)
                     /locus_tag="BT0286"
                     /codon_start=1
                     /transl_table=11
                     /product="FlbB protein"
                     /protein_id="YP_945294.1"
                     /db_xref="GI:119953085"
                     /db_xref="GeneID:4642624"
                     /translation="MNDCLSFLLRFFLWLFLVIFFLVFSFFLVDLFGIYQTRDYLPVY
                     IRALLFKGDAQPPEYTHISLEEIRMIKEKEAIYIKGQQVEKLREELKKREDSLNKLEA
                     ELNQKQKDLDLKQKVIDDIVNKYKDEDANFAQAALYLINMPPKDAVKRLEELNDEIAI
                     SYMRKVEDIAKKEGRASIVPYWLSLMDSKKAAVLIRKMSVSSLE"
     misc_feature    complement(298429..>298785)
                     /locus_tag="BT0286"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3334"
                     /db_xref="CDD:225871"
     gene            complement(299022..299450)
                     /locus_tag="BT0287"
                     /db_xref="GeneID:4642183"
     CDS             complement(299022..299450)
                     /locus_tag="BT0287"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein"
                     /protein_id="YP_945295.1"
                     /db_xref="GI:119953086"
                     /db_xref="GeneID:4642183"
                     /translation="MNDLIFKKKIFEKILSIRTYDRKSSENALVNVNNKISKIEEFLE
                     GISAGLNKLNNMDVFSKGNYLDYLTYRKGKELKKLEKLKHEYDKYHDIYLKKYGEEKK
                     VDILIKTLNDTIIKEKVKSESLFLDEYVNYRICKKLGNNQ"
     gene            complement(299447..300757)
                     /locus_tag="BT0288"
                     /db_xref="GeneID:4642701"
     CDS             complement(299447..300757)
                     /locus_tag="BT0288"
                     /EC_number="3.6.3.14"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellum-specific ATP synthase"
                     /protein_id="YP_945296.1"
                     /db_xref="GI:119953087"
                     /db_xref="GeneID:4642701"
                     /translation="MMDIFFEGYSKMLDDVEPISLIGKVRKIKGLLVESLGPKCGIGD
                     LCLIEQRSGKKIYAEVLGLNGSFVNLMAYEGFDGIEIGDQVCSLGKKLQINLSDELLG
                     RVIDSLGRPIDNKGQFFCNYYKELSFSNINPLSRGVFSEQIVTGVKVLDGFLPVAKGQ
                     RVGIFSGAGVGKSTLLGMIAKNSKADVNVIAFIGERGRELNEFIKYDLGEECFKRSVL
                     IVSTSDASPIARYKGAYTATLIAEYFRDCGMDVMLLFDSITRFANAKREISLSMGEPP
                     ATKGYPPSVFVEIPILLERSGLNSKGSITGFYTVLVEGDDFTEPIADNMKAVLDGHII
                     LDRDLSDRGIYPSVNILSSTSRSLHRIVNFEKQKLISKIRNLLSIYKSYEDLIKTGIY
                     IKGSNKEVDLAVAKYPKIIDFLSQGIQEEFDFENLDSELREILA"
     misc_feature    complement(299453..300757)
                     /locus_tag="BT0288"
                     /note="ATPase FliI/YscN family; Region: fliI_yscN;
                     TIGR01026"
                     /db_xref="CDD:233237"
     misc_feature    complement(300491..300685)
                     /locus_tag="BT0288"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    complement(299510..300484)
                     /locus_tag="BT0288"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(300239..300247,300257..300262))
                     /locus_tag="BT0288"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(299987..299992,300179..300184,
                     300188..300190,300239..300247,300257..300259))
                     /locus_tag="BT0288"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(299990..300004)
                     /locus_tag="BT0288"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            complement(300771..301697)
                     /gene="fliH"
                     /locus_tag="BT0289"
                     /db_xref="GeneID:4642791"
     CDS             complement(300771..301697)
                     /gene="fliH"
                     /locus_tag="BT0289"
                     /note="binds to and inhibits the function of flagella
                     specific ATPase FliI"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein H"
                     /protein_id="YP_945297.1"
                     /db_xref="GI:119953088"
                     /db_xref="GeneID:4642791"
                     /translation="MYLPKVLYKSKEVVNAVKLEFVEITNPIFKSLEIKRKENELCDI
                     DSRSIKLRNELEDLMNQRAKLQEEIEREHEFAKKEIDAECSKILEEAKEQANKIVSFA
                     SERAEALQKEAENKKGAIEQESNLEIEKIVREHEERLKRELETEMARGRNEGYDAGFN
                     KGREDCDKILGKLNSIISSLVAKRKEILESSGEHIMNLVMQIAVKVVKKIIDSQTGIV
                     IENINEALKKVKSKTNIIIRVNLDDIDVVSHQKHEFISKFDFIKNLEVVEDVNIGKGG
                     CIIETDFGEIDARISSQLDRIEEKFKNFSSIF"
     misc_feature    complement(300774..301691)
                     /gene="fliH"
                     /locus_tag="BT0289"
                     /note="flagellar assembly protein H; Validated; Region:
                     fliH; PRK06669"
                     /db_xref="CDD:235850"
     misc_feature    complement(<301257..301529)
                     /gene="fliH"
                     /locus_tag="BT0289"
                     /note="Flagellar assembly protein FliH; Region: FliH;
                     cl19405"
                     /db_xref="CDD:267758"
     misc_feature    complement(300807..301199)
                     /gene="fliH"
                     /locus_tag="BT0289"
                     /note="Flagellar assembly protein FliH; Region: FliH;
                     pfam02108"
                     /db_xref="CDD:111047"
     gene            complement(301706..302752)
                     /gene="fliG"
                     /locus_tag="BT0290"
                     /db_xref="GeneID:4642150"
     CDS             complement(301706..302752)
                     /gene="fliG"
                     /locus_tag="BT0290"
                     /note="One of three proteins involved in switching the
                     direction of the flagellar rotation"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein G"
                     /protein_id="YP_945298.1"
                     /db_xref="GI:119953089"
                     /db_xref="GeneID:4642150"
                     /translation="MIIYMEEQKEKEILGVSTLTGKQKAAILLVSIGSEISSKIFKYL
                     SQEEIESLTFEIARLDVVTSDLKDSVLLEFKELMMAQEFIQKGGIDYARELLEKSLGT
                     QKAVDIINNLGSALQSRPFEFVRRADPANILNFIQQEHPQTIALILSYLDPQKASFIL
                     SSLPTEIQTNVARRIALMDRTSPEVVREVERVLEKKLASLSSEDYTSAGGVDNVVEII
                     NMADRKTEKFIIESLEEEDPELAEEIKKKMFVFEDIVLLDDRSIQRILREIDGQELAK
                     ALKSVDAPVQDKIFKNMSKRAAGMLKEDMEFLGPTRRKDVEEAQQKIVSLIRKLEEQG
                     EIVISRGGEEDVLV"
     misc_feature    complement(301709..302707)
                     /gene="fliG"
                     /locus_tag="BT0290"
                     /note="flagellar motor switch protein FliG; Region: fliG;
                     TIGR00207"
                     /db_xref="CDD:232874"
     misc_feature    complement(302387..302704)
                     /gene="fliG"
                     /locus_tag="BT0290"
                     /note="FliG N-terminal domain; Region: FliG_N; pfam14842"
                     /db_xref="CDD:258979"
     misc_feature    complement(302132..302371)
                     /gene="fliG"
                     /locus_tag="BT0290"
                     /note="FliG middle domain; Region: FliG_M; pfam14841"
                     /db_xref="CDD:258978"
     misc_feature    complement(301739..302065)
                     /gene="fliG"
                     /locus_tag="BT0290"
                     /note="FliG C-terminal domain; Region: FliG_C; pfam01706"
                     /db_xref="CDD:190075"
     gene            complement(302756..304462)
                     /gene="fliF"
                     /locus_tag="BT0291"
                     /db_xref="GeneID:4642465"
     CDS             complement(302756..304462)
                     /gene="fliF"
                     /locus_tag="BT0291"
                     /note="the MS-ring anchors the flagellum to the
                     cytoplasmic membrane; part of the flagellar basal body
                     which consists of four rings L, P, S, and M mounted on a
                     central rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar MS-ring protein"
                     /protein_id="YP_945299.1"
                     /db_xref="GI:119953090"
                     /db_xref="GeneID:4642465"
                     /translation="MNNFITKFFASVNKKFQKASMVQKVAFGVIALFIILAFIFLIGF
                     STKKQGVALFGVGIKDQYLLDRIVQRLDRESVEYIITADGKIYLSDENMSKKMRAILV
                     REELVPVHMDPWSLFDIDRWTITDFERNVNLRRSITRAVEQHIVALDDVDAVSINLVM
                     PEKALFKESQEAVKASVRITPKPGSDIVTNRKKVEGLVKLIQYAIEGLESDNIAIVDN
                     KGTVLNDFSNLDGIDRIDLAEKERKLKLKYESMLRDEIDSALSKVLSVDRFMIARVNV
                     TLDTSRQTTESKEYAPIEIEPQDPKVSYNTRKVSDSTLLSSQVHKREYEGQGYSPWGP
                     PGQEGNTPPEYRDLSDIIGKSNEFKEIKNVALNEKKSLNEKEPARIAGISLGIFIDGV
                     WDFVYDESGNFIIENGMRKREYKPISDEALKNITDVLQSSFEYKPERGDSIAIRNVAF
                     DRVNEFRKIDEDYFSTEKFKFLIFTVSIIFALLILIFTVFFIVSRELERRRRLREEEF
                     SRQAHLRRQQALMDSDDIGVDDVVGGIREEDELQSNAELLAREKPEDVAKLIRTWIVK
                     NV"
     misc_feature    complement(302762..304462)
                     /gene="fliF"
                     /locus_tag="BT0291"
                     /note="flagellar basal-body M-ring protein/flagellar
                     hook-basal body protein (fliF); Region: fliF; TIGR00206"
                     /db_xref="CDD:129310"
     misc_feature    complement(303788..304405)
                     /gene="fliF"
                     /locus_tag="BT0291"
                     /note="Secretory protein of YscJ/FliF family; Region:
                     YscJ_FliF; cl01907"
                     /db_xref="CDD:261111"
     misc_feature    complement(303113..303685)
                     /gene="fliF"
                     /locus_tag="BT0291"
                     /note="Flagellar M-ring protein C-terminal; Region:
                     YscJ_FliF_C; pfam08345"
                     /db_xref="CDD:254746"
     gene            complement(304476..304805)
                     /gene="fliE"
                     /locus_tag="BT0292"
                     /db_xref="GeneID:4642680"
     CDS             complement(304476..304805)
                     /gene="fliE"
                     /locus_tag="BT0292"
                     /note="forms a junction between the M-ring and FlgB during
                     flagella biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body protein FliE"
                     /protein_id="YP_945300.1"
                     /db_xref="GI:119953091"
                     /db_xref="GeneID:4642680"
                     /translation="MEVDSFFTDNNVYLVRKNPLHFDKSFSVFDVKREVKAESFKDLF
                     LNLISDVNNSQLDVSRMSQQAILQPNSVDVHDITIAMAKANMNLSITKAVVERSIKAY
                     QDVINIR"
     misc_feature    complement(304479..304799)
                     /gene="fliE"
                     /locus_tag="BT0292"
                     /note="flagellar hook-basal body protein FliE; Reviewed;
                     Region: fliE; PRK01482"
                     /db_xref="CDD:134562"
     gene            complement(304821..305279)
                     /gene="flgC"
                     /locus_tag="BT0293"
                     /db_xref="GeneID:4642692"
     CDS             complement(304821..305279)
                     /gene="flgC"
                     /locus_tag="BT0293"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="YP_945301.1"
                     /db_xref="GI:119953092"
                     /db_xref="GeneID:4642692"
                     /translation="MGLFSSINTAATGLTAQRLRLDVIANNIANVETTRTSEGGSYRR
                     QRIVFSPRVVSPYWKGPFVPDYLDNGIGQGVRVAGIERDKSPLKLKYDPTHPDAIKSG
                     ERKGYVEFPNVNAVEEMVDMISASRAYEANSTVINSSKAIFRSALSILQN"
     misc_feature    complement(304824..305279)
                     /gene="flgC"
                     /locus_tag="BT0293"
                     /note="flagellar basal body rod protein FlgC; Reviewed;
                     Region: flgC; PRK05681"
                     /db_xref="CDD:235556"
     misc_feature    complement(304863..305276)
                     /gene="flgC"
                     /locus_tag="BT0293"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; cl19173"
                     /db_xref="CDD:267526"
     misc_feature    complement(305175..305261)
                     /gene="flgC"
                     /locus_tag="BT0293"
                     /note="Flagella basal body rod protein; Region:
                     Flg_bb_rod; pfam00460"
                     /db_xref="CDD:109515"
     misc_feature    complement(304833..>304970)
                     /gene="flgC"
                     /locus_tag="BT0293"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            complement(305305..305718)
                     /gene="flgB"
                     /locus_tag="BT0294"
                     /db_xref="GeneID:4642640"
     CDS             complement(305305..305718)
                     /gene="flgB"
                     /locus_tag="BT0294"
                     /note="with FlgF and C makes up the proximal portion of
                     the flagellar basal body rod"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="YP_945302.1"
                     /db_xref="GI:119953093"
                     /db_xref="GeneID:4642640"
                     /translation="MSLNIFDRSIDLAHRYLDVLSLRQSVIADNVANVDTPNFKRSKV
                     TFESELERAIFNEGASSLSLRRGNGKHLDGFKELGYLDVKPRRMLDYLSTLNNNGNNV
                     DIDSEMKNLAQNQMMYSLFTNIQAHHFKSVNIVIK"
     misc_feature    complement(305308..305712)
                     /gene="flgB"
                     /locus_tag="BT0294"
                     /note="flagellar basal body rod protein FlgB; Provisional;
                     Region: flgB; PRK12622"
                     /db_xref="CDD:183629"
     misc_feature    complement(305308..305703)
                     /gene="flgB"
                     /locus_tag="BT0294"
                     /note="flagellar basal-body rod protein FlgB; Region:
                     FlgB; TIGR01396"
                     /db_xref="CDD:233395"
     gene            complement(305746..307101)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /db_xref="GeneID:4642621"
     CDS             complement(305746..307101)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease ATP-binding subunit HslU"
                     /protein_id="YP_945303.1"
                     /db_xref="GI:119953094"
                     /db_xref="GeneID:4642621"
                     /translation="MMDKTENQNIVPKEIVAELDKYIIGQVEAKKLVSIALVNRYIRS
                     KLPKEIRDDVMPKNIIMVGSTGIGKTEIARRLSKFIKAPFIKVEATKYTEVGYVGRDV
                     ESMIRDLMSIAVNMVREEMYDSVREEASKRAEERIIDKLLKTSEGSENDNTSEEERKI
                     RDKLRNKFRKQLRSGDIDDNLIDIYVSGKMPVSTIEIFSGSNFEEIDMSIGGLINNIF
                     DRKKRRELKIKKAREIIISEELEKLVDHENIVEVAKSRVENMGIVFIDEIDKIVTKNR
                     TGNDISREGVQRDILPIVEGSKVNTKYGIVDTSHILFIAAGAFNLSKPSDLIPELQGR
                     FPIKVELKSLSVNDFKNILKHTKNSLIKQYIAMFKVYNLTLTFSEEAIDRIAELAFDM
                     NYEGENLGARRLHGVMEKILADLFFEAPGSKLKKFEINLDYVNEKIKINEQKDLNYYI
                     I"
     misc_feature    complement(305752..307101)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="ATP-dependent protease ATP-binding subunit HslU;
                     Provisional; Region: hslU; PRK05201"
                     /db_xref="CDD:235364"
     misc_feature    complement(<306754..306960)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(306892..306915)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(306889..306912)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(<306568..>306711)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="UPF0278 family; Region: UPF0278; cl17319"
                     /db_xref="CDD:247873"
     misc_feature    complement(306091..306465)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cl18944"
                     /db_xref="CDD:267297"
     misc_feature    complement(306301..306318)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(306100..306102)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(305782..306072)
                     /gene="hslU"
                     /locus_tag="BT0295"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; smart01086"
                     /db_xref="CDD:198154"
     gene            complement(307098..307640)
                     /locus_tag="BT0296"
                     /db_xref="GeneID:4642581"
     CDS             complement(307098..307640)
                     /locus_tag="BT0296"
                     /EC_number="3.4.25.1"
                     /note="heat shock protein involved in degradation of
                     misfolded proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease peptidase subunit"
                     /protein_id="YP_945304.1"
                     /db_xref="GI:119953095"
                     /db_xref="GeneID:4642581"
                     /translation="MSFKGTTVIAIRRGGKTVVAADGQVTFGYTVLKSNAIKIRKLFN
                     GKILAGFAGSTSDAITLFEKFEEKVKAREDGIIDIKRAAVELAKDWRSDKILHKLEAM
                     MLVADSENILLISGTGDVVEPEEDVISIGSGGNYAYSAALAYMENKKLSAADIAFKSL
                     KVAARVCIYTNSNIVLEEIS"
     misc_feature    complement(307104..307625)
                     /locus_tag="BT0296"
                     /note="Protease HslV and the ATPase/chaperone HslU are
                     part of an ATP-dependent proteolytic system that is the
                     prokaryotic homolog of the proteasome. HslV is a dimer of
                     hexamers (a dodecamer) that forms a central proteolytic
                     chamber with active sites on the...; Region:
                     protease_HslV; cd01913"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(307245..307247,307527..307529,
                     307569..307571,307575..307577,307623..307625))
                     /locus_tag="BT0296"
                     /note="active site"
                     /db_xref="CDD:238894"
     misc_feature    complement(order(307137..307139,307143..307148,
                     307155..307157,307167..307169,307200..307202,
                     307224..307226,307233..307238,307275..307277,
                     307287..307289,307368..307370,307548..307556))
                     /locus_tag="BT0296"
                     /note="HslU subunit interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238894"
     gene            complement(307652..308596)
                     /locus_tag="BT0297"
                     /db_xref="GeneID:4642556"
     CDS             complement(307652..308596)
                     /locus_tag="BT0297"
                     /codon_start=1
                     /transl_table=11
                     /product="Smf protein"
                     /protein_id="YP_945305.1"
                     /db_xref="GI:119953096"
                     /db_xref="GeneID:4642556"
                     /translation="MFKLLYVDNLRFLKGEEKLRIFNDFDLSCLCKLSLRDISNYLSR
                     VFRRDYKLPDLKLIEMQQKIINKTSARIAVFGSKDYPLKLKRIYNPPFAIYYKGNLPD
                     SNSLSWAVVGSRQISRVLADKIKELSSHLAKNHVEIISGFAIGADIAAHFGAMNEKKR
                     TYAVIATDIDNIYPKQNRKYVACLLENGGGVLTETLPYEKIQNYFFAKRNRIVAGLSD
                     VVFITCAPRKSGALITAELGLDLGLDVYVYNIDYSGDGSRVLYDSGAQEIKSVSDLYK
                     ILNVQYNEPEISDNSKVCCICKDTSSMLINKLLNEISK"
     misc_feature    complement(307760..308590)
                     /locus_tag="BT0297"
                     /note="Predicted Rossmann fold nucleotide-binding protein
                     involved in DNA uptake [DNA replication, recombination,
                     and repair / Intracellular trafficking and secretion];
                     Region: Smf; COG0758"
                     /db_xref="CDD:223829"
     misc_feature    complement(307763..308410)
                     /locus_tag="BT0297"
                     /note="DNA protecting protein DprA; Region: dprA;
                     TIGR00732"
                     /db_xref="CDD:129815"
     gene            complement(308602..309291)
                     /locus_tag="BT0298"
                     /db_xref="GeneID:4642548"
     CDS             complement(308602..309291)
                     /locus_tag="BT0298"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945306.1"
                     /db_xref="GI:119953097"
                     /db_xref="GeneID:4642548"
                     /translation="MKRWIPIFLFLVISCGDESKEKVNLGLRIREIEIAGGGSLEKIE
                     VYKEFIDKEEQNILKIINSIDKKARFFSLIGLELIRLGQYGPAIEYLNKNLEYGPDNH
                     LSHFYIGVSSYNLAKGIETKEKVREYFILAEGSFLKSISIKDDFKEAIFALSTMYVYD
                     LDKQLEAKGYLSRLESMGEDYFEFFMLRGANYYSLGDFDNALLFYKKAKDKALTQEQI
                     DGVDRIMNNFK"
     misc_feature    complement(308668..308916)
                     /locus_tag="BT0298"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(308668..308670,308677..308679,
                     308689..308691,308725..308727,308770..308772,
                     308779..308781,308791..308793,308830..308832,
                     308875..308877,308884..308886,308896..308898))
                     /locus_tag="BT0298"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(308707..308712,308719..308724,
                     308731..308736,308812..308817,308827..308832,
                     308836..308841))
                     /locus_tag="BT0298"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(309292..310533)
                     /locus_tag="BT0299"
                     /db_xref="GeneID:4642488"
     CDS             complement(309292..310533)
                     /locus_tag="BT0299"
                     /note="GTPase; similar structure to tubulin; forms
                     ring-shaped polymers at the site of cell division; other
                     proteins such as FtsA, ZipA, and ZapA, interact with and
                     regulate FtsZ function"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="YP_945307.1"
                     /db_xref="GI:119953098"
                     /db_xref="GeneID:4642488"
                     /translation="MVFERVVLTSHGGSLMKDYNIIDSHSKRFDSATNPTVLKVIGAG
                     GGGSNAVNRMIEYGVRDVEFIVANTDLQALQTSIAPIKIALGAKVTSGLGAGGRPEIG
                     QAAAEEDIDIIKNHLAGADMVFITAGMGGGTGTGAAPVIAQVAKELGILTVGVVTKPF
                     KFEGPKKMRLAEQGINNLRKSVDTLIIIPNQKLLTVVDKRTTIKDAFKRADDVLRMGV
                     QGIAGLIIEHGEVNIDFADVKSIMQGQGDALMGIGYGKGENRAVDAATSAISNPLLEE
                     VRIEGSKGLLVNITGGEDFSLLELEEIMGIITASVDDEATVIYGHAINSNLDDEIYVT
                     VVATGFSSKKQKDLSGAVENNTLSSKEFDSLMSGSQDVSGSVYEANDNFIAKSKNVNY
                     FEDDIDVPTFLRNLNKKNSDN"
     misc_feature    complement(309310..310446)
                     /locus_tag="BT0299"
                     /note="cell division protein FtsZ; Validated; Region:
                     PRK09330"
                     /db_xref="CDD:236468"
     misc_feature    complement(309517..310428)
                     /locus_tag="BT0299"
                     /note="FtsZ is a GTPase that is similar to the eukaryotic
                     tubulins and is essential for cell division in
                     prokaryotes.  FtsZ is capable of polymerizing in a
                     GTP-driven process into structures similar to those formed
                     by tubulin. FtsZ forms a ring-shaped septum at...; Region:
                     FtsZ_type1; cd02201"
                     /db_xref="CDD:100021"
     misc_feature    complement(order(309892..309894,309901..309906,
                     309913..309915,309964..309966,310033..310035,
                     310054..310059,310132..310152,310315..310317,
                     310387..310389,310396..310404))
                     /locus_tag="BT0299"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100021"
     misc_feature    complement(order(309634..309636,309643..309654,
                     309832..309834,309838..309843))
                     /locus_tag="BT0299"
                     /note="SulA interaction site; other site"
                     /db_xref="CDD:100021"
     gene            complement(310509..311750)
                     /locus_tag="BT0300"
                     /db_xref="GeneID:4642870"
     CDS             complement(310509..311750)
                     /locus_tag="BT0300"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="YP_945308.1"
                     /db_xref="GI:119953099"
                     /db_xref="GeneID:4642870"
                     /translation="MSRDLIVGLDVGTSKICTVVAEVNLNNQLEIVGIGTSVSRGVRK
                     GVLINIEAALDSISSSIEAAELISGCDISALSVSMSGSSIEGTNSRGVVAINSKTREI
                     DNEDVERVIEAAKAIVIPMDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIIT
                     GSSSSSQNLVRCVNRAGFSVDEVVLGSLASSYATLSKEEREMGVLFVDMGKGTTDIIL
                     YIDGSPYYTGVIPIGANRVTLDIAQVWKVPEDIAENIKITAGVAHISALESQVESVII
                     PNLGTRPPQEKSRKELAIIINSRLSEIFEMIKAEIMKRGLYNKINGGIVLTGGGSLFP
                     GISNLTEEIFKYPSRIGFPMNINGVGEEYIGPKFSSALGLVLYKHEQQKFNKLKKGNN
                     KSKRQSKISSKLKGWFLKEWF"
     misc_feature    complement(310620..311738)
                     /locus_tag="BT0300"
                     /note="cell division protein FtsA; Region: ftsA;
                     TIGR01174"
                     /db_xref="CDD:233300"
     misc_feature    complement(311169..311735)
                     /locus_tag="BT0300"
                     /note="Cell division protein FtsA; Region: FtsA;
                     smart00842"
                     /db_xref="CDD:214850"
     misc_feature    complement(310698..311141)
                     /locus_tag="BT0300"
                     /note="Cell division protein FtsA; Region: FtsA;
                     pfam14450"
                     /db_xref="CDD:258601"
     gene            complement(311750..312493)
                     /locus_tag="BT0301"
                     /db_xref="GeneID:4642206"
     CDS             complement(311750..312493)
                     /locus_tag="BT0301"
                     /codon_start=1
                     /transl_table=11
                     /product="DivIB protein"
                     /protein_id="YP_945309.1"
                     /db_xref="GI:119953100"
                     /db_xref="GeneID:4642206"
                     /translation="MLIYRKFLIIYIYVIISLILLEIVFIIFISPYFLIRYINFNDSI
                     HISKEEILSISGIKPNTYYYDADVSAYEKNIMRDRRVKNVTVKLKFPNTISINIERRV
                     PIVTAYENVDGSFIYYFIASDGLILEKCKDLIYDLPIVSGLNLNGNEVGDFLEDRMLA
                     IIKNLNYVKINQNTLYNLISEINFLKLNFYDYKIFLYIKNIYNKILITTDMDLISVMH
                     KVFMISDLLKGRSDTVDLRSGNIILLGED"
     misc_feature    complement(311774..312481)
                     /locus_tag="BT0301"
                     /note="Cell division septal protein [Cell envelope
                     biogenesis, outer membrane]; Region: FtsQ; COG1589"
                     /db_xref="CDD:224505"
     misc_feature    complement(312191..312391)
                     /locus_tag="BT0301"
                     /note="POTRA domain, FtsQ-type; Region: POTRA_1;
                     pfam08478"
                     /db_xref="CDD:254821"
     gene            complement(312533..313636)
                     /locus_tag="BT0302"
                     /db_xref="GeneID:4642205"
     CDS             complement(312533..313636)
                     /locus_tag="BT0302"
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="YP_945310.1"
                     /db_xref="GI:119953101"
                     /db_xref="GeneID:4642205"
                     /translation="MIFMFVERTSLRKCYLLVLWSLIAYGLVVFYTSSFFLSLELTGE
                     PNFLFLMRLKYLFLSFIVFFVFERISLDFLKKIVSIILLVTFTLVLATFFSPSVSGTQ
                     RWIFLKGVSIQPSEIFKVSFTIYLASYLSRFRLKSDNNISYWIKPMLIFGIFWLLIIL
                     QNDYSTAIYFAMLFFIVLFVSGMSLGYVFAILFTFVPIAMLFLIFEPYRVARIFAFLN
                     PYDDPLGKGYQIIASLNAFKSGGLGGRGLGMGEVKLGRLPEANSDFIFSVLGEELGFF
                     GICLAIVLFFLLFYFGYFVALFAKTRFRFFIAFIASLTIFLQSIMNILIAIGLLPPTG
                     INLPFFSSGGSSIVVTMALSGLISNVSRDVEGE"
     misc_feature    complement(312551..313603)
                     /locus_tag="BT0302"
                     /note="cell division protein FtsW; Region: ftsW;
                     TIGR02614"
                     /db_xref="CDD:233951"
     gene            complement(313644..314699)
                     /gene="mraY"
                     /locus_tag="BT0303"
                     /db_xref="GeneID:4642777"
     CDS             complement(313644..314699)
                     /gene="mraY"
                     /locus_tag="BT0303"
                     /EC_number="2.7.8.13"
                     /note="First step of the lipid cycle reactions in the
                     biosynthesis of the cell wall peptidoglycan"
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="YP_945311.1"
                     /db_xref="GI:119953102"
                     /db_xref="GeneID:4642777"
                     /translation="MFCLLGLRLLKYITFRTAYATIFAFLLALIFGPFIILRLKKLKL
                     DQILRKDGPKRHLSEKIGIPTMGGILIFFCVLVSLFFWIDFWNIYFLIILFVMVSFAC
                     LGFMDDLLKIKRKNSDGLNPRFKIYGQILFSCISVTMLYYFGDEHVSIIYFPFFKSLK
                     LDLGVLYIPFGMFILISASNSFNLTDGLDGLAIGLSIVVTGALVIIAYLASRVDFAFY
                     LNIPNIKGAEELVVFLGALLGGSFGFLWFNAYPAKIMMGDTGSLSIGAVLGMTALILK
                     SEILFAILAGVFVVETLSVIIQVVVYKHTKKRVFKMAPLHHHFEELGWSEMQVVIRFW
                     IIGLIFAIIALSTLKIR"
     misc_feature    complement(313659..314546)
                     /gene="mraY"
                     /locus_tag="BT0303"
                     /note="Phospho-N-acetylmuramoyl-pentapeptide-transferase
                     (mraY) is an enzyme responsible for the formation of the
                     first lipid intermediate in the synthesis of bacterial
                     cell wall peptidoglycan. It catalyzes the formation of...;
                     Region: GT_MraY; cd06852"
                     /db_xref="CDD:133462"
     misc_feature    complement(314376..314381)
                     /gene="mraY"
                     /locus_tag="BT0303"
                     /note="Mg++ binding site [ion binding]; other site"
                     /db_xref="CDD:133462"
     misc_feature    complement(313926..313937)
                     /gene="mraY"
                     /locus_tag="BT0303"
                     /note="putative catalytic motif [active]"
                     /db_xref="CDD:133462"
     misc_feature    complement(order(313746..313760,313776..313778))
                     /gene="mraY"
                     /locus_tag="BT0303"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:133462"
     gene            complement(314717..316111)
                     /locus_tag="BT0304"
                     /db_xref="GeneID:4642797"
     CDS             complement(314717..316111)
                     /locus_tag="BT0304"
                     /EC_number="6.3.2.-"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-L-
                     ornithine--D-alanyl-D-alanine ligase"
                     /protein_id="YP_945312.1"
                     /db_xref="GI:119953103"
                     /db_xref="GeneID:4642797"
                     /translation="MVHIKIEDILDSLKDIKFVGYASSMQKIVSFYSLDSREINAKNS
                     SASLYFAYKGDRVDGFSFVEYLIDIGVKCFVCSKDCESLCLEYLNRDENLVFLLTSNV
                     VILLQNLAAHFITRTSFKRIAITGSNGKTTTKEMLYSILSERYKTCKTWGNLNSDIGL
                     PLSILRTEGDEEYAVFEVGISYIGEMNLLAEILNPEIVIVTNISYAHMQAFEDLEIVT
                     AEKGKIMTKSTQMVILNESCPYHLHLRVMAKSINPGINIFYFDFHSLQIRSFAFVNDK
                     FFYDFTYKGFDYSILLPGQHNIFNAISCIHLALLLGLSENEIRNGLLHADFQKGRAEL
                     LRVKDYLILNDSYNGNLGSFMALKEMILGLEIKGKKFIILGAFKELGKFAYEVHKTAI
                     REVVLMNFDKGFLIGEEFQEVKKIENLALDNLFYFSNFENFIDYFVKNLESECFIAIK
                     GSRSNRLERILDYL"
     misc_feature    complement(315773..316027)
                     /locus_tag="BT0304"
                     /note="Mur ligase family, catalytic domain; Region:
                     Mur_ligase; pfam01225"
                     /db_xref="CDD:250458"
     misc_feature    complement(314720..316012)
                     /locus_tag="BT0304"
                     /note="UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine
                     ligase; Region: murF; TIGR01143"
                     /db_xref="CDD:233291"
     misc_feature    complement(315188..315742)
                     /locus_tag="BT0304"
                     /note="Mur ligase middle domain; Region: Mur_ligase_M;
                     pfam08245"
                     /db_xref="CDD:254689"
     misc_feature    complement(<314966..315127)
                     /locus_tag="BT0304"
                     /note="Mur ligase family, glutamate ligase domain; Region:
                     Mur_ligase_C; pfam02875"
                     /db_xref="CDD:251584"
     gene            complement(316127..316408)
                     /locus_tag="BT0305"
                     /db_xref="GeneID:4642878"
     CDS             complement(316127..316408)
                     /locus_tag="BT0305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945313.1"
                     /db_xref="GI:119953104"
                     /db_xref="GeneID:4642878"
                     /translation="MSKMGKIEVRLYFLLILILTIIICLNIYLNFRYVVKLREFEGLN
                     DEQSNIIDENLRLLTIIYELQSIDRIEELSKDYLNLEKKDNKDINVIKR"
     gene            complement(316401..317294)
                     /locus_tag="BT0306"
                     /db_xref="GeneID:4642457"
     CDS             complement(316401..317294)
                     /locus_tag="BT0306"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosyl-methyltransferase MraW"
                     /protein_id="YP_945314.1"
                     /db_xref="GI:119953105"
                     /db_xref="GeneID:4642457"
                     /translation="MGNIFHIPVLLEEIINLLEASNISDGFVFVDCTLGEGGHSSAVL
                     KKYQNINVIGIDRDDVVLNRAKESLIEFKGRVSYFNTWFDDFFSEYPLSSKINFILAD
                     LGISMFHYKMSGRGFSFFEDERLDMRLYPGAGGLSAYDIINTFDKKRLENLIYELSGE
                     RYSRRIVKSILEYRKIKKIETPRELQDIVSKAYPRIKLKINPATKTFQALRIYVNDEL
                     FRLKRSLPLWVESLSNNGVLAIVTFHSLEDKIVKEFFKGLSKDQYCILTKKPIMPRCE
                     EKRFNSASRSAKLRVIKKLYE"
     misc_feature    complement(316404..317294)
                     /locus_tag="BT0306"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cl17173"
                     /db_xref="CDD:266528"
     gene            complement(317287..318120)
                     /locus_tag="BT0307"
                     /db_xref="GeneID:4642097"
     CDS             complement(317287..318120)
                     /locus_tag="BT0307"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945315.1"
                     /db_xref="GI:119953106"
                     /db_xref="GeneID:4642097"
                     /translation="MMIIAVLFFFNFFNLYAFLEFGKDEKFDLVSDFGELRNDTLSIG
                     IKLRALDTHFSIFSNNYKILYSKNKVSEYDGSILIIFDKDLGFNLEFFGDFIYKDGKI
                     FLKNDNKVFDVVVVDHYSGHIINPLFVIKNRNNLNINSSFLLSNILLKGKDDTMFELK
                     ENIDLDLELGDYGLVLNFLKKDIGVAKAINGIYYFEVFLNNNSIFRADFQSMSLNGNS
                     YVVFDNKDYNLDLFNIKRDNGNIEINNLEFTSGHNEIKIKYGDVYNTENSLTYRFTLN
                     G"
     gene            complement(318123..319190)
                     /locus_tag="BT0308"
                     /db_xref="GeneID:4642837"
     CDS             complement(318123..319190)
                     /locus_tag="BT0308"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945316.1"
                     /db_xref="GI:119953107"
                     /db_xref="GeneID:4642837"
                     /translation="MNLCKENSTRFRKIKNFLLSIFLLIFIVLVDSILKSTIDISIFY
                     KFNHFKKSDNLVDIVPKRNVFINDQILNLDFNKYDYHVVSDRLVSFSDYYYVLNRFKN
                     NYSVFSRKTDKFLFSLAYKDFVFTKDNVVFALNNLHKALEVYGADGSRILSFKFIASI
                     LSIDYNDDVLALGLSDGKTYVYKRGKMVYGGDLLGVGLPIICLKLSLNNKYLCILRGN
                     EEYSIEVFNLEDGYNQFLYLKNLKIKDFNPFFKIDKFYNLFVETANSFLILNINSGKT
                     FKVDNKNSVLKASYDPFSRVYRVYFYDLSGSMINIRTYSVDSYSLFDNIFFKDKVNSY
                     VEFDEGILYFNDNSDLNYLGL"
     gene            complement(319216..319974)
                     /locus_tag="BT0309"
                     /db_xref="GeneID:4642410"
     CDS             complement(319216..319974)
                     /locus_tag="BT0309"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945317.1"
                     /db_xref="GI:119953108"
                     /db_xref="GeneID:4642410"
                     /translation="MDLVHNENYQKILFIDDLILQTLKDIKGIKKSGKLALDSGVTVN
                     FINLNLNVLSYIASLNYFYTKPRLKVNYDFRVNLFSFISDFSLFVSPVLLISFGELMD
                     NESVLNLNPEERFLIVRKLGYLIDLGMYFSKGDSKAILFLEDIYLKFIVLVKNFIDFK
                     NLSKNLVIDSPFYKVQLAHLIKSLDLLEEGAFLLRSRYEVNGAYGLSEQILSYIQAGK
                     TLATVTSQKSIAEKFTKFYEVWSVKFQSDLSKSR"
     gene            complement(319990..321666)
                     /locus_tag="BT0309A"
                     /db_xref="GeneID:4642399"
     CDS             complement(319990..321666)
                     /locus_tag="BT0309A"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RecN"
                     /protein_id="YP_945318.1"
                     /db_xref="GI:119953109"
                     /db_xref="GeneID:4642399"
                     /translation="MKFCMLVELFVKNFVLIKELSIKIGTGLVALTGESGSGKSLLLS
                     SIYYLFGGKIKSNIIINGEQECVLLAKFRVNGDVRDYLSSKAILASDCIIIKRVIIFE
                     SSETLLSNYYINNEPISSNILKPIFNMLIEVHSQNQQYLILKNPSSNLKILDNYANLN
                     SQLEKYRLVYEEYIQYLNDYDDFVSKEKLHKDSKEECEKIIDEIDSFNPKIGEEEILK
                     TRLDELKNHESLCNALSSLKSVLSLNNNVSALSKIRNVICDAEYLSGVNNNYFELENR
                     LKSSYYELEDIGQAYSRYLFDKTYDEKEIESVENRLHDLSRLRKKYGPSLEDVIVFRK
                     RCDDIIDLSLNFETERLGKEQMLNDLFERVKKLAFDISSVRKAAALRFASGVTKILHK
                     LNMGDAEFFVSVSEGKIKSTGIDEVEFLISSNTGLKAQPIYRIASGGELSRIMLAIKS
                     VQNVDESKLIIFDEIDSGIGGESGMSLGKYLKGLSENMQIFVVTHLANIASLSDYHIL
                     VKKEYIEDRPYVQACLLLGNDRVLEVARMLSGNVNDISFQHAEELLKGNN"
     misc_feature    complement(319993..321654)
                     /locus_tag="BT0309A"
                     /note="ATPase involved in DNA repair [DNA replication,
                     recombination, and repair]; Region: RecN; COG0497"
                     /db_xref="CDD:223571"
     misc_feature    complement(<321202..321651)
                     /locus_tag="BT0309A"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(321547..321570)
                     /locus_tag="BT0309A"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(321229..321231,321544..321552,
                     321556..321561))
                     /locus_tag="BT0309A"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(321229..321234,321238..321243))
                     /locus_tag="BT0309A"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(320047..>320430)
                     /locus_tag="BT0309A"
                     /note="ATP-binding cassette domain of RecN; Region:
                     ABC_RecN; cd03241"
                     /db_xref="CDD:213208"
     misc_feature    complement(320332..320361)
                     /locus_tag="BT0309A"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(320275..320292)
                     /locus_tag="BT0309A"
                     /note="Walker B; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(320257..320268)
                     /locus_tag="BT0309A"
                     /note="D-loop; other site"
                     /db_xref="CDD:213208"
     misc_feature    complement(320176..320196)
                     /locus_tag="BT0309A"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213208"
     gene            complement(321701..322579)
                     /locus_tag="BT0311"
                     /db_xref="GeneID:4642389"
     CDS             complement(321701..322579)
                     /locus_tag="BT0311"
                     /EC_number="2.7.1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-NAD kinase"
                     /protein_id="YP_945319.1"
                     /db_xref="GI:119953110"
                     /db_xref="GeneID:4642389"
                     /translation="MTRANLHGFHIRRIMKSKVLIYVNYSNLDAEVLACEIQKYLEHK
                     YGVLSLFAGIDKSSEVLTEDNLILAITLGGDGTVLLASSLLLKNDIDIPIISINLGKV
                     GFLADIKPIDFKEVIDKFFDNSLVIHSKYLLSISAYENGNNVFTKYALNDVIIRSSVI
                     NKLIYVNLRVNSEDFLSYRSDGIIFATPTGSTGYSFSAGGSILESDLQAFILTPISPH
                     SVYNRSFIFSSGSKLSLSFQKGYALNSASIFVDGVNIGKFGVNIIFELGLDNKSLRFA
                     SFCTDTFVRRLKNKLL"
     misc_feature    complement(321704..322537)
                     /locus_tag="BT0311"
                     /note="NAD kinase [Coenzyme metabolism]; Region: nadF;
                     COG0061"
                     /db_xref="CDD:223139"
     gene            complement(322527..323057)
                     /locus_tag="BT0312"
                     /db_xref="GeneID:4642371"
     CDS             complement(322527..323057)
                     /locus_tag="BT0312"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="YP_945320.1"
                     /db_xref="GI:119953111"
                     /db_xref="GeneID:4642371"
                     /translation="MFMKEKIMEKKSHLQVACFKIGKESYGVAIDHIREVIKVPLEGI
                     YAIPNVPDYITGIYNLRGSVIPLINLNIRFKIPSVYVTEEDKLLTGYLIVNIKDKLLG
                     IFVDKVLKVISFDTSKVQEPPATLQTLDRKYISGVVKIENEENFESEYLILIDIERIF
                     DKGEFARIPYKENNEE"
     misc_feature    complement(322566..323021)
                     /locus_tag="BT0312"
                     /note="CheW, a small regulator protein, unique to the
                     chemotaxis signalling in prokaryotes and archea. CheW
                     interacts with the histidine kinase CheA, most likely with
                     the related regulatory domain of CheA. CheW is proposed to
                     form signalling arrays together...; Region: CheW; cd00732"
                     /db_xref="CDD:238374"
     misc_feature    complement(order(322566..322589,322764..322766,
                     322770..322772,322866..322883))
                     /locus_tag="BT0312"
                     /note="putative CheA interaction surface; other site"
                     /db_xref="CDD:238374"
     gene            complement(323098..323733)
                     /locus_tag="BT0313"
                     /db_xref="GeneID:4642364"
     CDS             complement(323098..323733)
                     /locus_tag="BT0313"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA Um2552 2'-O-methyltransferase"
                     /protein_id="YP_945321.1"
                     /db_xref="GI:119953113"
                     /db_xref="GeneID:4642364"
                     /translation="MHNNNYNKKYNGLSVLQSIDMYNVVDEYSRRAKKEGYLARSVYK
                     LIEIDKRFSLFSSGNILDVGASPGSFSQYAYGNLKDGVLVAVDLNDIDLNFTNNFYFI
                     KGNIYIDEVCQKIETFAPYSLIISDAAPKTTGNRLVDTSNSFNLNMRIIELASRILVK
                     GGNLLLKVFQGGEEEQLFYKLKSCFKIVKKIRPKAVRKNSFEIYFLSKDFN"
     misc_feature    complement(323227..323559)
                     /locus_tag="BT0313"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(323353..323355,323389..323397,
                     323470..323475,323527..323547))
                     /locus_tag="BT0313"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            323728..324774
                     /locus_tag="BT0314"
                     /db_xref="GeneID:4642345"
     CDS             323728..324774
                     /locus_tag="BT0314"
                     /EC_number="2.5.1.1"
                     /EC_number="2.5.1.10"
                     /EC_number="2.5.1.29"
                     /note="geranylgeranyl pyrophosphate synthetase;
                     geranyltranstransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylallyltransferase"
                     /protein_id="YP_945322.1"
                     /db_xref="GI:119953112"
                     /db_xref="GeneID:4642345"
                     /translation="MQNKSFLDKIEKNINNIFSQDHFLNLFKDKDLKLKLNIQKNTIK
                     TIKAPAIEIINRGGKRIRPMLMILLAYALGYNKKNTENLYKLSMLLELPHSGSLIIDD
                     IEDGAIKRRGKPAIHLIYGLDNSINTANLIYFLPAKLIQTSKLKKSQKLLIYENFFTT
                     LSNLHLGQGIDIALHNGTYIPNLDEYISLVELKTSCLFGMAGFLAGILTNNESKAKNL
                     YNTFLKLGTCFQIIDDIKNIKDGINGKDFGDDLIEGKKSLPIIYFLKEKLLDEQIIQE
                     LSAIKNKSINESKKEILKFSNMINSSSAIQNSTNLAMSYLNKFTEELNSYALINKYKD
                     MIMNIVKKIKEENL"
     misc_feature    323857..324624
                     /locus_tag="BT0314"
                     /note="Trans-Isoprenyl Diphosphate Synthases,
                     head-to-tail; Region: Trans_IPPS_HT; cd00685"
                     /db_xref="CDD:173833"
     misc_feature    order(324004..324006,324013..324021,324025..324033,
                     324037..324042,324055..324060,324229..324231,
                     324238..324240,324304..324309,324316..324318,
                     324424..324429,324436..324438,324460..324462,
                     324475..324477,324490..324492)
                     /locus_tag="BT0314"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173833"
     misc_feature    324013..324042
                     /locus_tag="BT0314"
                     /note="chain length determination region; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(324028..324033,324040..324042,324055..324060,
                     324238..324240,324304..324306,324424..324429,
                     324436..324438,324460..324462,324475..324477,
                     324490..324492)
                     /locus_tag="BT0314"
                     /note="substrate-Mg2+ binding site; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(324028..324033,324040..324042,324055..324060,
                     324304..324306,324424..324429)
                     /locus_tag="BT0314"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(324028..324033,324040..324042,324055..324060,
                     324238..324240,324304..324306)
                     /locus_tag="BT0314"
                     /note="aspartate-rich region 1; other site"
                     /db_xref="CDD:173833"
     misc_feature    order(324046..324090,324442..324444,324460..324477,
                     324484..324498)
                     /locus_tag="BT0314"
                     /note="active site lid residues [active]"
                     /db_xref="CDD:173833"
     misc_feature    order(324424..324429,324436..324438,324460..324462,
                     324475..324477,324490..324492)
                     /locus_tag="BT0314"
                     /note="aspartate-rich region 2; other site"
                     /db_xref="CDD:173833"
     gene            324771..325454
                     /locus_tag="BT0315"
                     /db_xref="GeneID:4642355"
     CDS             324771..325454
                     /locus_tag="BT0315"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945323.1"
                     /db_xref="GI:119953114"
                     /db_xref="GeneID:4642355"
                     /translation="MKKYVIMLIWMNITTFIYATIPTEDINKIDELYTKSMLLKELKK
                     YNQSKALLMQIINTDPKQVDAYLLIAELEYLMNNWLQAIEQTKTYLQIIDFKDTKNYL
                     DISWAYFLMGESRNSMDYIMQFIQDNKELLNTNIYILIDTILKKGFYHFIQDEDLIFN
                     LIINTLFQIETYDDTIFTIFLNNLDIIKQMPFYKFNKIKIKDLELQIRALKKLKNSTN
                     DIAKTGWFF"
     misc_feature    324858..325160
                     /locus_tag="BT0315"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(324858..324863,324867..324872,324879..324884,
                     324969..324974,324978..324983,324990..324995,
                     325074..325079,325086..325091,325098..325103)
                     /locus_tag="BT0315"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(324876..324878,324912..324914,324924..324926,
                     324933..324935,324978..324980,325014..325016,
                     325026..325028,325035..325037,325083..325085,
                     325119..325121,325131..325133,325140..325142)
                     /locus_tag="BT0315"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(325432..326238)
                     /locus_tag="BT0316"
                     /db_xref="GeneID:4642335"
     CDS             complement(325432..326238)
                     /locus_tag="BT0316"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside transport system permease protein"
                     /protein_id="YP_945324.1"
                     /db_xref="GI:119953115"
                     /db_xref="GeneID:4642335"
                     /translation="MFGIFLHSIVFAYLALGILYAERVGLLNISIEGISFLSVFLTSF
                     FIYLGYGIFASVVMTIFISLIFGFFLSFIVINGYNIFITGIGINILCYFLVRVLMKAN
                     FNFIPGFSLNISNNFAIIFFVIFFFVFLSFSIYILNYSRVRVVFEFIRSNDYENILGE
                     RTSNYFKSFAIFVSVISSSIAGSFLAINFNVYSYDLGLNNGWLAICILYIAFANPWLI
                     FPSAFLMIFIEYEFFNFQDYVNSYFALSLPFYMAILINIFVSLFRKTNLF"
     misc_feature    complement(325459..326238)
                     /locus_tag="BT0316"
                     /note="Transmembrane subunit (TM) of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which are involved in the uptake of
                     branched-chain amino acids (AAs), as well as TMs of
                     transporters involved in the uptake of...; Region:
                     TM_PBP1_branched-chain-AA_like; cl00454"
                     /db_xref="CDD:260432"
     misc_feature    complement(order(325723..325740,325753..325791))
                     /locus_tag="BT0316"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119320"
     gene            complement(326239..327171)
                     /locus_tag="BT0317"
                     /db_xref="GeneID:4642332"
     CDS             complement(326239..327171)
                     /locus_tag="BT0317"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside transport system permease protein"
                     /protein_id="YP_945325.1"
                     /db_xref="GI:119953116"
                     /db_xref="GeneID:4642332"
                     /translation="MRAFRREYILLIFSLSVLSISYFFDGFFSFSYMKVMLWNFMLLL
                     LIATGISTCAKSNSLTLGDEGQVYFGAFLSYIFCEFCGLTYFNFVLIIILSSFLVGVI
                     GIIPFLLTFFCGVNGMLTGLLMSYGNQRLVDGFISKLLGSNGLLNQTKSIDKIFVIDT
                     AFPYLLLFSILVWGCYVFIHKRTILGLRLEILSDRKPLSKFFGINEFKYKFCTVFTSA
                     FLNGLVGSIFLIFFKNYLFLGLTAGLGWNGFVVAVVSGFNYMYVLCFSLFFAMLNEFN
                     NYLKINYSFKFEFIGLYQAISIFISLFLINAGKK"
     misc_feature    complement(326266..327045)
                     /locus_tag="BT0317"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(326527..326583)
                     /locus_tag="BT0317"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(327168..328625)
                     /locus_tag="BT0318"
                     /db_xref="GeneID:4642100"
     CDS             complement(327168..328625)
                     /locus_tag="BT0318"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside transport ATP-binding protein"
                     /protein_id="YP_945326.1"
                     /db_xref="GI:119953117"
                     /db_xref="GeneID:4642100"
                     /translation="MVEFKNIVKSFPDIEKPILDSVNLRIEESKILTVIGRNGEGKST
                     LSKIIAGFIRFDSGDVFVNNIRQKNWNVDVAKSNGIYIVSQIPKLDMNLKVWEYLSIY
                     WFDSQFFMPMNKSHTYRYYKWLRQFYNIAFDLETRIQDLNIKEIYFLLIISSLKKNAK
                     IIIFDESVSYFSQKEAKEFIKLLQALKRAGITSLFITHREIGDAIKFSDEFVILKEGK
                     CFRTTNKEIILSKLEIPADKFISMSIRRGGPNEDFIKFNLFFEDFWKYDISFSLKKRG
                     VLGIIAEEAVIKTWEKLFLGEIPFVGCIKMNGHRYEYINFYELKAGFLPLGIGNLFSD
                     NMTILDSFLAKIMSFENEIFIKQSIINDLKKFFKSDMEYCDSKILKTFYSKSLSFSGG
                     TLKKLALFREKYITKSFLICFSPLSNLDYRAYSETSNFIRNFSNEKPVLLITPNLDEL
                     LLLSDDVLAIKAGEVVLRLKREHINKEALKEMLFI"
     misc_feature    complement(327174..328625)
                     /locus_tag="BT0318"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    complement(327960..328622)
                     /locus_tag="BT0318"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(328497..328520)
                     /locus_tag="BT0318"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(328032..328034,328128..328133,
                     328371..328373,328494..328502,328506..328511))
                     /locus_tag="BT0318"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(328371..328382)
                     /locus_tag="BT0318"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(328176..328205)
                     /locus_tag="BT0318"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(328128..328145)
                     /locus_tag="BT0318"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(328110..328121)
                     /locus_tag="BT0318"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(328023..328025,328029..328046))
                     /locus_tag="BT0318"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(328629..329729)
                     /locus_tag="BT0319"
                     /db_xref="GeneID:4642793"
     CDS             complement(328629..329729)
                     /locus_tag="BT0319"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-binding protein"
                     /protein_id="YP_945327.1"
                     /db_xref="GI:119953118"
                     /db_xref="GeneID:4642793"
                     /translation="MPFCSHSIKFYFMRKRCFISVSKALFFRIFCVFVSLICLFLFVY
                     INFFRIREPRSSSNRKIALFIPGIISGSPSYKAMYDFLIEFKKNKSDIEIRLFEAGFN
                     QHEWIELLEKLLNSNNYDFLITTNNAMQGIIDRVSPNYPYTKFLLFDSLVKNINPQVY
                     SLSYNVAEEAYILGYYVGLFLKSSNLHNKNVALIAGQEYPVMNNYIFPYFKNGIREVL
                     DSEVFFRTLGNWHDSNRVKVLSDSLILDLGVSVVLPIVGTAIKGVLSSVREHGVFAVL
                     FDGEDYLNNKDNIIGSGVTNQRFYLEKVLGKALKGELKYGTYKVLGFRERGVSFNLLN
                     KFYLEKTDSKLKKKLEEKMKEMNNTEIKINLE"
     misc_feature    complement(328704..329552)
                     /locus_tag="BT0319"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            complement(329994..331085)
                     /locus_tag="BT0322"
                     /db_xref="GeneID:4642889"
     CDS             complement(329994..331085)
                     /locus_tag="BT0322"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945328.1"
                     /db_xref="GI:119953119"
                     /db_xref="GeneID:4642889"
                     /translation="MIVKSYVIILLLLLLQVTLFSQVASIKEMEGQINIIRNAIPVKL
                     NLGDEIFEYDFIEVGDNSKIKIGLYGINGIASDLTLYSNTHSLICYSSLKDMQDAKIY
                     LFKGSLEVFIYEVVQGSSFSVDLNNYFFMTDAPAKFYVNCEYFNNYFVSVFDGVLKHY
                     NKDEYWISAGTSILLWDNNSFLYKTSDSVSQNVIENLKEMSRKNFVSLNNSRLTYIFL
                     KYIEDSFRFDFVYDYLVRDPKFNTIYSKWSLEDKNYTLGNRVDMINYVNYLRGRIGIL
                     FNNFIYLANVFFFIEDIVKHSSDVFDKVSIHGAILKYLENYKKNRSSLTKKFFKTVHS
                     FKMYLIRTNGDIPSNLSVNEFYLLKPREF"
     gene            331604..332725
                     /locus_tag="BT0323"
                     /db_xref="GeneID:4642481"
     CDS             331604..332725
                     /locus_tag="BT0323"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane associated protein"
                     /protein_id="YP_945329.1"
                     /db_xref="GI:119953120"
                     /db_xref="GeneID:4642481"
                     /translation="MIKKSKLLFLMLSVFALPLISCKTPPEDTKNANSKISTKETGDI
                     KRDIEDIKKGVLRERGNLFYSKEFNETEKIEKEMHEKFAKGMIKEGNEIALKVLERYR
                     NIARDTTEKKEQINYLKENIEKYLNDAEANEAYIWIPLEIDEVNNLYFEATRKYKMYD
                     IESSLGMYSKTFNKAQQAAKKAKEARALKETEERMYKQLKALEAASELPVYRNNKLIK
                     PSPWNGRALLKDKGERINLLNPQDETYLLGQMDSLILAYEEKAEEVKTPDPNKFKTLQ
                     LIEKARQLWEQGLEAKNLNNLRLANELFLDSARYLKAYQSHSSKELYIIKIGNTLWGI
                     SKKLYNDPYLWPKIWFANRQKIQNPDLIHENWKIIIPSK"
     misc_feature    <332570..332722
                     /locus_tag="BT0323"
                     /note="Uncharacterized protein containing LysM domain
                     [Function unknown]; Region: XkdP; COG1652"
                     /db_xref="CDD:224566"
     gene            332821..333189
                     /locus_tag="BT0324"
                     /db_xref="GeneID:4642868"
     CDS             332821..333189
                     /locus_tag="BT0324"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945330.1"
                     /db_xref="GI:119953121"
                     /db_xref="GeneID:4642868"
                     /translation="MKKLVLTSILFFSCYTVAHLNKQLTKDTPYSIYLREAQKATNVN
                     DYQSALKIYEKMIKNYKENESIVAIGKYEIAFIYYVTNKNNTAKKLFEELIQSNVQTP
                     KWIIPLSQKIIEKIKNQQKK"
     gene            complement(333217..334332)
                     /locus_tag="BT0325"
                     /db_xref="GeneID:4642198"
     CDS             complement(333217..334332)
                     /locus_tag="BT0325"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane associated protein"
                     /protein_id="YP_945331.1"
                     /db_xref="GI:119953122"
                     /db_xref="GeneID:4642198"
                     /translation="MKKAYFIISLFIVFNLFSSINDHLSINIDDVYVEAHEDGFHLFI
                     RKKPNIKSVILTESFEIPDKSKDVSTYSFRTLEYNRINGDEIRILNGRVIQNRRLLSL
                     TSSTPVQNRRFGQAFHILIPKKLRYGFPNFLTRSGDIDLEVLKRKKDPFWFSIRTFEK
                     KYNDYLGQYKDNAYELFFGDIQRESTSENNDLKKEFSRFSDNVVVAKKGLDLVDKIKN
                     ILEESEDPLADLDLVFVIDVTDSMKNHIEILREHLFSMIEPQLSQYRSYRVGFVFYKD
                     YLEDFLTRSFDFNNKEYLNNVLEDISVGGGGDYPEAVFEGINSAVTQFDWKADNRFII
                     VLGNAPPHEYPRGPIVYEDVIRSAKEKDITIYGILLK"
     misc_feature    complement(333220..333645)
                     /locus_tag="BT0325"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(333319..333321,333400..333402,
                     333622..333624))
                     /locus_tag="BT0325"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(334397..337258)
                     /locus_tag="BT0326"
                     /db_xref="GeneID:4642469"
     CDS             complement(334397..337258)
                     /locus_tag="BT0326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945332.1"
                     /db_xref="GI:119953123"
                     /db_xref="GeneID:4642469"
                     /translation="MPDIEKINKFKRELLDNISDERAQKERFGIKMDIEPPKDGESIV
                     PWENQEEVFDLEEEPDDELDLDAMLGELDSEEDQNDGSNENDIAILKDSKKVDIDPEF
                     NELDNDFDVLSSHLEENLEKVLDDNSISLDDAINFDLDNNADSLQNLDIENDLDSDLL
                     NSDESIDNEIDANNLSQESLNDSNDDFDLENMISGLKESDETNNSLEMPYSDESFSNE
                     NSENLSDGEEDNWSNLSDDFEFLENDQKEPLGKHNFKINYPLFFKHLDSYPRNLRIAI
                     AEALMLENVSRYKIEALIDLVEQNKKGLKFIAKFVGDIVGRSVKLPVMYYKAEECSKL
                     EKKFSYRLSKALTPIFKIASLFVILTFLSFYFLVDVMFFYIASDRKYKEGISYIYENK
                     RELAKAIFRDAYYMKPNKKWFLTYAKVFEDVRDFDSAEEKYEELFTIDPFSVGASKRR
                     RKNFDRDGYISYAFMKMRLGEYADANAILDEVISYSIYDYEALMAKGDNYFQWAQRDP
                     AYYKDSINNYTILLSKYGHKKEILFKLFNAYIEAGAEREAEDVNAFIKVNKELDIDEV
                     VYTKYAKKLIDKYVEFTVYNKRINALSRNLKYFSAQMNLLNKEFSSFKAGNGKSISNA
                     LNDINLNSEIEYILRRILFKNPDYDKALFESGRYFYYMGDLKKSEGYLLTALNSFRQE
                     DSIENSSEKIVAYRILSDIYERNNDALKASNIVSLALNEYDFYKKNGLVKSSRELALI
                     YEKQGDILRTLNGFKSAISSYEMAINEGVNSPDVYYKLALLNYKENNYKDALTYLFRV
                     QNMSGFANSNKVLNSIASVLYKMGDFEAARSYYLRVLQNLESEKSSILSFKPQGNDHH
                     KALLIKEIEIYNNLGVVEIRASLGDRIESGVVRNNNLFDSGIANLTESSRIFDILNRD
                     DDMVKSVKKDLASLNLRGIFKNDFIGSKILFYDNLADNL"
     misc_feature    complement(336551..>337120)
                     /locus_tag="BT0326"
                     /note="SGT1 protein; Region: SGT1; pfam07093"
                     /db_xref="CDD:254052"
     misc_feature    complement(334751..335041)
                     /locus_tag="BT0326"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(334796..334801,334808..334813,
                     334820..334825,334907..334912,334919..334924,
                     334928..334933,335018..335023,335030..335035,
                     335039..335041))
                     /locus_tag="BT0326"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(334757..334759,334766..334768,
                     334778..334780,334814..334816,334865..334867,
                     334874..334876,334886..334888,334922..334924,
                     334967..334969,334976..334978,334988..334990,
                     335024..335026))
                     /locus_tag="BT0326"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(<334628..334831)
                     /locus_tag="BT0326"
                     /note="Tetratricopeptide repeat; Region: TPR_12;
                     pfam13424"
                     /db_xref="CDD:257749"
     gene            complement(337274..338167)
                     /locus_tag="BT0327"
                     /db_xref="GeneID:4642344"
     CDS             complement(337274..338167)
                     /locus_tag="BT0327"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate o-acyltransferase,
                     putative"
                     /protein_id="YP_945333.1"
                     /db_xref="GI:119953124"
                     /db_xref="GeneID:4642344"
                     /translation="MFIRNESFNKYFKGIENEFFSRFKAIEKINYLNNSYHEADSVSR
                     SLVDTMIKRLLKSSSTIVGIQNILKLYEKSKSGKSSIILMEHYSNFDFPCFQFLLNQM
                     NCKEVSEHIVPIAGVKLFKDNLLIKSLSLGYSVIFIYPPHAFVGVDHETIRARRVFNA
                     NSMRCIADKKSSGYMILIFPTATRYRKGRPETKKIISEISSYFKLFDYFIMVGVNGSI
                     LEVSSNEDMSCDVFKEDTLVYNATEILDILEYKNLILEQLNQEGLEPTKEILGSRIAD
                     DLEKRFEVLHEEGAKIYSGLI"
     misc_feature    complement(<337598..337927)
                     /locus_tag="BT0327"
                     /note="Phosphate acyltransferases; Region: PlsC;
                     smart00563"
                     /db_xref="CDD:214724"
     misc_feature    complement(order(337616..337624,337814..337825,
                     337895..337897,337901..337903,337910..337912))
                     /locus_tag="BT0327"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153244"
     gene            338367..339962
                     /locus_tag="BT0328"
                     /db_xref="GeneID:4642405"
     CDS             338367..339962
                     /locus_tag="BT0328"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide-binding protein OppA"
                     /protein_id="YP_945334.1"
                     /db_xref="GI:119953125"
                     /db_xref="GeneID:4642405"
                     /translation="MKYKTIILLSLLIIWLTSCSGDEHKDKITFRVTNEAEPDSLDPQ
                     LATSVQAFNIIINTFAGLTTRNTQTGGHKPGLAQSWDISADGLVYTLHLREGIMWSDG
                     VPITAEGILKSYLRVLNKETGSQYVDIVKSTIKNAKDYFEGKIPESELGIKTIDNSTL
                     EITLVAPKPYFLDMLAHQTFIPVPVHAIEKYGQAWTNPENIVVSGAYKLKTRIPNEKI
                     VLEKNDKYYNASNVEIDEVIFYQVQGNTAYNMYINDELDFLTKVASEYLDEARIRNDY
                     YSHPINRVAYMAFNTTIKPLDNVKVREALTLAIDREALNKITLKGQSKPTRNLTPPFE
                     HYSYGKQLKLFDPQRAKQLLAEAGYPDGAGFPTLKYKTSQRNGMAITAEFLQEQLKKT
                     LNINIEIEIEEWNTFLNNRNKGNYQTSYMGWTGDYSDPLTFLESLFTTENQGFGAYGY
                     SNKKYDNLIEQSNFAQDPIQRQDILRQAEALIIEQDFPVAPLSILKSYYLFRHDKWTG
                     WIPNVSEAYLYEEIKYKRENINN"
     misc_feature    338439..339941
                     /locus_tag="BT0328"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     misc_feature    338451..339923
                     /locus_tag="BT0328"
                     /note="The substrate-binding component of an ABC-type
                     oligopetide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_OppA; cd08504"
                     /db_xref="CDD:173869"
     misc_feature    order(338520..338522,339144..339146,339207..339209,
                     339576..339578,339624..339626,339630..339644,
                     339849..339851)
                     /locus_tag="BT0328"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173869"
     gene            340384..341970
                     /locus_tag="BT0329"
                     /db_xref="GeneID:4642416"
     CDS             340384..341970
                     /locus_tag="BT0329"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide-binding protein OppA"
                     /protein_id="YP_945335.1"
                     /db_xref="GI:119953126"
                     /db_xref="GeneID:4642416"
                     /translation="MKIKKYTFIIFFLTVILSCSKENSKENLSFKISMGGEPKSIDPQ
                     LTEDKIGATIVAQMFSGIVDGDPKTGGYKPGLAQSWDISDDGTIYTFHLRKDIVWSDG
                     VPITAEGIRRSYIRMLTKDTASNYVGMIKSTIKNAQDYFEGKIPESELGIKTIDELTL
                     EISIITPKAYFLDMLVHQSFIPVPVHAIEKYGKNWTNPENMVVSGAYKLKERNPNEKI
                     SLIKNDKYFNAANIELQELIFYTINDASTAYRMYENNEIDMLIHGAIPPDLIKEIKLR
                     NDYYSSAINGLYYFSFNTQVKPLDNVKVREALTLAIDRETLTKKVIDNGSIPTRSISP
                     KFNHYSYGKPLELFNPQRAKELMAEAGYPNGEDFPQLKLKYNTNESHKKIAEFVQNQW
                     EKILNINIVLENEEWASFLETKQKGNYEIARSGWIGDYSDPLTFLSLFQKEFAYFSSY
                     KYFNKEYENLINQSDREQDPIKRQNILRQAEEIIIKKDFPVAPIYIYAGNYLFKNDKW
                     TGWVPNISERFNFSEIKRIK"
     misc_feature    340384..341967
                     /locus_tag="BT0329"
                     /note="ABC-type oligopeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     OppA; COG4166"
                     /db_xref="CDD:226636"
     misc_feature    340468..341949
                     /locus_tag="BT0329"
                     /note="The substrate-binding component of an ABC-type
                     oligopetide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_OppA; cd08504"
                     /db_xref="CDD:173869"
     misc_feature    order(340537..340539,341170..341172,341233..341235,
                     341602..341604,341650..341652,341656..341670,
                     341872..341874)
                     /locus_tag="BT0329"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173869"
     gene            342202..343122
                     /locus_tag="BT0332"
                     /db_xref="GeneID:4642382"
     CDS             342202..343122
                     /locus_tag="BT0332"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transport system permease protein
                     OppB"
                     /protein_id="YP_945336.1"
                     /db_xref="GI:119953127"
                     /db_xref="GeneID:4642382"
                     /translation="MLKFTMQKILETIPTLIVIIFLCFLIMKLAPGNPFDSEKPIDPQ
                     IKEKLMQKYHLDKPFYVQAYYYITNIFKGDFGPSLVKKDLNVNQYIKLGFPKSFTIGI
                     ISLIISLTLGILLGSLAAIKKNTRTDYIIRIAAICGISVPTFVTGPLLQYLLSVKLKL
                     FYTSGWISERGGLTNLIMPILTMSLPWIAIFTRIIRGSMLEILKSDFVRTAKAKGLSF
                     NVIIRKHVLIGSILPLVSYIGPAFAGIISGSMVIEQIFRIAGMGTFTVESSLNRDYPL
                     LMGSLLVYSTILLISILASDIAYKKLDPRT"
     misc_feature    342202..343116
                     /locus_tag="BT0332"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    342532..343080
                     /locus_tag="BT0332"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(342532..342534,342541..342546,342559..342561,
                     342592..342603,342607..342636,342643..342648,
                     342652..342654,342757..342762,342766..342768,
                     342772..342774,342781..342786,342790..342792,
                     342802..342807,342814..342816,342865..342867,
                     342907..342912,342919..342921,342940..342951,
                     342958..342963,342988..342993,343030..343035,
                     343042..343047,343051..343056,343063..343068,
                     343075..343080)
                     /locus_tag="BT0332"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(342610..342654,342940..342957)
                     /locus_tag="BT0332"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(342652..342654,342742..342744,342958..342960,
                     342982..342984,342991..342993,343030..343032)
                     /locus_tag="BT0332"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(342817..342855,342871..342876,342886..342888)
                     /locus_tag="BT0332"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            343132..344184
                     /locus_tag="BT0333"
                     /db_xref="GeneID:4642327"
     CDS             343132..344184
                     /locus_tag="BT0333"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transport system permease protein
                     OppC"
                     /protein_id="YP_945337.1"
                     /db_xref="GI:119953128"
                     /db_xref="GeneID:4642327"
                     /translation="MNEHENQDTYVEIHTANKRAWLRFKENKLAFISIFIIGFYILIA
                     ILRPILPIYKYHTQVVEHADLPPSLKYAGELWYEKELHFIKRLSAKEKREINKEEKAK
                     LEEIKRKIETEVQTIDGKEIKIHKRIYLLGTDNLGRDLLARIIQGSQISISVGFIGAL
                     ISMIIGTIIGAIAGFFGGIIDRIITKIIEIFYVLPTLLVIIILMTVMERNIIGVFIAI
                     SIISWLTIARIVRGQVKSLARSEFIQAARTLGATNTRMIFKHLIPNSFGMIVIITTMN
                     VPSFIMLESFLSFLGLGISAPMTSWGELIKNGIPTFIEYPWKIFIPATVMTIFLLFMN
                     FLGDGLRDAFDPKDNL"
     misc_feature    343183..344172
                     /locus_tag="BT0333"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    343183..343335
                     /locus_tag="BT0333"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:257395"
     misc_feature    <343378..343503
                     /locus_tag="BT0333"
                     /note="Mitochondrial ATPase inhibitor, IATP; Region: IATP;
                     pfam04568"
                     /db_xref="CDD:252676"
     misc_feature    343579..344124
                     /locus_tag="BT0333"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(343621..343626,343633..343638,343651..343653,
                     343681..343692,343696..343725,343732..343737,
                     343741..343743,343792..343797,343801..343803,
                     343807..343809,343816..343821,343825..343827,
                     343837..343842,343849..343851,343900..343902,
                     343942..343947,343954..343956,343975..343986,
                     343993..343998,344038..344043,344071..344076,
                     344083..344088,344092..344094,344098..344100,
                     344107..344112,344119..344124)
                     /locus_tag="BT0333"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(343699..343743,343975..343992)
                     /locus_tag="BT0333"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(343741..343743,343777..343779,343993..343995,
                     344032..344034,344041..344043,344071..344073)
                     /locus_tag="BT0333"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(343852..343890,343906..343911,343921..343923)
                     /locus_tag="BT0333"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            344156..345073
                     /locus_tag="BT0334"
                     /db_xref="GeneID:4642354"
     CDS             344156..345073
                     /locus_tag="BT0334"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transport ATP-binding protein OppD"
                     /protein_id="YP_945338.1"
                     /db_xref="GI:119953129"
                     /db_xref="GeneID:4642354"
                     /translation="MHLIQKTTFRRHSMKEDYMLDIRNLSIEFKLKHTTIYPVSNINL
                     KMKKGEIRAIVGESGSGKSVTSMAILKLLPEITTVYKTGEILFEGQDLLKLSEKELQN
                     IRGNKIAMIFQDPMTSLNPYLRISTQIEETIMLHQKLDKKTAKQKAIEMLKTVGVINA
                     EERIEHYPHQFSGGMRQRVMIAMALSCHPSLLIADEPTTALDVTIQEQILLLIKSLSK
                     KFNTSTILITHDLGVVAEVCDTVSVMYQGKFVEEGTVQEIFKNPKHPYTIGLLKSILT
                     LDKDPNEKLYSIKDNPIGTITNKMEGDFK"
     misc_feature    344210..344914
                     /locus_tag="BT0334"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    344270..344968
                     /locus_tag="BT0334"
                     /note="nickel import ATP-binding protein NikD; Region:
                     nickel_nikD; TIGR02770"
                     /db_xref="CDD:131817"
     misc_feature    344321..344344
                     /locus_tag="BT0334"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(344330..344335,344339..344347,344492..344494,
                     344738..344743,344840..344842)
                     /locus_tag="BT0334"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    344483..344494
                     /locus_tag="BT0334"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    344666..344695
                     /locus_tag="BT0334"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    344726..344743
                     /locus_tag="BT0334"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    344750..344761
                     /locus_tag="BT0334"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    344828..344848
                     /locus_tag="BT0334"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    344897..>345031
                     /locus_tag="BT0334"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            345070..346059
                     /locus_tag="BT0335"
                     /db_xref="GeneID:4642385"
     CDS             345070..346059
                     /locus_tag="BT0335"
                     /codon_start=1
                     /transl_table=11
                     /product="oligopeptide transport ATP-binding protein OppF"
                     /protein_id="YP_945339.1"
                     /db_xref="GI:119953130"
                     /db_xref="GeneID:4642385"
                     /translation="MKNEKDIILKVENLVQTFTIGENFLFWKNKRKVNAVNGISFEVE
                     RNKTLGLVGESGCGKSTTLRTIMQLYTPTSGNIYFNGKDITKLSKRELLKTKKDMQMV
                     FQDPHTSLNPRMTIKEIIAEPLVIYNENKIFPRTKQEIEKRVNELMDITGLAKSMLSR
                     YPHEFSGGQRQRIGIARALALNPKLLLLDEAVSALDVSIRAQILNLLKDLQKELNLSY
                     LFISHDLAVVKYMSDKIAVMYLGVILEIAPREILFSNPKHPYTKTLIASIPEIDPEKI
                     KNKTIKLDEPSLTNIRNTSITPENATLEEVEKDHFVSKYLFDEMNNLINKNDT"
     misc_feature    345091..345810
                     /locus_tag="BT0335"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    345094..345894
                     /locus_tag="BT0335"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    345226..345249
                     /locus_tag="BT0335"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(345235..345240,345244..345252,345379..345381,
                     345634..345639,345736..345738)
                     /locus_tag="BT0335"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    345370..345381
                     /locus_tag="BT0335"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    345562..345591
                     /locus_tag="BT0335"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    345622..345639
                     /locus_tag="BT0335"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    345646..345657
                     /locus_tag="BT0335"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    345724..345744
                     /locus_tag="BT0335"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    345802..>345948
                     /locus_tag="BT0335"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     gene            complement(346217..346972)
                     /locus_tag="BT0336"
                     /db_xref="GeneID:4642388"
     CDS             complement(346217..346972)
                     /locus_tag="BT0336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945340.1"
                     /db_xref="GI:119953131"
                     /db_xref="GeneID:4642388"
                     /translation="MERILGWLFYFIFFFFNIFNICSQCYVIENFDLSLNEFLEVSTR
                     KDNLSPIVDSKRVIMFYPSNKGIRKIFAAFDFDGYAKKYLFKKNKYGLFFVKINLPHG
                     VGSIKYRLVVDGIWTNDEYNKNVVFNKDLIPFSIIDIGVDHSYVSLRNPIDSSDGREV
                     EIFYIGRPGQIVTIAGNFNNFNPFLNRLVEQEPYKGVYTIKLKDLPKGRIYYYFVDSG
                     NKVIDKNNVNRINLYLVEGIDNKMDFEVSYFDN"
     misc_feature    complement(<346616..346792)
                     /locus_tag="BT0336"
                     /note="Early set domain associated with the catalytic
                     domain of sugar utilizing enzymes at either the N or C
                     terminus; Region: E_set; cl09101"
                     /db_xref="CDD:263719"
     gene            347005..348399
                     /gene="eno"
                     /locus_tag="BT0337"
                     /db_xref="GeneID:4642778"
     CDS             347005..348399
                     /gene="eno"
                     /locus_tag="BT0337"
                     /EC_number="4.2.1.11"
                     /note="enolase; catalyzes the formation of
                     phosphoenolpyruvate from 2-phospho-D-glycerate in
                     glycolysis"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopyruvate hydratase"
                     /protein_id="YP_945341.1"
                     /db_xref="GI:119953132"
                     /db_xref="GeneID:4642778"
                     /translation="MQKYYTFVSFIIILKIYTKVNIQILTNKERKMGFHIYEIKARQI
                     IDSRGNPTVEADVILEDGSLGRAAVPSGASTGTNEAVELRDGNKSVYMGKGVLKAVEN
                     IINIISPELEGMSALNQVEIDKKMLELDGTPNKSKLGANAILAVSMATARAAAEHLGL
                     KVYQYLGAYKANILPTPMCNIINGGAHSDNCVDFQEFMIMPIGAKTFSDAIRMSAEVF
                     HTLKGILSKKGYATAVGDEGGFAPNLKSNEEACEVIMEAIQSAGYTPGTDIAIALDPA
                     TSELYDPKTKKYVLRWSTKEKLTSEEMVEYWAKWVEKYPIISIEDGMAEEDWDGWKKL
                     TDKIGNKVQLVGDDLFVTNTSFLKKGIEMKVANAILIKVNQIGTLTETFEAVEMAKKA
                     GYTAIVSHRSGETEDTTIADLVVALGTGQIKTGSLSRTDRIAKYNQLLRIEEELGSIA
                     EYHGRDVFYSIKKQ"
     misc_feature    347110..348390
                     /gene="eno"
                     /locus_tag="BT0337"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    347116..348339
                     /gene="eno"
                     /locus_tag="BT0337"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(347122..347124,347128..347154,347164..347166,
                     347200..347202,347566..347574,347635..347640,
                     347647..347652,347659..347664,347701..347706,
                     347725..347727,347731..347733,348214..348222,
                     348289..348297,348301..348306,348313..348315,
                     348322..348327,348334..348336)
                     /gene="eno"
                     /locus_tag="BT0337"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(347224..347226,347824..347826,347962..347964,
                     348043..348045)
                     /gene="eno"
                     /locus_tag="BT0337"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(347563..347565,347713..347715,348118..348120,
                     348202..348210,348271..348273)
                     /gene="eno"
                     /locus_tag="BT0337"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            complement(348450..348860)
                     /gene="rpsI"
                     /locus_tag="BT0338"
                     /db_xref="GeneID:4642072"
     CDS             complement(348450..348860)
                     /gene="rpsI"
                     /locus_tag="BT0338"
                     /note="forms a direct contact with the tRNA during
                     translation"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="YP_945342.1"
                     /db_xref="GI:119953133"
                     /db_xref="GeneID:4642072"
                     /translation="MAKSDVKGINLGMGTGRRKSSVARVYIREGKGDIKINNRDFDSY
                     IQLENLKTIALSPLVLTNTLGKYDLYINIYGGGISGQAGAIRHGIARALFDLDEEYKM
                     VLKSNGFLTRDSRKVERKKFGKKKARKSFQFSKR"
     misc_feature    complement(348453..348824)
                     /gene="rpsI"
                     /locus_tag="BT0338"
                     /note="30S ribosomal protein S9; Reviewed; Region: rpsI;
                     PRK00132"
                     /db_xref="CDD:178888"
     gene            complement(348871..349320)
                     /gene="rplM"
                     /locus_tag="BT0339"
                     /db_xref="GeneID:4642086"
     CDS             complement(348871..349320)
                     /gene="rplM"
                     /locus_tag="BT0339"
                     /note="in Escherichia coli this protein is one of the
                     earliest assembly proteins in the large subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="YP_945343.1"
                     /db_xref="GI:119953134"
                     /db_xref="GeneID:4642086"
                     /translation="MNRITNNKTIWVKPKCVEKKWCMIDASDKVLGRVATEAVKILRG
                     KHKPYYTPHQDLGDNVIIINASKIRLTGKKYSQKIYYRHSRYPGGLRSDTFRTLSERK
                     PTAPLEIAIKGMLPKGPLGRELFRNLKVFAGSNHMLNSQNFYKLEAN"
     misc_feature    complement(348919..349260)
                     /gene="rplM"
                     /locus_tag="BT0339"
                     /note="Ribosomal protein L13.  Protein L13, a large
                     ribosomal subunit protein, is one of five proteins
                     required for an early folding intermediate of 23S rRNA in
                     the assembly of the large subunit. L13 is situated on the
                     bottom of the large subunit, near the...; Region:
                     Ribosomal_L13; cd00392"
                     /db_xref="CDD:238230"
     misc_feature    complement(order(348931..348936,348943..348945,
                     348955..348957,348961..348963,348967..348975,
                     348979..348987,348991..348999,349015..349020,
                     349102..349104,349108..349110,349192..349194,
                     349204..349206,349213..349215,349222..349227,
                     349231..349233))
                     /gene="rplM"
                     /locus_tag="BT0339"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238230"
     misc_feature    complement(349015..349017)
                     /gene="rplM"
                     /locus_tag="BT0339"
                     /note="L3 interface [polypeptide binding]; other site"
                     /db_xref="CDD:238230"
     gene            complement(349400..350185)
                     /locus_tag="BT0340"
                     /db_xref="GeneID:4642093"
     CDS             complement(349400..350185)
                     /locus_tag="BT0340"
                     /EC_number="1.8.4.11"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide methionine sulfoxide reductase"
                     /protein_id="YP_945344.1"
                     /db_xref="GI:119953135"
                     /db_xref="GeneID:4642093"
                     /translation="MYNRSLFSCFPIIKRARFFYLYDIHGNRYLDLYLNGGLNFLGHR
                     VQGLNLILKQTFSRGLTASYPSVFRKQFENVLFSFFKEAGFVCIFKFERDARDFLLSL
                     TDQCCFSSPWEEKQGIYEFKAGFNNFRYPMLVKIPMPGCMSINIAIVDNLSRKIEFRD
                     SFDALTLAVARHMLTKILSYEKSTKINFNIFATPIFKLINRYMFPLYKSEYHNEIFNE
                     YLKNGYLISPFFDVPSLVPLKFSKGDLDGFHKVSLKLQDKFGC"
     misc_feature    complement(<349985..350155)
                     /locus_tag="BT0340"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     gene            complement(350178..351635)
                     /gene="gatB"
                     /locus_tag="BT0341"
                     /db_xref="GeneID:4642112"
     CDS             complement(350178..351635)
                     /gene="gatB"
                     /locus_tag="BT0341"
                     /EC_number="6.3.5.-"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     B"
                     /protein_id="YP_945345.1"
                     /db_xref="GI:119953136"
                     /db_xref="GeneID:4642112"
                     /translation="MEYKLLVGLEVHVQLGLKTKAFCGCKNDFGGIPNSRTCPTCLGL
                     PGALPSINKELISSAILAGHATNSKIKNIIKFDRKHYAYPDLPKGYQISQNDAPICEN
                     GFIFIETCSGLKKINIIRIHMEEDSGKSLHLLESENRSYIDFNRSGAPLLEIVSNPDI
                     NNGEEAVAYLSALREIFRYLDLSDCNMENGSFRCDVNVNLLINENGVEYKTPISEIKN
                     LNSFKSVKLAIDYEKSRQKEEWILHRRTFESVGKHTMGFDDKKGITVLQRSKETVADY
                     RYIKDPDLPLIKLDDSYIESIKSNRMVELPFDTRVRLKEQYGLSDFDVVTLTADKNLV
                     KYFEEAAIASSDPKRVANWILSEVLSVLNDREMNILDFNLPPSYISELVEFIVNDRVS
                     GKIAKEIFLEMLERNVSSAIIINEKNLAQISDISFIESVVFEVLNENPKSIELYKKGK
                     SHAIKFMMGQIMRKTSGRVNPVLANEILMNKLRDV"
     misc_feature    complement(350190..351635)
                     /gene="gatB"
                     /locus_tag="BT0341"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit B;
                     Validated; Region: gatB; PRK05477"
                     /db_xref="CDD:235489"
     misc_feature    complement(350745..351626)
                     /gene="gatB"
                     /locus_tag="BT0341"
                     /note="GatB/GatE catalytic domain; Region: GatB_N;
                     pfam02934"
                     /db_xref="CDD:251629"
     misc_feature    complement(350190..350630)
                     /gene="gatB"
                     /locus_tag="BT0341"
                     /note="GatB domain; Region: GatB_Yqey; smart00845"
                     /db_xref="CDD:197913"
     gene            complement(351625..353070)
                     /gene="gatA"
                     /locus_tag="BT0342"
                     /db_xref="GeneID:4642124"
     CDS             complement(351625..353070)
                     /gene="gatA"
                     /locus_tag="BT0342"
                     /EC_number="6.3.5.-"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     A"
                     /protein_id="YP_945346.1"
                     /db_xref="GI:119953137"
                     /db_xref="GeneID:4642124"
                     /translation="MDFRGLSLIKIKELILARRCKIYDIVLFYKELYEANKDINGYIE
                     FFDDSLELAKKYDELLGKGEGQNLPLIGMPIAVKDNISIKNKALTCASELLQGYVSPY
                     DATVIKRLKDSGAIMIGRTNMDEFAMGSSCEFSYYGVTLNPLNKEYVVGGSSGGSGAV
                     VAANQAPFALGSDTGGSVRLPASFSSLIGFKPSYGGLSRYGLASYASSLDQIGFFANS
                     IDDVALILKYTCGIDKMDATSIDLIQDPYPLLSKSLAGTKLAVIKELSEDLMEPEVAC
                     EFSKFKSALLNRGVEIHEVSIEAVNFVLSLYYSLSPVEAASNLARYTCLHYGKRLNDE
                     LNLNDFYYRHRSLFLREEVKRRIVLGNYLLSEGYDLQYYVKACKIVENVLIPKFNEIF
                     NNYSYIITPTSFVKPFKIGENFDNPIKMYYSDMCTVIANLIGAPALSIPFSQDDRGLP
                     IGMQIIGQVKRDFDLLSFAKNVIEELGLNGI"
     misc_feature    complement(351661..353028)
                     /gene="gatA"
                     /locus_tag="BT0342"
                     /note="aspartyl/glutamyl-tRNA amidotransferase subunit A;
                     Reviewed; Region: gatA; PRK00012"
                     /db_xref="CDD:234572"
     gene            complement(353082..353366)
                     /gene="gatC"
                     /locus_tag="BT0343"
                     /db_xref="GeneID:4642313"
     CDS             complement(353082..353366)
                     /gene="gatC"
                     /locus_tag="BT0343"
                     /EC_number="6.3.5.-"
                     /note="allows the formation of correctly charged
                     Asn-tRNA(Asn) or Gln-tRNA(Gln) through the transamidation
                     of misacylated Asp-tRNA(Asn) or Glu-tRNA(Gln) in organisms
                     which lack either or both of asparaginyl-tRNA or
                     glutaminyl-tRNA synthetases; reaction takes place in the
                     presence of glutamine and ATP through an activated
                     phospho-Asp-tRNA(Asn) or phospho-Glu-tRNA; some Mycoplasma
                     proteins contain an N-terminal fusion to an unknown
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl/glutamyl-tRNA amidotransferase subunit
                     C"
                     /protein_id="YP_945347.1"
                     /db_xref="GI:119953138"
                     /db_xref="GeneID:4642313"
                     /translation="MRDIRDIRLEDSLKLSLLRLSKNEEREFAIKFEKIIGMLNKISE
                     FEIKDGIQKEACNFSVLRNDEILPSLAIESIKNFSNVFVDGYFSSPKVLG"
     misc_feature    complement(353085..>353297)
                     /gene="gatC"
                     /locus_tag="BT0343"
                     /note="Glu-tRNAGln amidotransferase C subunit; Region:
                     Glu-tRNAGln; cl00495"
                     /db_xref="CDD:260461"
     gene            complement(353376..355469)
                     /locus_tag="BT0344"
                     /db_xref="GeneID:4642325"
     CDS             complement(353376..355469)
                     /locus_tag="BT0344"
                     /EC_number="3.6.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase II"
                     /protein_id="YP_945348.1"
                     /db_xref="GI:119953139"
                     /db_xref="GeneID:4642325"
                     /translation="MDKIEKFLFSLNSYQKQIVLDDTKNPILVLAGPGSGKTRVITAK
                     IAHLIKEMQLKPEEILALTFTNKAANEMNLRLNYLFDFNKALHIQTFHSFGAWLLRLY
                     FKEFDKNYDSNFTIWDTNDVVKFVKQIGLASTIELSKHVASFILKYKENCFLDNYCGL
                     DEKSYKDIKFYEQEKSKNNAFDFADLILKAVLMLRDCEDVKMRVQKKFKAIFVDEYQD
                     TNYTQFLFLKELYCKDMHFMVVGDEDQSIYSFRGARIENILEFEKIFDNVSKYYLVQN
                     YRSSLSIVNVANDVISKNRNRYEKVISTENKMGKKIRFFVFRNPAEEAEYFSNFLIEN
                     QLETAVLYRFNYQSLQFEKSFFKHNIPHKILGSIRFYEREEIKDVISLLRLFVNKKDK
                     ISFLRVINKPARGIGKTTTNKIIAMLNDRNVNFDLILASRKVADSLKGKAKDSLVAFL
                     NLYDKLAESIQKDVYVNLSEFIKNVVIRSGFWDYYQKFDGDEKSRNIDELISSGVEYS
                     GSFEGLVIFLENSSLSPLIHGDSKSSILLSSIHGVKGLEFDRVIISGLEKGLLPAEIE
                     ELTGERLEEERRLFYVAITRAKFELIVTMNLQRFFGGMLRNTAMSVFFQDISKDNYDI
                     VFVPEYLKDNFKYFFSKSGNKSFNIGDYITYNGENGIVVDKWYQNGEPFIKINLRNGR
                     KAILSSSYIKGLAKI"
     misc_feature    complement(353580..355442)
                     /locus_tag="BT0344"
                     /note="Superfamily I DNA and RNA helicases [DNA
                     replication, recombination, and repair]; Region: UvrD;
                     COG0210"
                     /db_xref="CDD:223288"
     misc_feature    complement(355209..355397)
                     /locus_tag="BT0344"
                     /note="Part of AAA domain; Region: AAA_19; pfam13245"
                     /db_xref="CDD:257601"
     misc_feature    complement(<354528..>354695)
                     /locus_tag="BT0344"
                     /note="Restriction endonuclease fold toxin 3; Region:
                     Tox-REase-3; pfam15647"
                     /db_xref="CDD:259777"
     misc_feature    complement(353688..>353849)
                     /locus_tag="BT0344"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; cl19402"
                     /db_xref="CDD:267755"
     gene            complement(355469..356668)
                     /locus_tag="BT0345"
                     /db_xref="GeneID:4642346"
     CDS             complement(355469..356668)
                     /locus_tag="BT0345"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane associated protein"
                     /protein_id="YP_945349.1"
                     /db_xref="GI:119953140"
                     /db_xref="GeneID:4642346"
                     /translation="MERNNFIRFGDFIKKARIDKGLTLEMISDDIRISVKYLKALEDS
                     NIELFPNEVLALGFLRTYSEYLGIDVWYVSSLFKEYKRRLNSSYIGIKTEDQNGSLNF
                     VNEGRLGGQYLDLSKIAFPKMIQILVGLVSIILLILLISNFSGIKQFLGNFFKANHAA
                     KRAPEVHEVLFDKESFWNVALGDGDFLSLVYGNTIANYRVSFMNDDLVVTNDLKNGRY
                     VFKLGKFREIDLSDNVKVKIVYDNYSQGKVRKAHVSLESFMLNIEYVLETSLSSRFNV
                     LNWGFEVNGPKSRVISEYPTVYSSQDISNIDLMINFLNDTFLRYADESNIYGKSLLVS
                     KGLPLNLKFKKSLILFLSRLSDVNIILQGKDITSILKSYGREIMAVQFFWLKTPGGFD
                     LKVSEVY"
     misc_feature    complement(355616..356644)
                     /locus_tag="BT0345"
                     /note="Predicted transcriptional regulator contains
                     Xre-like HTH domain [Function unknown]; Region: COG1426"
                     /db_xref="CDD:224343"
     misc_feature    complement(356462..356629)
                     /locus_tag="BT0345"
                     /note="Helix-turn-helix domain; Region: HTH_25; pfam13413"
                     /db_xref="CDD:257738"
     gene            complement(356680..357333)
                     /locus_tag="BT0346"
                     /db_xref="GeneID:4642358"
     CDS             complement(356680..357333)
                     /locus_tag="BT0346"
                     /codon_start=1
                     /transl_table=11
                     /product="outer-membrane lipoproteins carrier protein"
                     /protein_id="YP_945350.1"
                     /db_xref="GI:119953141"
                     /db_xref="GeneID:4642358"
                     /translation="MKKIILILCPCLIFAQVSANQYFENIYSNYQNIEDMQAKISLNI
                     KGLKQAGTLLYKSPDKFIVNLDSNNQVFVSDGEILTVYVPTLGTSFRQQLTMGKVGSG
                     FMNILSTEYSVSYTNSPNLEPLDESGGGNTENFIKLTFSRRLYKGAATIDSFMIAFTR
                     NGVIRRVIAYPTGGGREIIIDLLSVKFNVGIPDSRFKYDLPKTSNKVDNFLYDVKKT"
     misc_feature    complement(356704..357333)
                     /locus_tag="BT0346"
                     /note="Outer membrane lipoprotein-sorting protein [Cell
                     envelope biogenesis, outer membrane]; Region: LolA;
                     COG2834"
                     /db_xref="CDD:225390"
     gene            357499..358908
                     /locus_tag="BT0347"
                     /db_xref="GeneID:4642383"
     CDS             357499..358908
                     /locus_tag="BT0347"
                     /note="fibronectin-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="fibrinogen-binding protein"
                     /protein_id="YP_945351.1"
                     /db_xref="GI:119953142"
                     /db_xref="GeneID:4642383"
                     /translation="MSLNYSEINILLKEVPLKNSFLRKIKQPNHKTLIMELYNKETEK
                     KNFNILISLDPKKTRIHKTNKKFENTKPPLRFFEFLKSKVQNGKILEAYQIKNERIIL
                     IKVFKDKIIIFIFIKLWPSSPNIIATDANFKILDAYYRKPRSKEITGEIFTKAKEIIE
                     NNDITDKKEVKLKDGYNNEISYSEFIENYYDNLEIKETQAHNIELLKQKYEKEKINLE
                     KKINSLEKQINSIEKIEDQRKKGEMILSNINKIKKGMDEIILNNNNGEQIKIMLDKAL
                     LPKDNALKYFKEYKKNKNSLKIIQEQLEYAKTQYNTLISKTAYIDKTDCIIPTNEKTK
                     KQKITKKPSIGLHFISYGFEVVIGRNAKENDALLRNWAKGNDYWLHTRDYPGAYVFIR
                     SKKDKTPPLEVLIDAGNLCVFYTKPARQSGEADLYYTNVKYLRRIKGEKKGLVIPNRE
                     KNLNIKLDNKILNKLKNKN"
     misc_feature    357499..358899
                     /locus_tag="BT0347"
                     /note="Predicted RNA-binding protein homologous to
                     eukaryotic snRNP [Transcription]; Region: COG1293"
                     /db_xref="CDD:224212"
     misc_feature    358537..358806
                     /locus_tag="BT0347"
                     /note="Domain of unknown function (DUF814); Region:
                     DUF814; pfam05670"
                     /db_xref="CDD:253311"
     gene            359019..360452
                     /locus_tag="BT0348"
                     /db_xref="GeneID:4642397"
     CDS             359019..360452
                     /locus_tag="BT0348"
                     /EC_number="2.7.1.40"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     pyruvate"
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="YP_945352.1"
                     /db_xref="GI:119953143"
                     /db_xref="GeneID:4642397"
                     /translation="MIQKLTKIVATISDLRCDPEHIKELYEAGVNVIRLNTAHQSHDD
                     AIRVINNVRKVSNKIALMIDTKGPEVRTANIENPITVKIGDKIIISTSPINESNALQT
                     NYDGFVNEVPNGSTILIDDGELEMTVIEKLTDRLICKVKNDGQIKNKKSINTPGISLK
                     LQSVTEKDKGFIELAAKQNIDFIAHSFVRHAKDIQDVKDILNAAGNPDVKIIAKVENQ
                     EGIDNIEEIAKASYGIMVARGDMGVEIPAEDVPLAQIKITKTCIKYGVPVITATQMLH
                     TMIENPRPTRAEVSDVANAILNGTDAIMLSGETAYGKYPIEAVKMMTKIAIEVEKYRE
                     KTLFQDEIFHSKRIIRNYIIKCAIDAIKIMPVKAIIVDSLKGRTARIMATYRASVPLF
                     ITTNNERIARELSLSYGVYANLVDHNFKATTEFVVTSLEMLKTQKVVQDSDIVVIISG
                     NPNRDTNKGTEFMEINTVEEAIKGHNR"
     misc_feature    359019..360374
                     /locus_tag="BT0348"
                     /note="pyruvate kinase; Provisional; Region: PRK05826"
                     /db_xref="CDD:235619"
     misc_feature    359034..360374
                     /locus_tag="BT0348"
                     /note="Pyruvate kinase (PK):  Large allosteric enzyme that
                     regulates glycolysis through binding of the substrate,
                     phosphoenolpyruvate, and one or more allosteric effectors.
                     Like other allosteric enzymes, PK has a high substrate
                     affinity R state and a low...; Region: Pyruvate_Kinase;
                     cd00288"
                     /db_xref="CDD:238178"
     misc_feature    order(359034..359036,359196..359198,359220..359231,
                     359472..359477,359493..359495,359502..359516,
                     359559..359561,359583..359585,359604..359606,
                     359640..359642,359748..359750,359802..359807,
                     359817..359819,359913..359915,359919..359921,
                     360006..360008,360012..360017,360168..360170,
                     360174..360176,360180..360182,360213..360215,
                     360222..360227,360231..360233,360237..360245)
                     /locus_tag="BT0348"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238178"
     misc_feature    order(359118..359120,359124..359126,359208..359210,
                     359577..359579,359658..359660,359664..359666,
                     359736..359738,359832..359834)
                     /locus_tag="BT0348"
                     /note="active site"
                     /db_xref="CDD:238178"
     gene            360554..361210
                     /locus_tag="BT0349"
                     /db_xref="GeneID:4642874"
     CDS             360554..361210
                     /locus_tag="BT0349"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945353.1"
                     /db_xref="GI:119953144"
                     /db_xref="GeneID:4642874"
                     /translation="MISYGAYEFFLNNIALFKKVIAHNTKNVFIFSQTKENSQINISD
                     HQTWKFFNKTIDVNLDIINLIKNFEFTNTEDKIIENDHKIEIVLNFIKDITQDIKIIP
                     IILGKLKNQTLREFCTFLNPLITKEENSFIFLSHFISHSTHLNKSIQLSTTLKGLLST
                     PNLNSSTLLEYYNARKIFPENINAIIIIHKLFHKFEFINQQIINNDNEYSIIENILIN
                     "
     misc_feature    <360602..>360973
                     /locus_tag="BT0349"
                     /note="Subunit B of Class III Extradiol ring-cleavage
                     dioxygenases; Region: Extradiol_Dioxygenase_3B_like;
                     cl00599"
                     /db_xref="CDD:260521"
     gene            complement(361231..361509)
                     /gene="rpmB"
                     /locus_tag="BT0350"
                     /db_xref="GeneID:4642774"
     CDS             complement(361231..361509)
                     /gene="rpmB"
                     /locus_tag="BT0350"
                     /note="required for 70S ribosome assembly"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="YP_945354.1"
                     /db_xref="GI:119953145"
                     /db_xref="GeneID:4642774"
                     /translation="MGRECEITGKKTMFGNNVPRKGLSRKKGGGGQHIGVKTRRTFKV
                     NLINKKFFVPELGKSINIKVSASTLRSISKLGLSVFLKKNSKKIEDFI"
     misc_feature    complement(361243..361509)
                     /gene="rpmB"
                     /locus_tag="BT0350"
                     /note="50S ribosomal protein L28; Reviewed; Region: rpmB;
                     PRK00359"
                     /db_xref="CDD:234736"
     gene            complement(361519..363159)
                     /locus_tag="BT0351"
                     /db_xref="GeneID:4642784"
     CDS             complement(361519..363159)
                     /locus_tag="BT0351"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945355.1"
                     /db_xref="GI:119953146"
                     /db_xref="GeneID:4642784"
                     /translation="MYNFYSYFIILDLFENSRFYSERRVASLGLVDFLVSIFNRELTP
                     EQVKQRRLREVKNNLSKVGNFFNASKIQALPQFAKFIYNLYKAFMPFKFFVQRYRTSN
                     KIIHFVVEKYLNDNQKQALEYIYSFSSNDVVNFTPDISKNLDNNLNYLLNNITQEQIR
                     LIDETCGALDIFFDLASYQYYSIIKNFDSLFPENDFIYKPRFNTVSCGVILDDIKDFL
                     ECIYSIRDVSIWRNLYDILLEVYGDRDNFPIKPNVWLKILTSIIEINKNKEILYLIRY
                     VSGDPDYLPISGVKKAKAKAKLFFNDLSKHVSNERAKIEILQKNSKSKLLAEKLFPGM
                     TLVSLENYSERMHAKITSAIVNTTGYVYSDLLVYIKTHAVNFVKKELSDIINVLIIKG
                     QWKDMEVSREISNDIHSLVGVYSNLIDFDNNLGEQGTYGNRINSLLHRISVGDKSSEK
                     LLLNIIADINKKALILLNEYYLVIKSLERRLNDCLEDYFKPASEKEFIYNWKELDIEL
                     VKSYGNNVNFGSIIKNVVDSLNLFLKLMDLYLEKKNTV"
     gene            363202..364335
                     /locus_tag="BT0352"
                     /db_xref="GeneID:4642909"
     CDS             363202..364335
                     /locus_tag="BT0352"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945356.1"
                     /db_xref="GI:119953147"
                     /db_xref="GeneID:4642909"
                     /translation="MCIKKPILIIVFTLIFSCSRNDTITILTDNKIMPFYINQFNIQN
                     KTSFIIKYREHINMQTINEENAQVIISKNIDNININKNFKNIQQYYYSDYPILNNISE
                     KFAYRIVPLSFDVPILIYKNEYNIQKYIDIQNIKEIYKSFQKEKKIFISPYISENLFY
                     TISEINDINFYFGNNKPEYNEKKMSDMINHFKSFIDTNELELHKNFTEKYKYLNLEKI
                     LLQKKTILIAGLTNLTYYNSLNKDIKDKINFSYLTNKEKKSSICNINFMGVKEISTPI
                     EKFIQWILNQEVQKSLIKLKEKAKFNEHFGFANGFTPYKGLNLKLKHIIKKIPLFIID
                     ENYINKNSYIITKEQIEKENRMINELFLSNINNTKANEDHSSL"
     gene            complement(364320..366122)
                     /locus_tag="BT0353"
                     /db_xref="GeneID:4642169"
     CDS             complement(364320..366122)
                     /locus_tag="BT0353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945357.1"
                     /db_xref="GI:119953148"
                     /db_xref="GeneID:4642169"
                     /translation="MLYMKRELYTFVSKFFILLLLFICFVFCYTYFFGADYLDKHVLI
                     ATLFDTILSVYHYFNGFFIFFVLVYFIFLAKHETRLYLRDYKGYLFKKLSPFMFLFFI
                     IGIVFMFVFNSIMSYVLTQRSEYKYNYERYNLLAGQANAIVNEVKSIDINLSSNKTLD
                     VNELIEILQQKRKYLEELLRMYEKMRLISDNDELSINYYLTRSEYDRMPIYDVDLEKV
                     RKTLKLRLIKNLTKRDFQDIVNGFISKGDYSTANYFAYMGLVSTRDDEFAALLDLTFK
                     AINEYKNIEIEKKSLIFEEKQKNFLYLNTEKFKPAYYGFLRLHNLFPNDNEILSYKNK
                     SLEKLKDEYFFFDEIEKHYEHYGINDIFLFQPNSGNGTYDYIYMQKVVNTVSSYIKMI
                     KNFELIRFNRSGNIILHIKVPFATLKGNGVYQNVLDKKNENSDITATRMIVSLTDFDL
                     SNTKIININNDVNNLRLFANSGKDSIFLPIQVLLGAFNRVKTFNLILISVFSSSLFLM
                     MSPILLVFFGVMFTAVASKISFEFDSKLMIFLISLIIAIFSGIISLFINYLLLILIAL
                     FIQISVNIYISFILIFSILFFIVLHIIRVNYKEE"
     gene            complement(366129..367070)
                     /locus_tag="BT0354"
                     /db_xref="GeneID:4642409"
     CDS             complement(366129..367070)
                     /locus_tag="BT0354"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945358.1"
                     /db_xref="GI:119953149"
                     /db_xref="GeneID:4642409"
                     /translation="MLSILRFIFLISFRFIVMFVIFSLMFVCTSYLKYKFLQANLSIV
                     SFELYYDAYLYAFPLSLVVTFMRIAYPFNVKTLRVSGGFYGIIFIFILLLSYFGFLAS
                     ANFNSVFLDFHSRGEKIIKDGVVHFFDDKIVFYSDDVKSFGFKGVLKVEDNGFNEGDF
                     KTFSYDSDFSESDIMNFNANSFFTQKLYNDLINYVFSDLDTLNNFLFSLESFSLIFNI
                     FGFALLLFSFSYVFNLIFSSGLSFFLYPIFIILFFKVYNIYAIEFPESLDLIMGENVV
                     SNYVPFIFCVLTFFATYLISFIFKYIRVSEGFDNSLR"
     gene            complement(367105..367590)
                     /locus_tag="BT0355"
                     /db_xref="GeneID:4642420"
     CDS             complement(367105..367590)
                     /locus_tag="BT0355"
                     /codon_start=1
                     /transl_table=11
                     /product="CarD-like transcriptional regulator"
                     /protein_id="YP_945359.1"
                     /db_xref="GI:119953150"
                     /db_xref="GeneID:4642420"
                     /translation="MAFVLDQAVVYPMQGVGKIKNIQNKEFNGEFIDYYEIYFPFNEM
                     TFMVPVSRADDLGIRALVSKEKVEEVFNIIKDFEEQIDQKKIKDGSHDFYKQSDILST
                     AKLYKFLYTKSMQKELPFYEKRILNDFELILQHEISLALQISFEEAKQKIKEVLSMGK
                     S"
     misc_feature    complement(367123..367590)
                     /locus_tag="BT0355"
                     /note="CarD-like/TRCF domain; Region: CarD_CdnL_TRCF;
                     cl00588"
                     /db_xref="CDD:260515"
     gene            complement(367637..368230)
                     /locus_tag="BT0356"
                     /db_xref="GeneID:4642277"
     CDS             complement(367637..368230)
                     /locus_tag="BT0356"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945360.1"
                     /db_xref="GI:119953151"
                     /db_xref="GeneID:4642277"
                     /translation="MANLKDIYSKPDRIYFFGIPIDVFKSSDKLIGRFEYLVSYPYHS
                     MVIFIDCKSLLKFLFFKKFRNLVRNSSLVFSNSKLLRALCKFFKRIDIGCYDSNSILL
                     VLMSVLENTYKTCYIIDKDKIISKRNFLRLKESHKEINFIGYYDLKAVKRNKEMFFAN
                     INKLTPSMIISFCSDSYLEDLFYANKFGIRTNLSVFL"
     gene            complement(368223..368951)
                     /locus_tag="BT0358"
                     /db_xref="GeneID:4642279"
     CDS             complement(368223..368951)
                     /locus_tag="BT0358"
                     /note="in Escherichia coli RsmE methylates the N3 position
                     of the U1498 base in 16S rRNA; cells lacking this function
                     can grow, but are outcompeted by wild-type; SAM-dependent
                     m(3)U1498 methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="16S ribosomal RNA methyltransferase RsmE"
                     /protein_id="YP_945361.1"
                     /db_xref="GI:119953152"
                     /db_xref="GeneID:4642279"
                     /translation="MKQIVLDDTCLFDNDIIIDDVKIYHYLVDVRRVKVGDTLNVLLG
                     GREVRFAEISSIDNNLIKLSTLKVEMLKKRDFEVSIFISSLKGRKLDLSLRQVVEIGV
                     DHINIVNADNSVARIDMDDLEFKSTRFLKLINEALKQSGNTQVPSLNFYKNFFSISYS
                     PSVNYYVAHKEGVLLGCGDDISVFGKIGILIGPEGCFSKSEIDFFKKLNFKFVRFNTP
                     ILRADTAVVYSLAHFKLLLEGNNG"
     misc_feature    complement(368238..368951)
                     /locus_tag="BT0358"
                     /note="Diacylglycerol kinase catalytic domain; Region:
                     DAGK_cat; cl17465"
                     /db_xref="CDD:266706"
     gene            complement(368955..370385)
                     /locus_tag="BT0359"
                     /db_xref="GeneID:4642283"
     CDS             complement(368955..370385)
                     /locus_tag="BT0359"
                     /EC_number="3.4.21.102"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxy-terminal processing protease precursor"
                     /protein_id="YP_945362.1"
                     /db_xref="GI:119953153"
                     /db_xref="GeneID:4642283"
                     /translation="MKKKCLVFVYFVLALSISSSVIVESIFAQTDPSKGKMSASTYGQ
                     MMMDAFNFIKRNYVEPVDDEAIFEGALKGMFKALNDPYSQYLTKEDLVEISKTTEGNY
                     VGIGVSIVKKNVPVKSDSSVLDASYVMIVTAFEEGPAYKAGVKSGDYITDIDGKSTTL
                     MTIEQVGSLLKGKAGTKVKISVLRDKDLKLEFELVREKVDIQTVKHDVINKSVGYIKI
                     LSFNPNTNTYFKKAFEKLQAQNIKSLILDLRFNTGGYLQDAIEIADDILAEGLIVSTR
                     ARDSKVPVEYKASSSHIVPLDMPIVVLIDKHSASASEVLVGALKDNQRVYVIGEKSYG
                     KGVIQRILPFYTGGFKITNSKYYTPSGHSIHNIGIKPDLEVGEREFSETEVLAYRQIL
                     DKKLVEDFLNSRKNKKSITEKEIDAFVDKILKEHSIHNIDKDILGYYVFSQFYQDTHN
                     EMPIYNLHYDKPLRAAYEYLVKGTKN"
     misc_feature    complement(369183..370370)
                     /locus_tag="BT0359"
                     /note="Periplasmic protease [Cell envelope biogenesis,
                     outer membrane]; Region: Prc; COG0793"
                     /db_xref="CDD:223864"
     misc_feature    complement(369261..370256)
                     /locus_tag="BT0359"
                     /note="C-terminal processing peptidase; serine protease
                     family S41; Region: Peptidase_S41_CPP; cd07560"
                     /db_xref="CDD:143476"
     misc_feature    complement(369792..370082)
                     /locus_tag="BT0359"
                     /note="PDZ domain of C-terminal processing-,
                     tail-specific-, and tricorn proteases, which function in
                     posttranslational protein processing, maturation, and
                     disassembly or degradation, in Bacteria, Archaea, and
                     plant chloroplasts. May be responsible for...; Region:
                     PDZ_CTP_protease; cd00988"
                     /db_xref="CDD:238488"
     misc_feature    complement(order(369873..369878,369885..369890,
                     370059..370061,370065..370076))
                     /locus_tag="BT0359"
                     /note="protein binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238488"
     misc_feature    complement(order(369381..369383,369456..369458))
                     /locus_tag="BT0359"
                     /note="Catalytic dyad [active]"
                     /db_xref="CDD:143476"
     gene            370446..370874
                     /locus_tag="BT0360"
                     /db_xref="GeneID:4642284"
     CDS             370446..370874
                     /locus_tag="BT0360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945363.1"
                     /db_xref="GI:119953154"
                     /db_xref="GeneID:4642284"
                     /translation="MLKTNNSKTKRIITGLVLILQTVASILILLALYGFAERTIFVNN
                     SSIKFMIAFIIFSPELCISILTTNYILYEQFKILHNLIIITKTFQIVMVFLLIILGLS
                     LDLLYVYQPWIFMLLGIIITYTIFNAMILILIKIKDKITG"
     gene            370879..372012
                     /locus_tag="BT0361"
                     /db_xref="GeneID:4642287"
     CDS             370879..372012
                     /locus_tag="BT0361"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_945364.1"
                     /db_xref="GI:119953155"
                     /db_xref="GeneID:4642287"
                     /translation="MIIIPVASGKGGVGKSLFSTNIAICLANEGKKVLLVDLDLGGSN
                     LHSMLNIIPKKSIGTFLKTKIPFKDVIIESGIKNLSFIAGDSDIPELANIAIFQKKKI
                     INNLKNLSYDYLIIDLGAGTTFNTIDFFLISNRGVIITIPTVTAIMNAYLFLKNAIFR
                     LIAKIFTKETKAYKLISDIKKDSSDLQRIYIPNLLLKIETYDPESYEKFMKKFSQFSP
                     FIIFNMLNKPDDIKKIKKILKSAKDYLNINLQSIGSIYKDELIDKALNHKIPITIYKP
                     TSLTSKSIKKIAKKLIELETIINDVELLSEDDLNESYHFVIQEAQDEYLEKYAYLESL
                     LMNKTIDNNAIIDIIKSQQKEIATLRKQNIMFKKKLFAQLKKD"
     misc_feature    370885..371646
                     /locus_tag="BT0361"
                     /note="FleN is a member of the Fer4_NifH superfamily. It
                     shares the common function as an ATPase, with the
                     ATP-binding domain at the N-terminus. In Pseudomonas
                     aeruginosa, FleN gene is involved in regulating the number
                     of flagella and chemotactic motility by...; Region:
                     FleN-like; cd02038"
                     /db_xref="CDD:238995"
     misc_feature    370888..371475
                     /locus_tag="BT0361"
                     /note="CobQ/CobB/MinD/ParA nucleotide binding domain;
                     Region: CbiA; pfam01656"
                     /db_xref="CDD:250775"
     misc_feature    370900..>371229
                     /locus_tag="BT0361"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    370903..370926
                     /locus_tag="BT0361"
                     /note="P-loop; other site"
                     /db_xref="CDD:238995"
     gene            372023..372982
                     /locus_tag="BT0362"
                     /db_xref="GeneID:4642290"
     CDS             372023..372982
                     /locus_tag="BT0362"
                     /EC_number="2.4.99.-"
                     /note="transfers the N-acyl diglyceride moiety to the
                     prospective N-terminal cysteine in prolipoprotein"
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="YP_945365.1"
                     /db_xref="GI:119953156"
                     /db_xref="GeneID:4642290"
                     /translation="MPNYINYPSWLHPEIIKGIPITWYSLSYIIIIIISYKFIWYQIQ
                     TDKINIEKSDYEKLMFSLVMGAIIGARLTSTLIYDRSGIYYTHPWLIFLPFDRNWNFT
                     GFRGMAIHGGFFGVIIAPIIMINTKLKNTNIKKYFRKITDYGAIAFSSGYILGRFANF
                     ANAELYGRPMKGGIIFPNAELFKVSQKGVREFAESIGLEILPHDLFINLPRIPSQLIE
                     GLFEGTVTFLLLWFIFRKIKRYDGFIFGVYIILYGLFRFFIEYLREPDKEIGFVITYK
                     KPESILDFSFLNISIGQIFSLILILSGIIWLSWAKTRSEKLKK"
     misc_feature    372023..372976
                     /locus_tag="BT0362"
                     /note="Prolipoprotein diacylglyceryl transferase; Region:
                     LGT; cl00478"
                     /db_xref="CDD:260451"
     gene            373034..375025
                     /locus_tag="BT0363"
                     /db_xref="GeneID:4642293"
     CDS             373034..375025
                     /locus_tag="BT0363"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory box/GGDEF family protein"
                     /protein_id="YP_945366.1"
                     /db_xref="GI:119953157"
                     /db_xref="GeneID:4642293"
                     /translation="MKNPNAIVISEGTINDNDITKIKSIFKISQIVKSRKNISSEYIK
                     QSNIKFAIIYNHKRPIDFSINMANDLKSINNIHSIIIDNKSIDEAIYRPNYIEILKNI
                     SELNDKNKLIQQKKLYYDNNNANLDFFLNLSELIQEIVIITNTDNDIIYINEKGSKEL
                     ELPIKIGGKTNKISDINIMDLEKNTKIDLSYNINDIPEFKNILITDCLLKIKNNKKLI
                     VDLFISTIAQNNIDKLITIKDISELKSKHNIQDLTIIDQQTDLYNIKGLEKLLINQIE
                     SSYKKIYLFDLDLHINTECKYKDKKANSDLKILKKITSRIMSFYSEYIFRLKDNNLIV
                     IISTRGGEQRLISIAEEIKKTISRELKKEGLIIFKFNIGIIEVNLKEDIETKISKLKI
                     ATKISDEYKDSTPILYKDELPETILIKKQNKIFEYIVKAIKNDFFSLYYQKITPLKKD
                     LKPKIEILTRLFDYTGTPIPNGNVFSLIDKYNLTVEVDKLVVTKALREYTNFVAKNGA
                     HIFSINISPYSLKSKNFRMFLKETLLTSHVPLQNICLEITETGILENFELINTYFNEL
                     KTFGIKLALDDFGSGYTSLSYIKILPIDIIKIDGSFIQVINSSQTDLVIIKSIKDIAD
                     TKKIKIIAEFVSNEEILKKINEIGIDYGQGFLWHKPEPI"
     misc_feature    374315..375022
                     /locus_tag="BT0363"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            375197..376573
                     /locus_tag="BT0366"
                     /db_xref="GeneID:4642301"
     CDS             375197..376573
                     /locus_tag="BT0366"
                     /EC_number="3.4.11.-"
                     /note="catalyzes the removal of amino acids from the N
                     termini of peptides"
                     /codon_start=1
                     /transl_table=11
                     /product="putative aminopeptidase 1"
                     /protein_id="YP_945367.1"
                     /db_xref="GI:119953158"
                     /db_xref="GeneID:4642301"
                     /translation="MTKQNPWTSLNEEDRNNILEFTQKYKKFLSTVKTEREATNYATQ
                     RAKEKGFINACEKQELKAGDKIFYTCRNKNIALVFIGKEPIENGMNFIVSHTDSPRLD
                     AKPSPITEENEFTMMKTNYYGGIKKYQWLSLPLSIRGIIFLQNGEKVEINIGDDKNDP
                     VFVIPDILPHLDRKVQRDKKADDIIEGENLKIIIGSLPIETKEKEKVKSATLKLIKEK
                     YKIEEDDFVSAEIEIVPAGEAKDVGFDRALIGAYGQDDRVCVYTSLEAILNLEETPSK
                     TAICFLVDKEEIGSTGSTGLNSRYLEYFVSDIIFKLEQNKYNNLFVQKVLWNSKSISA
                     DVCGAINPLFKSVHDEQNAPKLGYGISIMKYTGHGGKIMASDADAELVSYVRNLLNKN
                     KIAWQVATLGKVDEGGGGTVAKFLAHYGIRTIDIGPGVISMHSPFEITSKFDIYTSYT
                     AYQAFFKG"
     misc_feature    375233..376567
                     /locus_tag="BT0366"
                     /note="M18 Peptidase Aminopeptidase I; Region: M18_API;
                     cd05659"
                     /db_xref="CDD:193535"
     misc_feature    order(375302..375304,375407..375409,375413..375415,
                     375500..375502,375506..375514,375518..375523,
                     375527..375529,375536..375538,375545..375568,
                     375572..375583,375590..375592,375596..375598,
                     375620..375628,375653..375658,375662..375667,
                     375671..375685,375689..375715,375755..375763,
                     375767..375769,375773..375787,375818..375820,
                     375824..375826,375836..375841,375863..375871,
                     375875..375886,375905..375907,375914..375940,
                     376055..376060,376067..376078,376085..376093,
                     376103..376105,376112..376117,376154..376156,
                     376160..376165,376172..376177,376208..376210,
                     376214..376231,376250..376252,376259..376261,
                     376286..376291,376304..376315,376325..376336,
                     376340..376345,376352..376357,376364..376366,
                     376382..376384,376388..376390,376397..376411,
                     376418..376420,376436..376438,376445..376447,
                     376454..376462,376487..376501,376505..376507,
                     376511..376513)
                     /locus_tag="BT0366"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:193535"
     misc_feature    order(375479..375481,375959..375964,376052..376057,
                     376199..376204,376208..376210,376283..376285,
                     376319..376321,376421..376426,376493..376498)
                     /locus_tag="BT0366"
                     /note="putative active site [active]"
                     /db_xref="CDD:193535"
     misc_feature    order(375479..375481,375959..375961,376052..376057,
                     376199..376201,376496..376498)
                     /locus_tag="BT0366"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193535"
     gene            376570..376845
                     /locus_tag="BT0367"
                     /db_xref="GeneID:4642302"
     CDS             376570..376845
                     /locus_tag="BT0367"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945368.1"
                     /db_xref="GI:119953159"
                     /db_xref="GeneID:4642302"
                     /translation="MTNMNKETIKTSEHILECFGGIANIKQVDKDLTRIKILVDSNSL
                     VKRENLTEDHNIIGAIKSNEFTEIVMNFEIIDDVYSNIVYMMNKKIQ"
     misc_feature    376597..376836
                     /locus_tag="BT0367"
                     /note="Phosphotransferase system IIB components
                     [Carbohydrate transport and metabolism]; Region: PtsG;
                     COG1264"
                     /db_xref="CDD:224184"
     gene            complement(376860..377912)
                     /gene="gpsA"
                     /locus_tag="BT0368"
                     /db_xref="GeneID:4642304"
     CDS             complement(376860..377912)
                     /gene="gpsA"
                     /locus_tag="BT0368"
                     /EC_number="1.1.1.94"
                     /note="catalyzes the NAD(P)H-dependent reduction of
                     glycerol 3-phosphate to glycerone phosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase"
                     /protein_id="YP_945369.1"
                     /db_xref="GI:119953160"
                     /db_xref="GeneID:4642304"
                     /translation="MKISIVGAGAWGTAIAKVLSDKFKDNVLIWSFEEDVRDSINNDH
                     ENVKYLKDIKLADNLVASSDLHDVVDQADYVFVVTPSLYTLNVLNKLKGMYTTKKFNL
                     AILTKGFITIDGRPCTIIDVAESILSDYKDEITYIAGPSHAEEVGLGIITGLVAASKN
                     RANAFEFINLFSDTSISMFYSDDILGVQIASALKNIFAIAFGILDEYKIENPNLIGNN
                     TESFLFSVSLNDMKNIAFKLGSCNAETFLFLAGSGDLDVTCRSIFGRNRRFGREIVSK
                     NILEGLAGINDLINNIHKIGYLPEGVIAANEVALLFKCLGSDSSYHNLASIVYKILNK
                     ELRPEAVIDYIRNFKV"
     misc_feature    complement(376878..377912)
                     /gene="gpsA"
                     /locus_tag="BT0368"
                     /note="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase; Validated; Region: gpsA; PRK00094"
                     /db_xref="CDD:234629"
     misc_feature    complement(377421..377909)
                     /gene="gpsA"
                     /locus_tag="BT0368"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     N-terminus; Region: NAD_Gly3P_dh_N; pfam01210"
                     /db_xref="CDD:250446"
     misc_feature    complement(376878..377369)
                     /gene="gpsA"
                     /locus_tag="BT0368"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     C-terminus; Region: NAD_Gly3P_dh_C; pfam07479"
                     /db_xref="CDD:254224"
     gene            complement(377937..380225)
                     /locus_tag="BT0369"
                     /db_xref="GeneID:4642833"
     CDS             complement(377937..380225)
                     /locus_tag="BT0369"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ATP-binding subunit
                     ClpA"
                     /protein_id="YP_945370.1"
                     /db_xref="GI:119953161"
                     /db_xref="GeneID:4642833"
                     /translation="MYNRRALNNLFFKSFLFFMKRKHLVFTEEHIFYSLISDEKIKEL
                     LSLCTLDFYSFNKILEKFFKKLPLRDSDISDYLFKMNDLYQEIVDTIFYYKKPYRLQE
                     KDLLWVLIRKRKNIILDALLKSGFSLTIFDKIIEVYDYLGSDLDLNSSENEKFIANDL
                     FGKEIDKDGGLSIFEEDYLKLEQSDDLSDNDNLVEDFLVNVIDSLEPSLDKNPLIGRE
                     EELCELTQVMLRKYKSNPIVFGEPGVGKTILLQGLAYMIKVGQVPQELVGYEVYSLDI
                     GRLISGTRYRGDLEDRVNKLLDFLYLKKKVILFIDEIHMIVGAGATSFSNIDVSNLLK
                     PILTLGKVKLIGATTKYEYQKFFLRDKALMRRFHSIELKEPSFEDTYLILKGSKEQYE
                     KHHNVGYTDEAIWASITMSKYIKDRFLPDKAFDLLDGLGAKFKLEGNKKVITGDDVKI
                     FVKSMIGTNVFNFDDYDQNLLINLERKIRESMIIDENILSDLILNIKLLRIKFLLKNN
                     TLGIFILMGSSDVDKNKLSCILSEELKIPKLTLGMSEYGDFDGINRLIGPVYGSESYD
                     EPTKFFKFLSESSSSIIVLSDFDKSSKRVIDFFFEGFNTGRLFDSLGRSVSLSDSIII
                     LDIDIKHREFDGIGFKTETIDGRSLLEKRFSTQLLDLVDHIFFFKPVGEDDFEKVIIE
                     EMNSFIKILKNEKVDVFFEENIVDYFQNKTYRSGLGIKSVRKIVLKEIGGLLVNDMIS
                     KKFKENDKIRVFLDETIKYELL"
     misc_feature    complement(377961..380225)
                     /locus_tag="BT0369"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    complement(379116..379583)
                     /locus_tag="BT0369"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(379485..379508)
                     /locus_tag="BT0369"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(379179..379181,379293..379295,
                     379482..379505))
                     /locus_tag="BT0369"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(379290..379307)
                     /locus_tag="BT0369"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(379128..379130)
                     /locus_tag="BT0369"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(380236..381456)
                     /locus_tag="BT0370"
                     /db_xref="GeneID:4642832"
     CDS             complement(380236..381456)
                     /locus_tag="BT0370"
                     /EC_number="6.1.1.1"
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="YP_945371.1"
                     /db_xref="GI:119953162"
                     /db_xref="GeneID:4642832"
                     /translation="MNLALEILEKRGFLKQCTNLEALSTLMDKERVVFYVGVDATSTS
                     LHIGHLIPFMVMAHLQRQGHIPIALVGGGTTKIGDPSGKDAMRKILSKEDIEKNVKAI
                     RAQLLRIIDFSHGYILDNSAWLDNINYIEFLRDIGVCFSVNRMLGFETYKRRIKDGLS
                     FIEFNYQLLQSYDFYMLNKIKNCKLQIGGDDQWGNIVSGVDLIKKKLGTEVFGLTLPL
                     ITRSDGKKMGKSEKGAVYLDAELYSVYDFYQYFRNVPDLDVKNFLYLFTFLGDDEIEH
                     MSSVKGYLLNKAKETLAFEITKIVHGEDAALKASSAARAAFKGSEGDRADIPFFKLAL
                     DSLEGSILLIDLMVLSKVVSSKSEARRLINSGGVYIDKVRIGDQDYCLNKDNFINGEI
                     ELKIGKKRILRVIL"
     misc_feature    complement(380239..381456)
                     /locus_tag="BT0370"
                     /note="tyrosyl-tRNA synthetase; Validated; Region:
                     PRK05912"
                     /db_xref="CDD:235645"
     misc_feature    complement(380560..381357)
                     /locus_tag="BT0370"
                     /note="catalytic core domain of tyrosinyl-tRNA synthetase;
                     Region: TyrRS_core; cd00805"
                     /db_xref="CDD:173902"
     misc_feature    complement(order(380770..380781,380800..380805,
                     380881..380883,380890..380895,380899..380901,
                     380938..380940,380947..380949,380959..380961,
                     381310..381315,381319..381321,381340..381348,
                     381352..381354))
                     /locus_tag="BT0370"
                     /note="active site"
                     /db_xref="CDD:173902"
     misc_feature    complement(381310..381321)
                     /locus_tag="BT0370"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173902"
     misc_feature    complement(order(380950..380955,380962..380967,
                     380971..380973,381019..381024,381028..381039,
                     381043..381048,381055..381063,381067..381072,
                     381226..381231,381238..381240))
                     /locus_tag="BT0370"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173902"
     misc_feature    complement(380767..380781)
                     /locus_tag="BT0370"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173902"
     misc_feature    complement(380317..380430)
                     /locus_tag="BT0370"
                     /note="S4 domain; Region: S4; pfam01479"
                     /db_xref="CDD:250650"
     gene            complement(381453..382799)
                     /locus_tag="BT0371"
                     /db_xref="GeneID:4642307"
     CDS             complement(381453..382799)
                     /locus_tag="BT0371"
                     /EC_number="6.1.1.14"
                     /note="Catalyzes a two-step reaction, first charging a
                     glycine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase"
                     /protein_id="YP_945372.1"
                     /db_xref="GI:119953163"
                     /db_xref="GeneID:4642307"
                     /translation="MFNMIKIEDIISLAKRKGFVFQSSEIYGGLSGVWDYGPLGIELK
                     KNIQKEWWNTMVYLHENVVGLDSSILMRPEVWEASGHVDSFLDLLVDCKNCKNRFRID
                     SIDLSNGCSSCNSIGTFTAPRSFNLMFKTNIGAVEDSSNEIYLRPETAQGIFVNFRNV
                     LDSTRLKVPFGIAQVGKAFRNEIVAKNFIFRTCEFEQMEMQFFVHPNQMSDWYYYWQQ
                     KRMNFFIETLGIRSDNLRFKEHKGDELAHYAKAAVDIEYKFPFGFQEIEGIHNRGNYD
                     LSQHAKFCGKPKLFEYHDLTSGDKYIPYVIETSLGLTRSVLMTLCDAYAHEELEGEGK
                     RIVLRLHPKLAPYKVAILPLVKKDGLPELARKVFMQFSDDFYMFYDDNGTIGKRYRRQ
                     DEIGTPYCVTVDYDTIENRTVTLRDRDSMAQIRIPIDDLYSYIRTEILNYKGVANR"
     misc_feature    complement(381483..382790)
                     /locus_tag="BT0371"
                     /note="glycyl-tRNA synthetase; Provisional; Region:
                     PRK04173"
                     /db_xref="CDD:235240"
     misc_feature    complement(381840..382772)
                     /locus_tag="BT0371"
                     /note="Glycyl-tRNA synthetase (GlyRS)-like class II core
                     catalytic domain. GlyRS functions as a homodimer in
                     eukaryotes, archaea and some bacteria and as a
                     heterotetramer in the remainder of prokaryotes. It is
                     responsible for the attachment of glycine to the 3...;
                     Region: GlyRS-like_core; cd00774"
                     /db_xref="CDD:238397"
     misc_feature    complement(order(381963..381965,382218..382220,
                     382311..382313,382323..382325,382404..382415,
                     382584..382586,382590..382598,382605..382610,
                     382626..382628,382644..382646,382668..382670,
                     382746..382748))
                     /locus_tag="BT0371"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238397"
     misc_feature    complement(382590..382613)
                     /locus_tag="BT0371"
                     /note="motif 1; other site"
                     /db_xref="CDD:238397"
     misc_feature    complement(order(381858..381860,381867..381869,
                     381873..381875,381879..381881,381984..381986,
                     382002..382007,382203..382205,382209..382211,
                     382215..382217,382224..382232,382254..382256,
                     382260..382262,382350..382352,382356..382358))
                     /locus_tag="BT0371"
                     /note="active site"
                     /db_xref="CDD:238397"
     misc_feature    complement(382254..382265)
                     /locus_tag="BT0371"
                     /note="motif 2; other site"
                     /db_xref="CDD:238397"
     misc_feature    complement(381858..381869)
                     /locus_tag="BT0371"
                     /note="motif 3; other site"
                     /db_xref="CDD:238397"
     misc_feature    complement(381483..381842)
                     /locus_tag="BT0371"
                     /note="GlyRS Glycyl-anticodon binding domain. GlyRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     GlyRS_anticodon; cd00858"
                     /db_xref="CDD:238435"
     misc_feature    complement(order(381552..381554,381558..381560,
                     381588..381590,381612..381614,381630..381632,
                     381735..381740))
                     /locus_tag="BT0371"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238435"
     gene            complement(382822..384345)
                     /gene="gltX"
                     /locus_tag="BT0372"
                     /db_xref="GeneID:4642309"
     CDS             complement(382822..384345)
                     /gene="gltX"
                     /locus_tag="BT0372"
                     /EC_number="6.1.1.17"
                     /note="Charges one glutamine molecule and pairs it to its
                     corresponding RNA trinucleotide during protein
                     translation"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="YP_945373.1"
                     /db_xref="GI:119953164"
                     /db_xref="GeneID:4642309"
                     /translation="MIFQKRISFTKRGYVVNIRVRYAPSPTGLQHIGGIRTALFNYFF
                     AKSCGGKFLLRIEDTDQTRYFKEAEEDLYQSLEWLGIDFDEGPTCGGPYAPYVQSQRT
                     EIYQKYAKQLVELGSAYYCYCTPERLERIRKIQTVNKMAPGYDRHCRNLSESEVRDVL
                     SLGITPVIRFKIPLDGETCFNDILLDKITWANKDISPDPVLLKSDGLPTYHLANVIDD
                     HLMEVSHVLRAQEWISSGPLHVLLYSAFGWNPPIYCHLPMVMGSDGQKLSKRHGATAL
                     KQFIDDGYLPEAIINYITLLGWSYDDKSEFFTKDELRRLFSIERVNKSPAVFDYNKLD
                     FFNSHYIREKGNNELAKLIIPFLQKAGYIKEDINSFDEQKLILLVSLIKPRIRKLSES
                     VTMLKFFYEDIKTWNLDEFLGKEKTAGDICLLLEKIKPLLEGFETRILSENEKIFYNF
                     AKENNLKIGEVLLPIRIAVLGSKVSPPLFDSLQLLGKTKVFNRINQAQQFLRRHECK"
     misc_feature    complement(382855..384297)
                     /gene="gltX"
                     /locus_tag="BT0372"
                     /note="glutamyl-tRNA synthetase; Reviewed; Region: gltX;
                     PRK01406"
                     /db_xref="CDD:234953"
     misc_feature    complement(383317..384297)
                     /gene="gltX"
                     /locus_tag="BT0372"
                     /note="catalytic core domain of discriminating
                     glutamyl-tRNA synthetase; Region: GluRS_core; cd00808"
                     /db_xref="CDD:173905"
     misc_feature    complement(order(383545..383550,383572..383577,
                     383650..383655,383659..383664,383704..383706,
                     383716..383718,384175..384177,384235..384240,
                     384244..384249,384271..384279,384283..384285))
                     /gene="gltX"
                     /locus_tag="BT0372"
                     /note="active site"
                     /db_xref="CDD:173905"
     misc_feature    complement(384244..384255)
                     /gene="gltX"
                     /locus_tag="BT0372"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173905"
     misc_feature    complement(383536..383550)
                     /gene="gltX"
                     /locus_tag="BT0372"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173905"
     gene            complement(384314..385093)
                     /locus_tag="BT0373"
                     /db_xref="GeneID:4642831"
     CDS             complement(384314..385093)
                     /locus_tag="BT0373"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945374.1"
                     /db_xref="GI:119953165"
                     /db_xref="GeneID:4642831"
                     /translation="MVDRILFIFNIIFFVAFLYFVYLLEIFKFSNFLDFIFLHCSFIL
                     TFIVFIFIFNIVYSKFLYSRLYFMLNGIEHTYTFLKLKILRKTLKSVFDISLLLKIIL
                     IKQDKKSLDEIYFYLKDTKMSNKTIIELYSICISFREKEKASGLIANHAYSKNKWLRY
                     CVALNTIADEDYEKLSNEINFLKRYFLRGDPIFTVYFYYVLKRSNLEYQLVEKNRLEI
                     RDKYFKYKDRLNVKHTRLLNSNLFFVVFYYIYDISKKDIFY"
     gene            385224..386363
                     /locus_tag="BT0374"
                     /db_xref="GeneID:4642788"
     CDS             385224..386363
                     /locus_tag="BT0374"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory transduction protein"
                     /protein_id="YP_945375.1"
                     /db_xref="GI:119953166"
                     /db_xref="GeneID:4642788"
                     /translation="MQNFDNLAKDIKNFSYIIDKDFLVWPQNSLLQPVNTELIEKWDL
                     KSSLKIQRTFFNETLIRETKKLINVEYDEESIANYHMLINNLEEIYENCKKNKKIYYQ
                     DVLPAVKKVMEFYKKNQQTFIKYMKLPKLLSDYHIVHSINTAILTVALGNEMNLNNHK
                     MVELCTIAILHKIGFLFIPLQISEKKEKLSNEEFEIIKKYPVLGHKILSTTNFSQSIC
                     SAILNHKENLDGSGYPNKLKSENINIESNIIGAASAYSAILLDRTYKGALNSGASLIE
                     LIQDADKKFDKRVLKLIIKVLSQCPLDFIVELNDNSIAKITKINEDNINVPYIKYIIK
                     DDKIVPPSENKNYVKSIPKTETGIKKILRQDEIEFISKKYGLKEI"
     misc_feature    385254..386213
                     /locus_tag="BT0374"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    385632..386021
                     /locus_tag="BT0374"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(385638..385640,385734..385739,385980..385982)
                     /locus_tag="BT0374"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    385737..385739
                     /locus_tag="BT0374"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            386376..387089
                     /locus_tag="BT0375"
                     /db_xref="GeneID:4642276"
     CDS             386376..387089
                     /locus_tag="BT0375"
                     /EC_number="3.2.2.16"
                     /EC_number="3.2.2.9"
                     /note="S-adenosylhomocysteine nucleosidase"
                     /codon_start=1
                     /transl_table=11
                     /product="5'-methylthioadenosine nucleosidase"
                     /protein_id="YP_945376.1"
                     /db_xref="GI:119953167"
                     /db_xref="GeneID:4642276"
                     /translation="MILITSAMDEESIEINKIIENKEEIILDDYSGEKKIYKGEIAGH
                     KVISLTTGIGKVNAAMWNSYIISKYKITHIINSGTAGGLKESEDLKITDIIVSSETAF
                     HDFNLTKFGHKIGQVPGFPQKFKADENLLNKVVNIIEDKLKNISVHIGLILTGDQFIG
                     DKKQLEEIKNNFADALAVEMESAAIAQVAHTFKIPFIITRSVSDLPNIKDNHIDFNKF
                     LQDASMNSAKIVKELIKLI"
     misc_feature    386376..387086
                     /locus_tag="BT0375"
                     /note="5'-methylthioadenosine/S-adenosylhomocysteine
                     nucleosidase; Validated; Region: PRK05584"
                     /db_xref="CDD:180148"
     gene            387108..388277
                     /locus_tag="BT0376"
                     /db_xref="GeneID:4642286"
     CDS             387108..388277
                     /locus_tag="BT0376"
                     /EC_number="2.5.1.6"
                     /note="catalyzes the formation of S-adenosylmethionine
                     from methionine and ATP; methionine adenosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthetase"
                     /protein_id="YP_945377.1"
                     /db_xref="GI:119953168"
                     /db_xref="GeneID:4642286"
                     /translation="MLNNNLTSTSEAVSEGHPDKIADQISDAILDEILKRDKMAKVAC
                     ETLVSQNLIIIAGEISSKAKKEINIKEIAKQTIKNIGYTNIEYGLDYKSATIIDAIGS
                     QSIDITNAVEKKDTNDIGAGDQGIIFGYACNETKNFLPIAYELSNLILQKASKLRKSG
                     QIKWLRPDAKSQVTIEYDSNKNPIRVNNIVVSHQHDPGIPQDFLRQTIIEKIIKPILQ
                     SKSMLDENIKYYINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATK
                     VDRSAAYMARYIAKNMVAAGISKEFEMQLAYAIGIPNPISIKITTGINNNEYEKKILS
                     FIINNFDLTPNGIIKKLKLREPIYSKTCTYGHFGKNELEWEKLDFVDTIKKEFKI"
     misc_feature    387132..388274
                     /locus_tag="BT0376"
                     /note="S-adenosylmethionine synthetase; Validated; Region:
                     PRK05250"
                     /db_xref="CDD:235374"
     misc_feature    387132..387419
                     /locus_tag="BT0376"
                     /note="S-adenosylmethionine synthetase, N-terminal domain;
                     Region: S-AdoMet_synt_N; pfam00438"
                     /db_xref="CDD:249858"
     misc_feature    387459..387818
                     /locus_tag="BT0376"
                     /note="S-adenosylmethionine synthetase, central domain;
                     Region: S-AdoMet_synt_M; pfam02772"
                     /db_xref="CDD:251520"
     misc_feature    387822..388235
                     /locus_tag="BT0376"
                     /note="S-adenosylmethionine synthetase, C-terminal domain;
                     Region: S-AdoMet_synt_C; pfam02773"
                     /db_xref="CDD:111646"
     gene            388226..388747
                     /locus_tag="BT0377"
                     /db_xref="GeneID:4642298"
     CDS             388226..388747
                     /locus_tag="BT0377"
                     /EC_number="3.13.1.-"
                     /note="catalyzes the hydrolysis of S-ribosylhomocysteine
                     to homocysteine and autoinducer-2"
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteinase"
                     /protein_id="YP_945378.1"
                     /db_xref="GI:119953169"
                     /db_xref="GeneID:4642298"
                     /translation="MGKTRFRRHNKKGVQNMNKIPSFTIDHTKLKPGIYVSRKDIFDN
                     LTFTTVDIRMKAPNREPVINNAEMHTIEHIGATLLRNNKVWGDKVLYFGPMGCRTGFY
                     LILLGNYESKDLIDLISWLFHEIANFQGNIIGATEKECGNYQDHNLNMAKYESNRYLA
                     ILANIKEENLTYP"
     misc_feature    388274..388741
                     /locus_tag="BT0377"
                     /note="S-ribosylhomocysteinase; Provisional; Region:
                     PRK02260"
                     /db_xref="CDD:179399"
     gene            complement(388890..389321)
                     /locus_tag="BT0379"
                     /db_xref="GeneID:4642897"
     CDS             complement(388890..389321)
                     /locus_tag="BT0379"
                     /EC_number="3.6.1.17"
                     /codon_start=1
                     /transl_table=11
                     /product="bis(5'-nucleosyl)-tetraphosphatase
                     (asymmetrical)"
                     /protein_id="YP_945379.1"
                     /db_xref="GI:119953170"
                     /db_xref="GeneID:4642897"
                     /translation="METILSGCIFCKIVKNEMSCYKVYENELVLAFLDINPLNVGHTL
                     VIPKQHSNDALGMSDELNGQILKVCKKVALSLKKLGSNICNGINIYSAIGSDAGQVIF
                     HTHFHVVPRFKGDNFGFTRGSNIELSGDEFLDLSKHISQNI"
     misc_feature    complement(388989..389300)
                     /locus_tag="BT0379"
                     /note="HINT (histidine triad nucleotide-binding protein)
                     subgroup: Members of this CD belong to the superfamily of
                     histidine triad hydrolases that act on alpha-phosphate of
                     ribonucleotides. This subgroup includes members from all
                     three forms of cellular life; Region: HINT_subgroup;
                     cd01277"
                     /db_xref="CDD:238608"
     misc_feature    complement(order(388995..389003,389007..389009,
                     389013..389015))
                     /locus_tag="BT0379"
                     /note="HIT family signature motif; other site"
                     /db_xref="CDD:238608"
     misc_feature    complement(389007..389009)
                     /locus_tag="BT0379"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238608"
     gene            complement(389372..390733)
                     /locus_tag="BT0380"
                     /db_xref="GeneID:4642754"
     CDS             complement(389372..390733)
                     /locus_tag="BT0380"
                     /codon_start=1
                     /transl_table=11
                     /product="Mg2+ transporter MgtE"
                     /protein_id="YP_945380.1"
                     /db_xref="GI:119953171"
                     /db_xref="GeneID:4642754"
                     /translation="MIDVVFLRTLLEEKKYSDIKEELLKYDAFDISEALKKLNGSDLI
                     LLYRFLPKKVAVEAFSNFDQGTKNKLANSFTNREIREMIDELNLDDVIDLLEEVPANV
                     VQRFLASSTEENREIINKFLSYSDDSAGSIVTIEYIELKDYFCVGEALDYIRRVAKTK
                     EDIYTYYITDEEKRLKGVIKIEDLMLSGDDVIISAIMRTSGFYIVKVGDEKEDVALLF
                     QNHDISSVPVVDNEGRMIGVIIIDDILEVIQNLNTEDFQIMAAVTPLGKSYLDTSIFD
                     MTKNRIIWLLILMISSTLTATIITNYQHLVLSLVILTSFIPLLMDTSGNAGSQASALI
                     IRELALGTLKVKDFFKVLLKEVCVSILVGSILAGINFLRIVFFVIPEHNEKFKIAFVV
                     SACLMIGLMVAKILGGLLPILAKFIRIDPALMAGPLITTIADVVTLIAYFNIARLVLT
                     NYF"
     misc_feature    complement(389387..390724)
                     /locus_tag="BT0380"
                     /note="Mg2+ transporter (mgtE); Region: mgtE; TIGR00400"
                     /db_xref="CDD:129495"
     misc_feature    complement(390353..390658)
                     /locus_tag="BT0380"
                     /note="MgtE intracellular N domain; Region: MgtE_N;
                     pfam03448"
                     /db_xref="CDD:146204"
     misc_feature    complement(389990..390298)
                     /locus_tag="BT0380"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domain in the
                     magnesium transporter, MgtE.  MgtE and its homologs are
                     found in eubacteria, archaebacteria, and eukaryota.
                     Members of this family transport Mg2+ or other...; Region:
                     CBS_pair_Mg_transporter; cd04606"
                     /db_xref="CDD:239979"
     misc_feature    complement(389870..390100)
                     /locus_tag="BT0380"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair; cd02205"
                     /db_xref="CDD:239067"
     misc_feature    complement(389399..389791)
                     /locus_tag="BT0380"
                     /note="Divalent cation transporter; Region: MgtE;
                     pfam01769"
                     /db_xref="CDD:110745"
     gene            complement(390788..392245)
                     /locus_tag="BT0381"
                     /db_xref="GeneID:4642524"
     CDS             complement(390788..392245)
                     /locus_tag="BT0381"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945381.1"
                     /db_xref="GI:119953172"
                     /db_xref="GeneID:4642524"
                     /translation="MIDICFSEVRALNKSVFPKIYYYDQDFIDIYNKSLSWIRDKIVF
                     PQALERGRKDKNYYSENLEFIDQLQACLSSFFLVYSNGEYSPTSTIDKFYELQEASGA
                     IRARYDRNNNIVHIEGNDDGIGLPIFAWVEYNLYHKTGNKKRICDVLPVLDKYYKWIE
                     KKFLKANGLYSIDMNKIFYKNSPRNDAYYPIDFNSLQVHSAYCIAKLADILNDKNLSL
                     EYKKRFFSLKAKINSLMWDEKDGFYYDLDINENIVRCKTIVGFLPLLSEIPSEDRIER
                     MIFYLKSHEHFGTPNPFPTLSANDPSFNLDGNGYYGSVYTYMNFFVIKGLEYCRRSNI
                     AREFTIRHLYYILDTLLPDGKVKGHVWEAYKPMKEGPAYLDVEKKILPEKDVICYLAL
                     FSISLMIENIIGLTISLPDKTVYWNIPALEVMGIESLSLKKNQTTIICNKGKRGWEIK
                     MESEKLYYFTINILNKKEKTLPIPSGRCSMLLDKL"
     misc_feature    complement(390791..392215)
                     /locus_tag="BT0381"
                     /note="Neutral trehalase [Carbohydrate transport and
                     metabolism]; Region: TreA; COG1626"
                     /db_xref="CDD:224541"
     misc_feature    complement(391265..>391636)
                     /locus_tag="BT0381"
                     /note="Trehalase; Region: Trehalase; cl17346"
                     /db_xref="CDD:266637"
     gene            complement(392490..393503)
                     /locus_tag="BT0382"
                     /db_xref="GeneID:4642913"
     CDS             complement(392490..393503)
                     /locus_tag="BT0382"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-binding protein"
                     /protein_id="YP_945382.1"
                     /db_xref="GI:119953173"
                     /db_xref="GeneID:4642913"
                     /translation="MKNLFLILCMLCCSCFNSKVNGNLAKIAVLVDGVFDDKTFNKGA
                     WDGAKKVEKEFGLEIVMKESNSNSYLADLESLKNNGSNFIWLIGYKLSDSAIIVALKN
                     PEIKYVIIDPVYDSDLVIPENLSAITFRNEEGAFLVGYIAAKISKTGKIGFLGGVDNV
                     IVNAFRYGYEAGAMYANRNINIDNKYIGSFVNINTGRNMANEMYVDKVDIIYHVAGLA
                     GLGVIEAAHNFGDESYVIGVDQDQSHLAPDSVITSSIKDIGRILNIIISNYLKINAFE
                     GGRILNYGLREGFLDFVKNPKMISFKLEKELDDISEKIINRKIVVPNNESTYNKFLKE
                     FVN"
     misc_feature    complement(392640..393428)
                     /locus_tag="BT0382"
                     /note="Periplasmic binding domain of basic membrane
                     lipoprotein, PnrA, in Treponema pallidum and its homologs
                     from other bacteria and Archaea; Region:
                     PBP1_BmpA_PnrA_like; cd06354"
                     /db_xref="CDD:107349"
     misc_feature    complement(order(392736..392738,392787..392789,
                     392856..392858,392934..392936,393018..393020,
                     393171..393173,393381..393383,393408..393410))
                     /locus_tag="BT0382"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107349"
     misc_feature    complement(392493..>392738)
                     /locus_tag="BT0382"
                     /note="Topoisomerase IA [DNA replication, recombination,
                     and repair]; Region: TopA; COG0550"
                     /db_xref="CDD:223624"
     gene            complement(393540..394610)
                     /locus_tag="BT0383"
                     /db_xref="GeneID:4642785"
     CDS             complement(393540..394610)
                     /locus_tag="BT0383"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-binding protein"
                     /protein_id="YP_945383.1"
                     /db_xref="GI:119953174"
                     /db_xref="GeneID:4642785"
                     /translation="MSNNLCFIILFILLFVSCFSSKESSSFVDRQIIMGIMFPGNFDD
                     KGYFQNAFEGAVKITNEFEIKLLPKVLTPYPVEGKRLMTASEVLEEDVYTLQKDGANL
                     IWFISAHFSDSALRLAHENTNTSYGIIDSFGYDDNILIPKNFLAINFKAEEGAFLAGY
                     LAAKMSKSNRIGFMTGVNIKYVERFLVGFRAGAFYAEPKTRMIVKRVLDEFSEASGKS
                     VAEHMYIEDGVDVIFPVMGPAALGVFSAAKKLGAGHYVIGINKDQSSLAPGHVITSVL
                     KDVGKTIYNFSLDAIKKHKFNGGRIIEEGVKEGVIDIVKDPNIIGNNLFDTMTKIQTE
                     IVNGQLIIPSTEHEFDLFKARL"
     misc_feature    complement(393573..394508)
                     /locus_tag="BT0383"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            complement(394772..395818)
                     /locus_tag="BT0384"
                     /db_xref="GeneID:4642262"
     CDS             complement(394772..395818)
                     /locus_tag="BT0384"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-binding protein"
                     /protein_id="YP_945384.1"
                     /db_xref="GI:119953175"
                     /db_xref="GeneID:4642262"
                     /translation="MRSFYMNKFVMFIFVVLTFLGCDKKSLTSKSLAKPIISLIVDGT
                     FDDKSFGEDAWKGSQMLEGGFGVEIIGKASTSTAYASDLEDLKDKGSSIIWGVGFRLQ
                     EATEQAATLNKDVNYGMIDVTYEDDINLPDNFLGLSFKVEEASFLAGYLAAKTSKTGK
                     IGFLGGMEGVVINAFRYGYEAGAKYANKDIELNSQYLESFVDLSLARTIALKMYEDGT
                     DVIFVAAGLAGLGAIEVAKELGAGYYIVGVDQDQSYLAPDNVLTSVVKNVGNSIYEIT
                     KNYLNTNDFDGGKVLKLGLKNGSVSIVKHDSIKDDIKVEIETIEDKIVSGDISVPSNL
                     DEYNKFLDIYNLLN"
     misc_feature    complement(394913..395710)
                     /locus_tag="BT0384"
                     /note="Periplasmic binding domain of basic membrane
                     lipoprotein, PnrA, in Treponema pallidum and its homologs
                     from other bacteria and Archaea; Region:
                     PBP1_BmpA_PnrA_like; cd06354"
                     /db_xref="CDD:107349"
     misc_feature    complement(order(395021..395023,395072..395074,
                     395141..395143,395219..395221,395303..395305,
                     395456..395458,395666..395668,395693..395695))
                     /locus_tag="BT0384"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107349"
     gene            complement(395846..396877)
                     /locus_tag="BT0385"
                     /db_xref="GeneID:4642875"
     CDS             complement(395846..396877)
                     /locus_tag="BT0385"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside-binding protein"
                     /protein_id="YP_945385.1"
                     /db_xref="GI:119953176"
                     /db_xref="GeneID:4642875"
                     /translation="MMRGIYMLKKVFLFFFILGCSGSRDQTSLSDTISVIVDGTFDDR
                     GFNESSSNAMAQIKEEFKVNIIRKESKVSDYLADIGILEEGGSSLIWGVGFKFTDTFL
                     RKSLENANVHYGIIEGAYSEDVELPKNLVNVNFRSEEGAFLVGYLAANASKTGKIGFL
                     GGMEGVVINAFRYGYEAGAKYANKNIELNSQYVGTFSDLSLGHLMASKMYASGVDIIF
                     TAAGLSGLGAIEVAKELGNGHYIIGVDQDQSYLAPDNVLLSYVKRVDLVMLDLMRSYL
                     DFGKWNGGDNLEFGLKDGALDLILNKSISLDLIKDYDFLSEIKNKIVGNEIKVPKDEK
                     SYGDFVVNL"
     misc_feature    complement(395984..396784)
                     /locus_tag="BT0385"
                     /note="Periplasmic binding domain of basic membrane
                     lipoprotein, PnrA, in Treponema pallidum and its homologs
                     from other bacteria and Archaea; Region:
                     PBP1_BmpA_PnrA_like; cd06354"
                     /db_xref="CDD:107349"
     misc_feature    complement(order(396092..396094,396143..396145,
                     396212..396214,396290..396292,396374..396376,
                     396527..396529,396737..396739,396764..396766))
                     /locus_tag="BT0385"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107349"
     gene            complement(396934..397407)
                     /locus_tag="BT0386"
                     /db_xref="GeneID:4642281"
     CDS             complement(396934..397407)
                     /locus_tag="BT0386"
                     /note="binds directly to 16S rRNA where it nucleates
                     assembly of the head domain of the 30S subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="YP_945386.1"
                     /db_xref="GI:119953177"
                     /db_xref="GeneID:4642281"
                     /translation="MSRKSKKIKKKVFKDSKYDSQVIAKFVNRMMYDGKKSISEAIVY
                     NSIDLLAEKTEEVDKVAAFSKALDNVKPLVEVRSRRVGGATYQVPVEVREERREALAM
                     KWIIAAARKASGKSMQEKLGNELVNSYNSTGVAFKKREDTHRMAEANRAFTHYRW"
     misc_feature    complement(396937..397407)
                     /locus_tag="BT0386"
                     /note="30S ribosomal protein S7; Validated; Region:
                     PRK05302"
                     /db_xref="CDD:235398"
     gene            complement(397422..397796)
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /db_xref="GeneID:4642808"
     CDS             complement(397422..397796)
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="interacts with and stabilizes bases of the 16S rRNA
                     that are involved in tRNA selection in the A site and with
                     the mRNA backbone; located at the interface of the 30S and
                     50S subunits, it traverses the body of the 30S subunit
                     contacting proteins on the other side; mutations in the
                     S12 gene confer streptomycin resistance"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="YP_945387.1"
                     /db_xref="GI:119953178"
                     /db_xref="GeneID:4642808"
                     /translation="MPTINQLIRKPRKSQKEKTASPALQNCPQRRGICTRVMTVTPKK
                     PNSALRKVARVRLSNGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAK
                     DTLGVNNRKQGRSKYGTKKPKA"
     misc_feature    complement(397467..397790)
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="S12-like family, 30S ribosomal protein S12
                     subfamily; S12 is located at the interface of the large
                     and small ribosomal subunits of prokaryotes, chloroplasts
                     and mitochondria, where it plays an important role in both
                     tRNA and ribosomal subunit...; Region: Ribosomal_S12;
                     cd03368"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(397761..397766,397773..397778,
                     397782..397787))
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="S17 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239466"
     misc_feature    complement(397785..397787)
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="S8 interaction site; other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(397467..397469,397530..397535,
                     397545..397550,397587..397592,397599..397601,
                     397623..397625,397644..397652,397656..397661,
                     397704..397706,397710..397715,397719..397721,
                     397755..397763))
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="16S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(397533..397535,397665..397670))
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="streptomycin interaction site [chemical binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(397662..397667)
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="23S rRNA interaction site [nucleotide binding];
                     other site"
                     /db_xref="CDD:239466"
     misc_feature    complement(order(397563..397589,397647..397664))
                     /gene="rpsL"
                     /locus_tag="BT0387"
                     /note="aminoacyl-tRNA interaction site (A-site)
                     [nucleotide binding]; other site"
                     /db_xref="CDD:239466"
     gene            complement(397859..401992)
                     /locus_tag="BT0388"
                     /db_xref="GeneID:4642812"
     CDS             complement(397859..401992)
                     /locus_tag="BT0388"
                     /EC_number="2.7.7.6"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates. Subunit beta'
                     binds to sigma factor allowing it to bind to the -10
                     region of the promoter"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_945388.1"
                     /db_xref="GI:119953179"
                     /db_xref="GeneID:4642812"
                     /translation="MKEIKDFEKIRIKIASPDQIRSWSYGEVKKSETINYRTLRPEKD
                     GLFCERIFGTTKEWECYCGKFKSIRYKGIICDRCNVEVTHFKVRRERMGHIELSAPVA
                     HIWYYKYIPSRIGLLLDITASNLNSILYYEKYIVIEPGDTDLKKMQLLNEDEYSEAKE
                     RYGMSFSASMGAEAIKTLLENLDLDELSSKLRLQMIDKDDKTDKKLLRRLEIIENFKV
                     SGNKPEWMIMDVLPVIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLRKLLLLNA
                     PEIIVRNEKRMLQESVDSLFDNSHKRKVVKGTSNRPLKSLSDALKGKQGRFRQNLLGK
                     RVDYSGRSVIVVGPELKLHQCGIPAKMALELFKPFVIRKLIESESVFNIKRAKSLIEQ
                     EVDEVWQILDNVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADF
                     DGDQMAVHVPLTPAAQAESWALMLSTNNLLNPANGHPIVFPSQDIVLGLYYLTMERKN
                     VVGEGRKFSNFNHVLLAINNKSLDYNARIYVKVDGEYIETTAGCVVFNEALPGKISFV
                     NKTLSDYELQNLISEVYVVYGSSIVIEMLDIIKELGFKYATKFGCTISMSDIIVPEEK
                     KVYVDKANREIAKIQNDYTKGVITGEERYNNVVSVWSKTNEELTNKMMEILKKDRDGF
                     NVIYMMADSGARGSRNQIRQLAGMRGLMAKTSGDIIELPIISNFKEGLSVIEFFISTN
                     GARKGLADTALKTADAGYLTRRLVDIAQDVVVRIEDCGTINGIKVEALKNGEEIVEPL
                     REKAVGSYSIERIKSPITGEIILDVNEEITEDKIKLLETVGIDKLVIRSVLTCEAEHG
                     VCQKCYGRDFSNNKPVNIGEAVGIIAAQSIGQPGTQLTMRTFHIGGVAQAGSEDDKIA
                     LKNSFILNGLEGFNVQVDGGLLFTRKGTLRVINVIYEEDIKDIKEFKVLDSQKVIKGM
                     PLFTSKDGIDVLSSHIGYVRIKDNKLMIVSEEQEISLKTGTKLEVNVGDYVEAGRVIG
                     TFDPFAEPIIAEVRGKVKFKDIILGTTLKEEINLETGNIEKRITDQVFESLDPRILII
                     NDRGIEIASYVLPGDAYLQVEDGQDIDIGDIIAKLSKGSEKTQDITGGLPRVNDLFET
                     RIPKNLTEMAKVSGVVQFKAIQKGKRLINVLDEYGVEHKHYIPAGKHLLVRDGDVVKA
                     GDMLCDGRINPHDVLEILGGISLQEFLLAEIQDVYRKQGVSINDKHIGVIIKQMMKKV
                     KIVSVGDTNFVYNQKVDKHTFYEQNKRVIEQGGEPAVASPILIGITKASLNIDSFISA
                     ASFQETTKVLTDASIAGSVDDLKGLKENVVIGHLIPTGTGMNLYKRVKVRENSSSEM"
     misc_feature    complement(397880..401980)
                     /locus_tag="BT0388"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     misc_feature    complement(399665..401980)
                     /locus_tag="BT0388"
                     /note="Largest subunit (beta') of bacterial DNA-dependent
                     RNA polymerase (RNAP), N-terminal domain; Region:
                     RNAP_beta'_N; cd01609"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(399701..399703,399710..399712,
                     399740..399745,399749..399757,399761..399769,
                     399773..399778,399785..399790,399794..399817,
                     399833..399835,399854..399859,399872..399874,
                     399884..399889,399896..399898,399911..399913,
                     399929..399931,399947..399949,400142..400177,
                     400181..400186,400475..400477,400490..400492,
                     400502..400504,400511..400519,400559..400561,
                     400574..400579,400589..400591,400598..400621,
                     400631..400633,400640..400648,400673..400675,
                     400688..400693,400721..400726,400730..400735,
                     400742..400744,400754..400756,400832..400834,
                     400877..400882,400886..400891,400898..400903,
                     400910..400915,400949..400951,400955..401017,
                     401033..401038,401045..401047,401105..401107,
                     401255..401260,401267..401269,401273..401275,
                     401279..401284,401291..401293,401297..401299,
                     401309..401311,401678..401680,401684..401686,
                     401717..401728,401732..401737,401792..401794,
                     401825..401827,401876..401878,401882..401884,
                     401918..401929,401936..401938,401948..401950,
                     401954..401980))
                     /locus_tag="BT0388"
                     /note="beta and beta' interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(400826..400831,400835..400837,
                     401021..401026,401051..401053,401060..401062,
                     401090..401092,401123..401125,401132..401137,
                     401141..401167,401177..401188,401192..401194,
                     401201..401206,401216..401218,401225..401227,
                     401234..401251,401261..401263,401270..401275,
                     401600..401605,401738..401740,401786..401788,
                     401792..401794,401822..401824,401828..401830,
                     401885..401887,401891..401899))
                     /locus_tag="BT0388"
                     /note="beta' and sigma factor interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(401759..401761,401768..401770,
                     401807..401809,401813..401815))
                     /locus_tag="BT0388"
                     /note="Zn-binding [ion binding]; other site"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(399719..399724,399731..399736,
                     400634..400636,400640..400642,400646..400648,
                     400745..400753,400970..400972,400988..400990,
                     401009..401011,401024..401026,401093..401095,
                     401660..401662))
                     /locus_tag="BT0388"
                     /note="active site region [active]"
                     /db_xref="CDD:259845"
     misc_feature    complement(order(400634..400636,400640..400642,
                     400646..400648))
                     /locus_tag="BT0388"
                     /note="catalytic site [active]"
                     /db_xref="CDD:259845"
     misc_feature    complement(<399278..399385)
                     /locus_tag="BT0388"
                     /note="Largest subunit of RNA polymerase (RNAP),
                     C-terminal domain; Region: RNAP_largest_subunit_C;
                     cl11429"
                     /db_xref="CDD:142634"
     misc_feature    complement(399365..399367)
                     /locus_tag="BT0388"
                     /note="Rpb1 - Rpb6 interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:132719"
     misc_feature    complement(397910..398602)
                     /locus_tag="BT0388"
                     /note="Largest subunit (beta') of Bacterial DNA-dependent
                     RNA polymerase (RNAP), C-terminal domain; Region:
                     RNAP_beta'_C; cd02655"
                     /db_xref="CDD:132721"
     misc_feature    complement(order(398018..398023,398066..398068,
                     398552..398554))
                     /locus_tag="BT0388"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:132721"
     misc_feature    complement(order(397916..397918,397928..397933,
                     397940..397942,397958..397960,397976..397978))
                     /locus_tag="BT0388"
                     /note="Rpb1 (beta') - Rpb2 (beta) interaction site
                     [polypeptide binding]; other site"
                     /db_xref="CDD:132721"
     gene            complement(402007..405474)
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /db_xref="GeneID:4642805"
     CDS             complement(402007..405474)
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /EC_number="2.7.7.6"
                     /note="DNA-dependent RNA polymerase catalyzes the
                     transcription of DNA into RNA using the four
                     ribonucleoside triphosphates as substrates; beta subunit
                     is part of the catalytic core which binds with a sigma
                     factor to produce the holoenzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_945389.1"
                     /db_xref="GI:119953180"
                     /db_xref="GeneID:4642805"
                     /translation="MIKRVHLGQGKAEEILDLPNLIEIQLNSYEKFLQLDRLKNNKPL
                     LNEGLESVFRDVFPMKSSNGEVALEYEKYYVEYDSLSFTEKECKRKGQSYEAVLKIRL
                     NLQFLTTGEIRQKDVYMGTIPLMTDRGTFIVNGAERVIVSQIHRSPGVVFYKEKDLYY
                     ARIIPYRGSWLEFEIDSKKDYLYVKIDRKKRILVTLFLRALGLDTREKIIETFYKIKK
                     IEVNEDTKREITGQYLAVNITIKENMTYRAGDKITLQDIEDFLQNGVKEIDLIDFDGY
                     DSVPGKHFISSDVILNCFEKEDAYFSLKDGFKELSRESVMLAVYSVLLPGEPISIDNA
                     ENDLRTVFFSEKRYDLGHVGRYKLSKKFGLNDLTTSVLTMTDIVNTISHLLRIYDGHD
                     VLDDIDHLGNRRVRSVGELLTNIYKGAMSRVEKIAKDRMSNKEVFNLKPQELISVKPI
                     VSAVKEFFATSQLSQFMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVRDVHYTHYG
                     RMCPIETPEGPNIGLIVSLATYAKVNDYGFLETPYRKVINGKVTDEIEYLSAIDEEKK
                     CIAQANAAVNAESNYIDDLISVRVSGDYTTMIPKNIDYMDVSPRQLISVSSALIPFLE
                     HNDANRALMGSNMQRQAVPLLFPQPPIVGTGMERIVAKDSGVVIKAKRSGTVVLATSK
                     RIVIRPDNADDEHDLDEYELAKYERTNQDTSFNHSVLIKEGQVVNKGEIIADGPATRY
                     GELALGNNLLVGFIPWNGFNYEDAILISERIVKEDLYTSIHIKEFSIEVRETKLGPEK
                     VTADIPNVSGKILNKLDENGIVRIGTYVKPGDILIGKVTPKSEGDITPEFKLLTSIFG
                     EKAKDVKNNSLKVPHGTEGTVIDVQRITKNDVGNLPPGVDEILKVYVAKKRRLKEGDK
                     MAGRHGNKGVVAKILPVEDMPYLADGTPLDICLNPLGVPSRMNIGQLMESQLGLAGKY
                     LSEYYDVPVFESATNECIQEKLKKAGFNETSKAILYDGYTGEPFENEVMVGIIYMLKL
                     HHLVDDKMHARSTGPYSLVSQQPLGGKAQFGGQRLGEMEVWALEAYGAAYTLQELLTV
                     KSDDMSGRVKIYENIVKGIPTNVSGIPESFNVLMQELRGLGFDLSIYDDNGNQIPLTE
                     KEEELINKT"
     misc_feature    complement(402052..405468)
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    complement(402070..405414)
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="RNA polymerase beta subunit. RNA polymerases
                     catalyse the DNA dependent polymerization of RNA.
                     Prokaryotes contain a single RNA polymerase compared to
                     three in eukaryotes (not including mitochondrial. and
                     chloroplast polymerases). Each RNA polymerase...; Region:
                     RNA_pol_B_RPB2; cd00653"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(403000..403002,403006..403014,
                     403024..403026,403030..403032,403141..403143,
                     405205..405207))
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(402070..402072,402076..402078,
                     402082..402093,402097..402099,402103..402108,
                     402112..402114,402118..402120,402130..402132,
                     402199..402201,402211..402228,402232..402249,
                     402253..402255,402259..402264,402268..402270,
                     402280..402288,402349..402354,402358..402366,
                     402373..402375,402412..402414,402418..402426,
                     402448..402450,402529..402531,402580..402582,
                     402592..402594,402607..402609,402616..402618,
                     402625..402627,402631..402633,402697..402699,
                     402703..402705,402709..402711,403186..403194,
                     403198..403200,403207..403218,403591..403593,
                     403597..403605,403657..403659,403939..403941,
                     403954..403956,403963..403965,403969..403977,
                     403981..403983))
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(403651..403848)
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="RNA polymerase beta subunit external 1 domain;
                     Region: RNA_pol_Rpb2_45; pfam10385"
                     /db_xref="CDD:255954"
     misc_feature    complement(order(402409..402411,402460..402462,
                     402553..402555,402559..402564,402643..402645,
                     402682..402684,403153..403155,403162..403164,
                     403225..403227,403231..403233,403528..403533))
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(402442..402444,402685..402687,
                     403156..403158,403198..403200))
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    complement(order(402418..402420,402424..402447,
                     402658..402663,402667..402669,402676..402684,
                     402757..402759,402763..402765,403141..403143,
                     403153..403158))
                     /gene="rpoB"
                     /locus_tag="BT0389"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            complement(405560..405931)
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /db_xref="GeneID:4642134"
     CDS             complement(405560..405931)
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_945390.1"
                     /db_xref="GI:119953181"
                     /db_xref="GeneID:4642134"
                     /translation="MALSKEDILTWLEEAKTSEVVELITAIEEKFGVTAAAVAVAAGS
                     GPASVDAEEQTEFDVMLMSFGDSKINVIKEVRAVTGLGLGEAKALVEAAPKAIKEGVS
                     KADAEDIKKKLEAVGAKVEIK"
     misc_feature    complement(405566..405925)
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="Ribosomal protein L7/L12. Ribosomal protein L7/L12
                     refers to the large ribosomal subunit proteins L7 and L12,
                     which are identical except that L7 is acetylated at the N
                     terminus. It is a component of the L7/L12 stalk, which is
                     located at the surface of...; Region: Ribosomal_L7_L12;
                     cd00387"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(405617..405619,405626..405628,
                     405632..405637,405677..405682,405686..405688,
                     405692..405697,405701..405703,405764..405769,
                     405803..405805,405848..405850,405857..405859,
                     405866..405871,405878..405886,405923..405925))
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(405839..405841,405854..405856,
                     405893..405895,405905..405907,405914..405916))
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(405839..405841,405848..405850,
                     405860..405865,405872..405874))
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(405671..405673,405680..405685,
                     405704..405706,405713..405718,405725..405730))
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(405671..405673,405680..405685,
                     405704..405706,405713..405715,405725..405727))
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    complement(order(405704..405706,405713..405718,
                     405725..405727))
                     /gene="rplL"
                     /locus_tag="BT0390"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            complement(406008..406505)
                     /gene="rplJ"
                     /locus_tag="BT0391"
                     /db_xref="GeneID:4642804"
     CDS             complement(406008..406505)
                     /gene="rplJ"
                     /locus_tag="BT0391"
                     /note="binds the two ribosomal protein L7/L12 dimers and
                     anchors them to the large ribosomal subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_945391.1"
                     /db_xref="GI:119953182"
                     /db_xref="GeneID:4642804"
                     /translation="MHAKINPKKVEMFNLLKEFLDGKDSVFFLDYRGLTVATLTELRN
                     RVENEKGELKVVKNNIMKRVLKDKHMEGLDSYLLGPTAVVTAVDEANVIAKIFYEFVK
                     TSSLKVKGGFVLGEVYDEAKLNAYSKLPTKKESISLFMNVLKAPISKLARTLKALSDV
                     KDVKV"
     misc_feature    complement(406029..406493)
                     /gene="rplJ"
                     /locus_tag="BT0391"
                     /note="Ribosomal protein L10 family, L10 subfamily;
                     composed of bacterial 50S ribosomal protein and eukaryotic
                     mitochondrial 39S ribosomal protein, L10. L10 occupies the
                     L7/L12 stalk of the ribosome. The N-terminal domain (NTD)
                     of L10 interacts with L11 protein...; Region:
                     Ribosomal_L10; cd05797"
                     /db_xref="CDD:240223"
     misc_feature    complement(order(406317..406319,406326..406337,
                     406467..406469,406476..406481))
                     /gene="rplJ"
                     /locus_tag="BT0391"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    complement(order(406032..406037,406041..406046,
                     406053..406061,406065..406082,406086..406091,
                     406098..406103,406110..406112,406158..406160,
                     406167..406169,406233..406235))
                     /gene="rplJ"
                     /locus_tag="BT0391"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            complement(406516..407190)
                     /gene="rplA"
                     /locus_tag="BT0392"
                     /db_xref="GeneID:4642809"
     CDS             complement(406516..407190)
                     /gene="rplA"
                     /locus_tag="BT0392"
                     /note="in Escherichia coli and Methanococcus, this protein
                     autoregulates expression; the binding site in the mRNA
                     mimics the binding site in the 23S rRNA"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_945392.1"
                     /db_xref="GI:119953183"
                     /db_xref="GeneID:4642809"
                     /translation="MAKSGKKYIQALSKVDKLKSYSIDDAISLLKEIKFVKFDETIDV
                     SVNLNLKKNHTVRDTVVLPNQFMREKRILVFAKGDKAEEAREAGAVYVGDDDLINKVK
                     GGFSDFDVVVATPDMMKDVGKLGPILGKRGLMPNPKTQTITNDLKGTIASLKKGRTEF
                     RANKNGVINFSVGKSSMDNNKVKENYDEFIKELLKRRPSDLKGTFVDSVYMSSTMGPS
                     VKIDFV"
     misc_feature    complement(406528..407124)
                     /gene="rplA"
                     /locus_tag="BT0392"
                     /note="Ribosomal protein L1.  The L1 protein, located near
                     the E-site of the ribosome, forms part of the L1 stalk
                     along with 23S rRNA.  In bacteria and archaea, L1
                     functions both as a ribosomal protein that binds rRNA, and
                     as a translation repressor that binds...; Region:
                     Ribosomal_L1; cd00403"
                     /db_xref="CDD:238235"
     misc_feature    complement(order(406537..406539,406543..406548,
                     406684..406686,406690..406692,406696..406698,
                     407050..407052,407056..407058,407062..407064,
                     407068..407070,407077..407085))
                     /gene="rplA"
                     /locus_tag="BT0392"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            complement(407190..407624)
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /db_xref="GeneID:4642877"
     CDS             complement(407190..407624)
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /note="binds directly to 23S ribosomal RNA"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_945393.1"
                     /db_xref="GI:119953184"
                     /db_xref="GeneID:4642877"
                     /translation="MSKKKREIAWVKLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEF
                     NERTAKMEPGIIVPVIITVYADKSFSFIVKTPPASVLIKKAVGIETGSKKSNTEKVGT
                     ISKEKVMEIARVKMPDLNAKTELAAFKIIAGSARSMGVEVEK"
     misc_feature    complement(407196..407615)
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     misc_feature    complement(407199..407594)
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /note="Ribosomal protein L11. Ribosomal protein L11,
                     together with proteins L10 and L7/L12, and 23S rRNA, form
                     the L7/L12 stalk on the surface of the large subunit of
                     the ribosome. The homologous eukaryotic cytoplasmic
                     protein is also called 60S ribosomal...; Region:
                     Ribosomal_L11; cd00349"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(407211..407219,407223..407228,
                     407235..407240,407247..407249,407259..407267,
                     407280..407282,407355..407357,407376..407378,
                     407388..407396,407529..407531,407589..407591))
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(407262..407267,407274..407279,
                     407409..407414,407418..407420,407430..407441,
                     407445..407447,407589..407591))
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /note="L7/L12 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(407529..407531,407541..407543))
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /note="putative thiostrepton binding site; other site"
                     /db_xref="CDD:100101"
     misc_feature    complement(order(407328..407330,407337..407339))
                     /gene="rplK"
                     /locus_tag="BT0393"
                     /note="L25 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100101"
     gene            complement(407678..408232)
                     /locus_tag="BT0394"
                     /db_xref="GeneID:4642315"
     CDS             complement(407678..408232)
                     /locus_tag="BT0394"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusG"
                     /protein_id="YP_945394.1"
                     /db_xref="GI:119953185"
                     /db_xref="GeneID:4642315"
                     /translation="MSRAWYVLQTFSQYERKVEQEIKLLISEGVFGSNVLDVKAPIER
                     VEEIKNGKKRIRERRIWPGYILIELDLPEQEWKSTVANIIKIPGVVNFVGTNKEQKPF
                     PISDEEVKSVFMLAGEIKADKSIFILYDFEEGERVRIKGGPFDSFEGVIGSIDYEKKK
                     LKVAVQIFGRSTPVEVDFQHIEKV"
     misc_feature    complement(407684..408220)
                     /locus_tag="BT0394"
                     /note="transcription termination/antitermination factor
                     NusG; Region: nusG; TIGR00922"
                     /db_xref="CDD:233188"
     misc_feature    complement(407894..408220)
                     /locus_tag="BT0394"
                     /note="Bacterial N-Utilization Substance G (NusG)
                     N-terminal (NGN) domain, subgroup 1; Region: NGN_Bact_1;
                     cd09891"
                     /db_xref="CDD:193580"
     misc_feature    complement(order(407897..407899,407921..407923,
                     408035..408037,408041..408043,408050..408052,
                     408110..408112,408212..408214))
                     /locus_tag="BT0394"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:193580"
     misc_feature    complement(407684..407845)
                     /locus_tag="BT0394"
                     /note="NusG contains an NGN domain at its N-terminus and
                     KOW motif at its C-terminus; Region: KOW_NusG; cd06091"
                     /db_xref="CDD:240515"
     misc_feature    complement(order(407693..407698,407708..407719,
                     407723..407731,407756..407758,407792..407794,
                     407801..407815))
                     /locus_tag="BT0394"
                     /note="heterodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     misc_feature    complement(407804..407815)
                     /locus_tag="BT0394"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240515"
     gene            complement(408242..408412)
                     /gene="secE"
                     /locus_tag="BT0395"
                     /db_xref="GeneID:4642814"
     CDS             complement(408242..408412)
                     /gene="secE"
                     /locus_tag="BT0395"
                     /note="forms a complex with SecY and SecG; SecYEG forms a
                     putative protein-conducting channel to which secA binds
                     and translocates targeted polypeptides across the
                     cytoplasmic membrane, a process driven by ATP and a
                     proton-motive force"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="YP_945395.1"
                     /db_xref="GI:119953186"
                     /db_xref="GeneID:4642814"
                     /translation="MFKFVKESVLELKKITWPKYGEVIGSGKQVFWLVVFISIFLGIV
                     DYIMYLAITYVF"
     misc_feature    complement(408248..408412)
                     /gene="secE"
                     /locus_tag="BT0395"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK07597"
                     /db_xref="CDD:236066"
     gene            complement(408443..408514)
                     /locus_tag="BTT0006"
                     /db_xref="GeneID:4642670"
     tRNA            complement(408443..408514)
                     /locus_tag="BTT0006"
                     /product="tRNA-Trp"
                     /db_xref="GeneID:4642670"
     gene            complement(408525..408704)
                     /gene="rpmG"
                     /locus_tag="BT0396"
                     /db_xref="GeneID:4642803"
     CDS             complement(408525..408704)
                     /gene="rpmG"
                     /locus_tag="BT0396"
                     /note="in Escherichia coli BM108, a mutation that results
                     in lack of L33 synthesis had no effect on ribosome
                     synthesis or function; there are paralogous genes in
                     several bacterial genomes, and a CXXC motif for zinc
                     binding and an upstream regulation region of the paralog
                     lacking this motif that are regulated by zinc similar to
                     other ribosomal proteins like L31; the proteins in this
                     group lack the CXXC motif"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="YP_945396.1"
                     /db_xref="GI:119953187"
                     /db_xref="GeneID:4642803"
                     /translation="MGKKKGKGAVELIALVCEETGIRNYTTTKNRRNKQEKLELMKYC
                     PILRKHTLHKEGKIK"
     misc_feature    complement(408534..408692)
                     /gene="rpmG"
                     /locus_tag="BT0396"
                     /note="50S ribosomal protein L33; Validated; Region: rpmG;
                     PRK00595"
                     /db_xref="CDD:179075"
     gene            complement(408727..408799)
                     /locus_tag="BTT0007"
                     /db_xref="GeneID:4642807"
     tRNA            complement(408727..408799)
                     /locus_tag="BTT0007"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:4642807"
     gene            complement(408885..409784)
                     /locus_tag="BT0397"
                     /db_xref="GeneID:4642811"
     CDS             complement(408885..409784)
                     /locus_tag="BT0397"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_945397.1"
                     /db_xref="GI:119953188"
                     /db_xref="GeneID:4642811"
                     /translation="MGLDRCLSGEKVGSFNVNLLSRLLSFLFLFYSNVSIVNDSLSKS
                     SIKRTIDWDTKIIYFDIIKPVDEDKFGRVGLDSTSRLVFSVNDFKDTLIRQSLFEMII
                     DSDNTFKDYFDSDPHLILYFSGLDSILKRGYTKYSEDLKSITVRYELCLFPDFVNLFI
                     AHSKPYMAFYPLMDTSVDQFVYTGIIIYAGDDYQFSSGGVVKLTDAFFIRIYDEDIKL
                     YFDKKMVEPDALRKWGMLEYTNDISYKNKDRVGNYPLRLIAKGVYGKNHSDIILDKYS
                     INKIFSNKNNVNLLRQGKLVIIK"
     gene            complement(409748..410770)
                     /locus_tag="BT0398"
                     /db_xref="GeneID:4642798"
     CDS             complement(409748..410770)
                     /locus_tag="BT0398"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945398.1"
                     /db_xref="GI:119953189"
                     /db_xref="GeneID:4642798"
                     /translation="MKLLIQAFGLMLVFSCCKIKQSEIQSLVSLLEESSKKGLDRFLI
                     VDRIVDIHMRNKDYQDALRSVNQEIAHYESREYYPLYFYLMGNIYSSIKEDLVAFTYY
                     RYVVDNFDDYIYENSSVKLDIAKRVINLNIEAGHKIRYYKLLLDDHAESLTNSDRGNY
                     YYNLALSLESIQNYDEAYFYYNKLLSIPRSDLRIDSIDYSGVITKVNYYNNPDFIIYR
                     NLNDLIQDVKRYIFSGNTTKLLSIRDKHNFFIQSWDQRGGKSNSINTNSFLTTMIKLG
                     SRRKNGIQFASSFEADSSDDISYLGSSGWEHIWEWYFVFKKISYPKDPEINNGWAWIG
                     VYLGKK"
     gene            410795..412153
                     /locus_tag="BT0398A"
                     /db_xref="GeneID:4642801"
     CDS             410795..412153
                     /locus_tag="BT0398A"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945399.1"
                     /db_xref="GI:119953190"
                     /db_xref="GeneID:4642801"
                     /translation="MYNKTYLRVNKNYQDFNMNKKLIYILLLILFLSCFNKNNKYGIV
                     LDSKNREKLPNGSLVKIEDANQEKKTVTINYNGIKFIVHKFTIEEFQTKKEAENFKLS
                     IQPYVNKYAISKKDLLPLRTSPDSYRENIIYRISKESILKIIHIGKDTEVGSLKGKWL
                     YVLTKDGHKGYVFDYALEVFDNITGTILTNPLDQVSQNDIINTFNNIKYLRPLYYEKM
                     IAYNTYNTNLLREEYGLFFTPKNEIIINIPELSLHFKFDIVEEVKPNGFLFRSKTSEE
                     DFILLTKETQNYYKSIIKVKEHNFESKFVIIEQNVEKIILESKKQNQNLINRLISYGT
                     LINTQYGNIEFKSDQTFIWKVDKKIYNFPSSGTFEIIGLSPNLQISYKKAIKLMTKER
                     EKYFCLLDYTDNALQLIFISPKNVKDDLIIIDDKDKIAVILFNNAQSNQEIIKQQSQK
                     TI"
     gene            412166..412822
                     /locus_tag="BT0399"
                     /db_xref="GeneID:4642800"
     CDS             412166..412822
                     /locus_tag="BT0399"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945400.1"
                     /db_xref="GI:119953191"
                     /db_xref="GeneID:4642800"
                     /translation="MKIIFILLLTQFITFLNANENTKIIKELSKTIYNLSNKEYEIDK
                     AKLDSFIESIDLNNTNILKELQKIKNDFLITSVYFQNIKGTLIALNLSAEINFQYKIS
                     PLSISIINNDFQTTKTLIDYGIKINQIDETEYPSIFWAIYLNNEKIFNLLKEKGADLS
                     LALKNGKTPIQAAIEIENINLIELLLKKNAYIKDKYKKEIKNLKNKNIKDILKKYKVI
                     "
     misc_feature    412469..412759
                     /locus_tag="BT0399"
                     /note="ankyrin repeats;  ankyrin repeats mediate
                     protein-protein interactions in very diverse families of
                     proteins. The number of ANK repeats in a protein can range
                     from 2 to over 20 (ankyrins, for example). ANK repeats may
                     occur in combinations with other...; Region: ANK; cd00204"
                     /db_xref="CDD:238125"
     misc_feature    412475..412750
                     /locus_tag="BT0399"
                     /note="Ankyrin repeats (3 copies); Region: Ank_2;
                     pfam12796"
                     /db_xref="CDD:257303"
     gene            413248..414438
                     /locus_tag="BT0401"
                     /db_xref="GeneID:4642799"
     CDS             413248..414438
                     /locus_tag="BT0401"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter family protein"
                     /protein_id="YP_945401.1"
                     /db_xref="GI:119953192"
                     /db_xref="GeneID:4642799"
                     /translation="MNTKVKFSLIIPIGILLGLFFPSGAYNILSHIFIRLGYLSLIPF
                     LIFSIPLGIENIIENKKFRKLFGKTIYYGILVNIMGIIISIVIATIYLPQRIPILDKN
                     IQNTYTFDQKVFLETFFPKNIFIIFTNNNPNLLSIYIVSIIIGASLYYAKQKGRIARE
                     LILSFSNLFYHANGIVVKILHFGIIFITAAYTTNLKNFKNYQYYIDSIIFLSLWTITI
                     ILIIIPMISYRLTKNFKLSYKNILISIQNIIFAGLTMDAYAPYSILIEDIKNERINIK
                     KSIITNIPIINFISKSGTIFIATISFFIILKSYSSLPISIYEISYMSILAFLFIFAFP
                     HIPNSLIYIITMLCSTYTKGIELSHSNIIPILPILTSLALMIDFTSNIAIIQIIDFNE
                     LKDT"
     misc_feature    413260..414432
                     /locus_tag="BT0401"
                     /note="Na+/H+-dicarboxylate symporters [Energy production
                     and conversion]; Region: GltP; COG1301"
                     /db_xref="CDD:224220"
     gene            complement(414465..415970)
                     /locus_tag="BT0402"
                     /db_xref="GeneID:4642866"
     CDS             complement(414465..415970)
                     /locus_tag="BT0402"
                     /EC_number="6.1.1.15"
                     /note="catalyzes the formation of prolyl-tRNA(Pro) from
                     proline and tRNA(Pro)"
                     /codon_start=1
                     /transl_table=11
                     /product="prolyl-tRNA synthetase"
                     /protein_id="YP_945402.1"
                     /db_xref="GI:119953193"
                     /db_xref="GeneID:4642866"
                     /translation="MSIMMNFSKRVRFMGNFISSKEEEFSKWYLDIVQKAKLVDYSPI
                     KGCMVIMPYGYAIWEQIKSILDNKFKETGHENAYFPLLIPYEFLEREKEHVKGFSPEL
                     AVITTAGGEELAEPLVLRPTSETIIWNMYSKWIKSYRDLPVKINQWANIVRWEKRTRP
                     FLRTTEFLWQEGHTAHETAGEALEETLFILNLYKRFIEDYLAIPVFCGQKTEREKFAG
                     AVSTYTIEALMQDKKALQAGTSHYLGLNFAKAFDVKFQNKKGEMDYVFATSWGVSTRL
                     IGALIMVHSDSKGLILPPKIAPIEIIIVPIFKRDDEVNKKIIEYATTIFNILKEAKFR
                     VELDRDIKNSPGFRFAAVELKGIPIRIEVGSNDILMDCVTVARRDQDKNSKYQVSVKE
                     LPSKMRHELETMQCELFNRALKFRNLHTKEIIGFKENDYDTFKTYINEHLGFVLSSWC
                     GNEVCEESIKNDTKATIRCIPEDFQNRSLNNLTCIYCNTTAKHLVLFARSY"
     misc_feature    complement(414468..415931)
                     /locus_tag="BT0402"
                     /note="prolyl-tRNA synthetase; Provisional; Region:
                     PRK08661"
                     /db_xref="CDD:236327"
     misc_feature    complement(415122..415901)
                     /locus_tag="BT0402"
                     /note="Prolyl-tRNA synthetase (ProRS) class II core
                     catalytic domain. ProRS is a homodimer. It is responsible
                     for the attachment of proline to the 3' OH group of ribose
                     of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region:
                     ProRS_core_arch_euk; cd00778"
                     /db_xref="CDD:238401"
     misc_feature    complement(order(415473..415475,415521..415523,
                     415581..415583,415647..415661,415665..415667,
                     415728..415733,415737..415745,415794..415796,
                     415815..415826,415848..415853))
                     /locus_tag="BT0402"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238401"
     misc_feature    complement(415728..415751)
                     /locus_tag="BT0402"
                     /note="motif 1; other site"
                     /db_xref="CDD:238401"
     misc_feature    complement(order(415146..415148,415152..415154,
                     415158..415166,415248..415250,415254..415259,
                     415263..415265,415458..415460,415464..415466,
                     415470..415472,415479..415487,415506..415508,
                     415512..415514,415599..415601,415605..415607))
                     /locus_tag="BT0402"
                     /note="active site"
                     /db_xref="CDD:238401"
     misc_feature    complement(415506..415517)
                     /locus_tag="BT0402"
                     /note="motif 2; other site"
                     /db_xref="CDD:238401"
     misc_feature    complement(415146..415160)
                     /locus_tag="BT0402"
                     /note="motif 3; other site"
                     /db_xref="CDD:238401"
     misc_feature    complement(414468..415106)
                     /locus_tag="BT0402"
                     /note="ProRS Prolyl-anticodon binding domain, long version
                     found predominantly in eukaryotes and archaea. ProRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in...; Region:
                     ProRS_anticodon_zinc; cd00862"
                     /db_xref="CDD:238439"
     misc_feature    complement(order(414843..414845,414849..414851,
                     414879..414881,414903..414905,414921..414923,
                     415050..415055))
                     /locus_tag="BT0402"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238439"
     misc_feature    complement(order(414510..414512,414519..414521,
                     414606..414608,414621..414623))
                     /locus_tag="BT0402"
                     /note="zinc-binding site [ion binding]; other site"
                     /db_xref="CDD:238439"
     gene            416518..417117
                     /locus_tag="BT0405"
                     /db_xref="GeneID:4642864"
     CDS             416518..417117
                     /locus_tag="BT0405"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945403.1"
                     /db_xref="GI:119953194"
                     /db_xref="GeneID:4642864"
                     /translation="MKTLLKLIMVFLTSLSVATTINTSNLNKILNKQQTQFRSFGIGF
                     GIGNPITNIIINFPYVDIDIGYGGFNGLHPNNFIPYIVFGTDILFKEEIYQSIMLTGG
                     LGIGIDLSQIKPDEQNSSNIKQENTQDKQEEFSIASSNNRLGIVFRLPIILEYSFLTN
                     VVIGFKAITTIGGTMIFQPTSMEGIRFGFFGFGFIKIYI"
     misc_feature    416602..417108
                     /locus_tag="BT0405"
                     /note="Protein of unknown function (DUF3996); Region:
                     DUF3996; pfam13161"
                     /db_xref="CDD:257532"
     gene            417125..417955
                     /locus_tag="BT0406"
                     /db_xref="GeneID:4642813"
     CDS             417125..417955
                     /locus_tag="BT0406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945404.1"
                     /db_xref="GI:119953195"
                     /db_xref="GeneID:4642813"
                     /translation="MMKNNTQKIFILLLIFNLHHFAFSKSNNNYSIRCKQEDDGTTCI
                     TNDKPIIEEPKLTLEEPKLTLEEPKPIIEEPKPIIEEPKLTLEEPKPISEEPKLILEE
                     PKPIFEEPKPQIITNFHAIHREKNPYSFAAGIGTGNPLINLLISVPYVDIDIGYGSFL
                     YFNPTNFKPYNLIAIDLIFKQQIGEYLIVGGGVGIGTDWSQANLTSLGTTQPSPYDRI
                     GIVTRLPLSIEHKIIKNLSLGFKVYPTLGPTIFLTKPKIVFEGIRFKFFAIGFIRVFM
                     "
     misc_feature    <417326..>417469
                     /locus_tag="BT0406"
                     /note="Protein of unknown function (DUF740); Region:
                     DUF740; pfam05340"
                     /db_xref="CDD:253157"
     misc_feature    417479..417946
                     /locus_tag="BT0406"
                     /note="Protein of unknown function (DUF3996); Region:
                     DUF3996; pfam13161"
                     /db_xref="CDD:257532"
     gene            complement(417995..419110)
                     /locus_tag="BT0407"
                     /db_xref="GeneID:4642802"
     CDS             complement(417995..419110)
                     /locus_tag="BT0407"
                     /EC_number="5.3.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="YP_945405.1"
                     /db_xref="GI:119953196"
                     /db_xref="GeneID:4642802"
                     /translation="MRSDNIFLMKNKIKEYDWGGTSFIPSLLGQREDGLPKAEMWLGA
                     HKTFSSKILVDGQYVFLCDFLENHKELLGCESELSFLLKVLSAQKPLSIQIHPSKDIA
                     LKGFELENDKGIDINDSKRIYKDKNPKIELVYALSDFYALKGFLPIFEIKSIYKKLKL
                     DFHFATHKEFIKIIFSLQKFEIEDAISRVKKNLSFINDFRAYWFNEIYEIYGADIGLL
                     VFLGMYIFKLSPGEVLYTESQEVHAYLQGDCLELMTNSDNVIRAGLTTKYIDKDEMLK
                     VGRFEEGVFSLLRGKEIDGFNVFKLPDTNLSLFQRNINEKICFKKDGVMILLVMNGEI
                     QINNGVCLKRGESVFIGNYDEKLLICGNGEIFIALSL"
     misc_feature    complement(418007..419104)
                     /locus_tag="BT0407"
                     /note="Alpha-Mannosidase Binding Domain of Atg19/34;
                     Region: ABD; cl19057"
                     /db_xref="CDD:267410"
     misc_feature    complement(418007..419101)
                     /locus_tag="BT0407"
                     /note="Phosphomannose isomerase [Carbohydrate transport
                     and metabolism]; Region: ManA; COG1482"
                     /db_xref="CDD:224399"
     gene            complement(419107..420975)
                     /locus_tag="BT0408"
                     /db_xref="GeneID:4642876"
     CDS             complement(419107..420975)
                     /locus_tag="BT0408"
                     /EC_number="2.7.1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, mannose-specific IIABC component"
                     /protein_id="YP_945406.1"
                     /db_xref="GI:119953197"
                     /db_xref="GeneID:4642876"
                     /translation="MFLKFLKKELIFISDKINSKEEAINFLVDQVSKRGYTHDKTRFL
                     QGLFERENIGDTSWENGVAIPHFIGDVVKSSFISLLYIKGDGIKWSDDNPPVNLIFLI
                     CMSKSQQGNDHIKSIAFIAKLFESDDFKNILKVMKSTDEIYSYIENVERSSTDDTTSV
                     SKSEKIVAVCACPVGIAHTYIAAKKLEVEAKRQGYILKVETQGSIGIDNPLTETEIKD
                     ADVIILAVDKDVDEERFDGKRVYKVSTAKAINNVENVIKEAFSAPILNYKNVHSIKDK
                     SGSSRTGFYKYLMSGVSPMIPIVASGGILIALGISLAGIGSDGPNFDKYPFYKTITDI
                     GGVAFGMMLPILSGFIAMAIADKPGLAPGLVGGVLARDVKAGFLGAILVGFMAGFVAK
                     WIAKRKIPEWLRPVMPIFVIPLISTVIVGFFMIYVGVYIGQFMALLENGLKSLQNNSE
                     TYGIIGKLFLGLILGAMVAIDMGGPFNKVAFLFGVGMIPQVPQIMGMVASAIPVPPMA
                     MGLATLIMPKLFEEEERESGKISFLISFIGISEGAIPFAASDPARVLPSIVLGGAVAS
                     IIAAFLGVADHAPHGGPIVLPVVDNKLGFIIAIAVGVVVATSLVIFLKSLKVKESK"
     misc_feature    complement(419110..420975)
                     /locus_tag="BT0408"
                     /note="PTS system 2-O-a-mannosyl-D-glycerate specific
                     transporter subunit IIABC; Provisional; Region: PRK09765"
                     /db_xref="CDD:182066"
     misc_feature    complement(420538..420960)
                     /locus_tag="BT0408"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cd00211"
                     /db_xref="CDD:238129"
     misc_feature    complement(order(420778..420780,420826..420828))
                     /locus_tag="BT0408"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    complement(420778..420780)
                     /locus_tag="BT0408"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     misc_feature    complement(420193..420480)
                     /locus_tag="BT0408"
                     /note="PTS_IIB_fructose: subunit IIB of enzyme II (EII) of
                     the fructose-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In this system, EII (also
                     referred to as FruAB) is a fructose-specific permease made
                     up of two proteins (FruA and...; Region: PTS_IIB_fructose;
                     cd05569"
                     /db_xref="CDD:99911"
     misc_feature    complement(order(420439..420447,420451..420462))
                     /locus_tag="BT0408"
                     /note="P-loop; other site"
                     /db_xref="CDD:99911"
     misc_feature    complement(order(420439..420444,420451..420456,
                     420460..420462))
                     /locus_tag="BT0408"
                     /note="active site"
                     /db_xref="CDD:99911"
     misc_feature    complement(420460..420462)
                     /locus_tag="BT0408"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99911"
     misc_feature    complement(419116..420129)
                     /locus_tag="BT0408"
                     /note="Phosphotransferase system, fructose-specific IIC
                     component [Carbohydrate transport and metabolism]; Region:
                     FruA; COG1299"
                     /db_xref="CDD:224218"
     gene            421079..421738
                     /locus_tag="BT0409"
                     /db_xref="GeneID:4642840"
     CDS             421079..421738
                     /locus_tag="BT0409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945407.1"
                     /db_xref="GI:119953198"
                     /db_xref="GeneID:4642840"
                     /translation="MNLIMKKLIEFCFLLLCASLYSSNNEGHKKNEINNKKSILLKEK
                     STNHENDFFSVKRGFIYSTGTGLGTGFFLNSKVNHIIFRPYYIFAINNFDFLVVCMIL
                     MIKEYNISKKVKYSSSYIGTGINWHIINLSKKMKYLSSTTGIGGRLYLSTNLIGDFKF
                     YDKLPYVIEPYIFFEFSTKKATPYLNIYSKIECLFLDTFNISFDFGIRYNLKNSNEVN
                     S"
     gene            421735..422616
                     /locus_tag="BT0411"
                     /db_xref="GeneID:4642842"
     CDS             421735..422616
                     /locus_tag="BT0411"
                     /EC_number="3.1.30.-"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="YP_945408.1"
                     /db_xref="GI:119953199"
                     /db_xref="GeneID:4642842"
                     /translation="MNKRLKILFCFYILILLGFLFLYQNPKILNNIKEIAYNYLSKLK
                     DKIYEPEISTELKEEYLLPKGYLTTQIIHKKYYSLGYAESARQSEWVAYQLKREMVEL
                     ALTLLREKKITRSKNFFEDQDIKGIAPKLSDYLKSGYDRGHIVSSADMSFSKDAMLDT
                     YFLSNISPQQREFNSGIWLKLEQLVRKWAILKEKIYIVSAGILTENKGFIGKNKILVP
                     KNFYKIVLSLNNNNFYDILAFIIPNEKAQDLELRNYVVNVNLIEEKTKINFFAKLDAE
                     IKKIIKMKKDVRSWKFR"
     misc_feature    421954..422559
                     /locus_tag="BT0411"
                     /note="DNA/RNA non-specific endonuclease; Region: NUC;
                     smart00477"
                     /db_xref="CDD:214683"
     misc_feature    order(422152..422157,422161..422163,422254..422256,
                     422278..422280,422290..422292)
                     /locus_tag="BT0411"
                     /note="active site"
                     /db_xref="CDD:238043"
     misc_feature    order(422152..422157,422290..422292)
                     /locus_tag="BT0411"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238043"
     misc_feature    422254..422256
                     /locus_tag="BT0411"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238043"
     gene            422601..423377
                     /locus_tag="BT0412"
                     /db_xref="GeneID:4642806"
     CDS             422601..423377
                     /locus_tag="BT0412"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945409.1"
                     /db_xref="GI:119953200"
                     /db_xref="GeneID:4642806"
                     /translation="MEIQMKTLFAKLNIFLLTTFVLGIIIISIFMYYINFNINFYTYI
                     IKIYNKNLLILVNKFFIFSIGIIGSIWTCINYKRTNNIQFVFFYCFILSYILEPISIF
                     KYYFLSNILSLEFYYFMKFYHLITVFSLLNLFFLSLYICDFQIKSITYAIYLIFTFAM
                     VYNSLAPINAYEYTKDFLSPTANNRFYVYLFLLLIPINFLVSCLRKKNLSYFLLFISI
                     SLIVSGIYLNFIEITYAFIPISIGAPMYLKESGKVFFYWL"
     gene            complement(423381..423977)
                     /locus_tag="BT0413"
                     /db_xref="GeneID:4642841"
     CDS             complement(423381..423977)
                     /locus_tag="BT0413"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical membrane spanning protein"
                     /protein_id="YP_945410.1"
                     /db_xref="GI:119953201"
                     /db_xref="GeneID:4642841"
                     /translation="MFDQVFYNENVKYELYRKFFHISTLVFLFFYKLNFWVGLVSSLF
                     FMFAYLILEIFRIMEINLFFLRGISEIIIKSREVSSYKISLSPIFLVVSIFCTYFLID
                     KPFSYIGIFSACLGDGLASLVGKLIPSFKLVNNKTFSGSVAVFLVAFIVCYYFFPNFI
                     IASVVGMGAVLVELFDFEKYDNLFLPLGVATLSFVLIA"
     misc_feature    complement(423387..423965)
                     /locus_tag="BT0413"
                     /note="Dolichol kinase [Lipid metabolism]; Region: SEC59;
                     COG0170"
                     /db_xref="CDD:223248"
     gene            complement(423977..424996)
                     /locus_tag="BT0413A"
                     /db_xref="GeneID:4642810"
     CDS             complement(423977..424996)
                     /locus_tag="BT0413A"
                     /EC_number="5.2.1.8"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_945411.1"
                     /db_xref="GI:119953202"
                     /db_xref="GeneID:4642810"
                     /translation="MKRCLLYFLLILMLITCDSKRKDLVEKKGIFALIDTNKGNIEIE
                     LYYKIAPLTVMNFIGLSEGTIKNSVTSQPYFENIIFHRVVDEFVIQTGDPTGTGTGGP
                     GYVFPDELNKNLSHNEPGIVSMANSGPDTNGSQFFITLADNLTYLDLKHSIFGKVVAG
                     MDTVRNIRQGDKIEKVRIIRVGEDAKAFKVDNEEFLKLKKSYEARKIAEVKKYMASQL
                     EIIDKDYKDFQKDESGILYKINKQGNGKNVKSGNIVKVDYEGFLLSGIKFDSSIDRGK
                     PIEFVVGSGQVIEGWDVMLSDMCEEEERVVIIPPNLAYGERSIGNVIKPNSFLKFNII
                     LRKIS"
     misc_feature    complement(424460..424897)
                     /locus_tag="BT0413A"
                     /note="cyclophilin: cyclophilin-type peptidylprolyl cis-
                     trans isomerases. This family contains eukaryotic,
                     bacterial and archeal proteins which exhibit a
                     peptidylprolyl cis- trans isomerases activity (PPIase,
                     Rotamase) and in addition bind the...; Region:
                     cyclophilin; cd00317"
                     /db_xref="CDD:238194"
     misc_feature    complement(order(424544..424546,424556..424561,
                     424586..424588,424592..424594,424619..424624,
                     424727..424729,424733..424738,424745..424747,
                     424751..424753))
                     /locus_tag="BT0413A"
                     /note="active site"
                     /db_xref="CDD:238194"
     misc_feature    complement(423998..424261)
                     /locus_tag="BT0413A"
                     /note="FKBP-type peptidyl-prolyl cis-trans isomerase;
                     Region: FKBP_C; pfam00254"
                     /db_xref="CDD:249719"
     gene            425143..426003
                     /locus_tag="BT0414"
                     /db_xref="GeneID:4642815"
     CDS             425143..426003
                     /locus_tag="BT0414"
                     /EC_number="2.1.1.80"
                     /codon_start=1
                     /transl_table=11
                     /product="pili chemotaxis protein methyltransferase
                     CheR-like PilK"
                     /protein_id="YP_945412.1"
                     /db_xref="GI:119953203"
                     /db_xref="GeneID:4642815"
                     /translation="MLNISNELLLKFCNFIYENSGIRFDEKNKVVLQGRINDAIHELE
                     NINTPEQLYDLINSDKFQKEYFLDLVTTNLTRFFRNEAHFATFERFIIPNLINIKTQE
                     GKNRIIIWSAGCSTGEEPYSLAFVLKHNLPKNFDFIIIASDLSLKSLMIAKEGYYSVK
                     KCEHIPIQYKIYIKPHMNGYKVIDDIKKHIRFDYHNLNFESGFSEMDVIFCRNVLIYF
                     DEKSKIRVLKKFYSSMAMKSYLFIGHSESLFGLNLPFKFLRTPWAIIYEKDDKDVPKK
                     KFQFKNKYKL"
     misc_feature    425155..425322
                     /locus_tag="BT0414"
                     /note="CheR methyltransferase, all-alpha domain; Region:
                     CheR_N; pfam03705"
                     /db_xref="CDD:202731"
     misc_feature    425161..425940
                     /locus_tag="BT0414"
                     /note="Methyltransferase, chemotaxis proteins; Region:
                     MeTrc; smart00138"
                     /db_xref="CDD:214534"
     misc_feature    425359..425937
                     /locus_tag="BT0414"
                     /note="CheR methyltransferase, SAM binding domain; Region:
                     CheR; pfam01739"
                     /db_xref="CDD:250828"
     gene            426039..427175
                     /locus_tag="BT0415"
                     /db_xref="GeneID:4642511"
     CDS             426039..427175
                     /locus_tag="BT0415"
                     /EC_number="3.1.1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="protein-glutamate methylesterase"
                     /protein_id="YP_945413.1"
                     /db_xref="GI:119953204"
                     /db_xref="GeneID:4642511"
                     /translation="MQIKIYVLVIEASSVNRKTISDIINSSLKLEVIATAANTDFALK
                     KLKKHPDVILLSLEEETIKEITLIKKKENINNKLPVIILSSNKDIAKNAILKGADDFI
                     IKTDNKLESIKDKIIDLLSIYGNKTIKNKIITDINFKFKTNQYLINNKVNKENSNTTK
                     ATDKNENTNLNQEKIIDEKDLKKLKNRKFEIVVIGISTGGPAALKTILPEIPKNFPLP
                     IIIVQHMPKGFTTEFAKSLNNICNLTVKETSNKEILQKGFIYISSGGYHTRINKINEN
                     YQIEVFDAENVNGHKPSIGVLFKSISENVKDKAIALIMTGMGSDGSREIGEIKKAGGL
                     TIAQDEKSSVVFGMPKIAIEENNIDYIVSISHVVKLLKAILLDG"
     misc_feature    426048..427163
                     /locus_tag="BT0415"
                     /note="Chemotaxis response regulator containing a
                     CheY-like receiver domain and a methylesterase domain
                     [Cell motility and secretion / Signal transduction
                     mechanisms]; Region: CheB; COG2201"
                     /db_xref="CDD:225111"
     misc_feature    426060..426398
                     /locus_tag="BT0415"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(426069..426074,426204..426206,426288..426290,
                     426339..426341,426348..426350,426354..426356)
                     /locus_tag="BT0415"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    426204..426206
                     /locus_tag="BT0415"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(426348..426350,426354..426359)
                     /locus_tag="BT0415"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    426609..427160
                     /locus_tag="BT0415"
                     /note="CheB methylesterase; Region: CheB_methylest;
                     pfam01339"
                     /db_xref="CDD:250544"
     gene            427199..428407
                     /locus_tag="BT0416"
                     /db_xref="GeneID:4642324"
     CDS             427199..428407
                     /locus_tag="BT0416"
                     /codon_start=1
                     /transl_table=11
                     /product="pheromone shutdown protein"
                     /protein_id="YP_945414.1"
                     /db_xref="GI:119953205"
                     /db_xref="GeneID:4642324"
                     /translation="MDITKENTEDCFLHVSTLDTDHDKIYVLGTAHVSKKSSQDTATL
                     IETLKPDFIAVELDEARYHAILKTDENEKWRNLDIYKVIKQGKAFLLIVQIILSNFQK
                     KLAKEQGINPGEEMKTAILKAKEHNIPLILADRKVETTLKRAWNCVPTFEKVKIISSL
                     FSFSDVKVTQDEIEKLKEQDVLSNMMEELAKEIPTVKKVLIDERDEFIASKILEGSGT
                     ILAVVGAGHVKGIIANLKEIKENKKIVNIDNLNTIPKNTFSVSKLISYFIAISIVILM
                     ASSFYFKGFDFAYKNLEFWIICNSLFAGLAALLLRANIITIITASIGAPIFSLIPFIG
                     TGMVAGLVEAYINKPKIKDFEKLQEDLENIKGYFKNKVTKILLIVFFVNIGSAIGTIV
                     GFKFLLNIFS"
     misc_feature    427268..428401
                     /locus_tag="BT0416"
                     /note="TraB family; Region: TraB; cl12050"
                     /db_xref="CDD:264523"
     gene            428445..429077
                     /locus_tag="BT0417"
                     /db_xref="GeneID:4642859"
     CDS             428445..429077
                     /locus_tag="BT0417"
                     /EC_number="2.7.4.3"
                     /note="essential enzyme that recycles AMP in active cells;
                     converts ATP and AMP to two molecules of ADP"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="YP_945415.1"
                     /db_xref="GI:119953206"
                     /db_xref="GeneID:4642859"
                     /translation="MKLVFLGPPGSGKGTIAKILSGKLNYYHISTGDLFRANISNATP
                     LGKEIKQIVENGQLVPDSITIKIVEDKINTLANKDNFILDGFPRNINQAKALDTFLQN
                     IQIINFLLDEAILIKRLSGRRICQSCGGIFNIYTLPTKEKGICDLCKGSLYQRKDDVE
                     ESLKIRLQEYHLQTKPLIDFYSKNNRLNNINASKDIDGVEKSLIEIISKY"
     misc_feature    428445..429074
                     /locus_tag="BT0417"
                     /note="adenylate kinase; Provisional; Region: PRK14526"
                     /db_xref="CDD:172992"
     misc_feature    428448..429041
                     /locus_tag="BT0417"
                     /note="Adenylate kinase (ADK) catalyzes the reversible
                     phosphoryl transfer from adenosine triphosphates (ATP) to
                     adenosine monophosphates (AMP) and to yield adenosine
                     diphosphates (ADP). This enzyme is required for the
                     biosynthesis of ADP and is essential for...; Region: ADK;
                     cd01428"
                     /db_xref="CDD:238713"
     misc_feature    order(428535..428537,428550..428552,428619..428621,
                     428694..428699,428703..428708,428718..428720)
                     /locus_tag="BT0417"
                     /note="AMP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238713"
     misc_feature    order(428550..428552,428694..428696,428706..428708,
                     428808..428810,428940..428942,428952..428954)
                     /locus_tag="BT0417"
                     /note="ATP-AMP (Ap5A)-binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238713"
     gene            429150..430205
                     /locus_tag="BT0418"
                     /db_xref="GeneID:4642861"
     CDS             429150..430205
                     /locus_tag="BT0418"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945416.1"
                     /db_xref="GI:119953207"
                     /db_xref="GeneID:4642861"
                     /translation="MRKYFMEERIYMIKKLFMVLIFLQTILIYSKENQDEMGYFYVNS
                     QMAYYPSHALGTSGSKFSPSFISPQFKSVSPNNQISPSSWGSIKLISNLGYYKFFKIL
                     KNPDPHSLLLQNTGIDVDFKIGLSPVVALLKGNIGFTPIAFINLYTGIEIGIGWQGFG
                     FKGIGIHVGNGRYSSKPELYSEVTMGGRLQFDLNAVFGGDWTHIITVVGNNILHIKNP
                     HAKDNQLWKYKADEGKNINGFTINPYALLAYKMPIPLNIIGLLYEGQTYIGHARNVST
                     TQNQGWGSDFFYHNFSLISKIEIIENLTLDMQFKFSTAPIYTVNTMGMADISKRISTN
                     NSYIYYDSIGFSLTYKI"
     gene            complement(430208..431140)
                     /locus_tag="BT0419"
                     /db_xref="GeneID:4642471"
     CDS             complement(430208..431140)
                     /locus_tag="BT0419"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="YP_945417.1"
                     /db_xref="GI:119953208"
                     /db_xref="GeneID:4642471"
                     /translation="MTKGMILDNFEEISVEPQKLLLVDDTPTNLDLLIDILQHKYEIR
                     VALNGFDALKQVEIASPDLILLDVLLPDVSGYEVCKRLKNDPETKDIPVIFISSSDST
                     DAQLEGFSVGGVDYILKPFNGRIIDARIKTHLELKRLRDYFKNLARIDGLTQIPNRRF
                     FTDKFAKSWMQALEHKKNVIVGMLDIDYFKKYNDNYGHTNGDECLRLIAKSLNKIAIK
                     YKIDIARYGGEEFILFSVNKSLNEVIKIVSILIEDIRNLEIVHEYSNISNFVTVSIGL
                     AEQIPYDSNFTNIIKLADDKLYEAKISGRNQCKY"
     misc_feature    complement(430739..431080)
                     /locus_tag="BT0419"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(430781..430786,430793..430795,
                     430850..430852,430916..430918,430940..430942,
                     431066..431071))
                     /locus_tag="BT0419"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(430940..430942)
                     /locus_tag="BT0419"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(430916..430924,430928..430933))
                     /locus_tag="BT0419"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(430778..430786)
                     /locus_tag="BT0419"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(430217..430699)
                     /locus_tag="BT0419"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(430454..430456,430586..430588))
                     /locus_tag="BT0419"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(430451..430462,430466..430468,
                     430535..430537,430547..430549,430559..430564,
                     430571..430573))
                     /locus_tag="BT0419"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(430394..430396,430481..430483))
                     /locus_tag="BT0419"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(431152..435585)
                     /locus_tag="BT0420"
                     /db_xref="GeneID:4642473"
     CDS             complement(431152..435585)
                     /locus_tag="BT0420"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory transduction protein kinase"
                     /protein_id="YP_945418.1"
                     /db_xref="GI:119953209"
                     /db_xref="GeneID:4642473"
                     /translation="MRGLSLFLFLFFVSHVSLPAKETLKFKLVDQYYPLYYKNQENKM
                     VGMIFYLLDKWAQDNDYDISIEAIDYLNKDKIEDDVVYLGLTYNSDLNEYLYFKNEIG
                     KCVTAFIYDSEKEQKPSNLFFSNELRVGVVKNTIYEDILRFHGHNDNIFLFPDTEKLL
                     LALRGNKIDLVYGSYKSLSCVWYSSFYPSFMKVFNSEYFYSFGIRAAISKNAISQLRD
                     LNVDLLSYMQSLSREEYASFKEFDFLFKLDVGIYNDYPPFSFINSKGQFAGILVDLWN
                     TLAREYGFSVKFVGFPKESIKGSLDDKDVSVWGGIIEDDNILTSKKYKATAPICSLNF
                     NLYFTNAKNSNKVINSQVIGLSLNDIQLDKNTDIVNNFLDIVNHSYGFVENSITVNYL
                     LKLHGYNNILKLQDSSLSKGKFLVLAANNKRLQLFAYMLNALTENILFDTLLQIGKNW
                     LGQDEIEDYQNNFYGHINSGNFNIEEKIWLQNNKRLTLAVKDWYPIDYFNSGRYKGVN
                     EWLIKKIKRLTNLDFNIISVHERDIEELMKLGKIDILSANLDDANSDYIFNIKAVSGI
                     PLHLFSNKTRLFTSRSFNSIAVLKFLYTKKLETKIGTRLVQVDSFTDALDLLYRGKVS
                     GIVSDEYTATINFEDLNIRDIKKIFTVPNLTFDLNIAVHNQDYILRRIIQKILFRTNV
                     NNKLYFDDWVFNVHESFKDLRLKKSGIAVLTMGMFVFTIFMFCLFNLWKEIGFRKKMY
                     SSAISEKKVIENAIAAKTIFLASMSHDIRTPINGIIAATELLENTDLLGVQKEYVQMI
                     NYSSISLLSLIDEILYISKIDMNEIYIDNNEIDLEHEIECVLKGFQSQSAKQNIDLIF
                     YSKSDLENYLIGDRARLKRVLINLIGNSFKFTTDGIIVLNYEMIRSTEDNDGNKIITI
                     EFKVTDTGKGIKESNIPVIFGLFRQGNDSDSKKYEGSGLGLAISRKLVSLMGGPGIAV
                     ESEVGKGTTFSFMLPFVLGHKIKDKEVNKLELVTNKKILSLFLSKKTVEVLRDISKIF
                     DYKDIHYFYSYEHAYKAFYRYPYYDFVFINVDDFGLQEGLKFAEKIESLNSNVRIVFV
                     FYCLKSDEIIDFKYEYMQKPFQRWDFYSDWIKNGAIVDVPIINESNTLKLKNNVGILI
                     AEDNEINQKILKNVLIVIGVKEDSIDIVDDGVKAIEFLKTNKYDMAFIDIRMPNCDGL
                     TVSKEIRKFESQNNLNPCVLIAVTAHALREYKDRCLENGMNDYLAKPIHISSIKYILK
                     KYLHIEVEDNKIIADKTFDGFSNLPNLDINNALKDLNISYDMYVDLCRGFVNMSDNLI
                     RDLDEAFNLNNIKLVKELAHSIAGALGNMRSNLFGNFKQIEINTGSIHELKILYSEAR
                     KGLIVLIKNIREQILDVIETYDQEKLKFKSNDEFLSLMQKLLNGIEDRNPKEYKEVLE
                     VLKRYSLDDNNIILFDSLIKYLRVYNFKESANIVKRMINLR"
     misc_feature    complement(434953..435498)
                     /locus_tag="BT0420"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(434233..434841)
                     /locus_tag="BT0420"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(434233..434841)
                     /locus_tag="BT0420"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(434434..434436,434569..434571,
                     434707..434709,434821..434823))
                     /locus_tag="BT0420"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(434470..434472,434488..434490,
                     434509..434511))
                     /locus_tag="BT0420"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(434338..434343,434350..434361))
                     /locus_tag="BT0420"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(433555..434130)
                     /locus_tag="BT0420"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(433135..433326)
                     /locus_tag="BT0420"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(433150..433152,433162..433164,
                     433171..433173,433183..433185,433192..433194,
                     433204..433206,433252..433254,433261..433263,
                     433273..433275,433282..433284,433294..433296,
                     433306..433308))
                     /locus_tag="BT0420"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(433288..433290)
                     /locus_tag="BT0420"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(432628..432969)
                     /locus_tag="BT0420"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(432640..432642,432646..432651,
                     432664..432666,432670..432672,432721..432732,
                     432811..432816,432820..432822,432826..432828,
                     432832..432834,432928..432930,432937..432939,
                     432949..432951))
                     /locus_tag="BT0420"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(432937..432939)
                     /locus_tag="BT0420"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(432724..432726,432730..432732,
                     432814..432816,432820..432822))
                     /locus_tag="BT0420"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(431791..432153)
                     /locus_tag="BT0420"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(431833..431838,431845..431847,
                     431902..431904,431977..431979,432001..432003,
                     432139..432144))
                     /locus_tag="BT0420"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(432001..432003)
                     /locus_tag="BT0420"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(431977..431985,431989..431994))
                     /locus_tag="BT0420"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(431830..431838)
                     /locus_tag="BT0420"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(435642..435752)
                     /locus_tag="BT0_844"
                     /db_xref="GeneID:9487180"
     rRNA            complement(435642..435752)
                     /locus_tag="BT0_844"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:9487180"
     gene            complement(435772..438711)
                     /locus_tag="BTR0001"
                     /db_xref="GeneID:4642863"
     rRNA            complement(435772..438711)
                     /locus_tag="BTR0001"
                     /product="23S ribosomal RNA"
                     /note="lsuRNA"
                     /db_xref="GeneID:4642863"
     gene            complement(439012..439851)
                     /locus_tag="BT0421"
                     /db_xref="GeneID:4642204"
     CDS             complement(439012..439851)
                     /locus_tag="BT0421"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase (HAD superfamily)"
                     /protein_id="YP_945419.1"
                     /db_xref="GI:119953210"
                     /db_xref="GeneID:4642204"
                     /translation="MNANYEKYKMLVFDLDGTLLNNNHEIAPLTLKVLLRLKNDFHII
                     VATGRRLYEIKDVLMQLKDLQIDESYIVTANGAEIFLKNNLILRYKINYDIVRELLKV
                     KRGDIDINLYTLNNWYSDREIRSPIMNYFIETLGIQPIITDLSELEIDSCSKIVYYSH
                     DFSKLEDFANKIRDKNFKDISIFYSANDLLEITNIDASKYNAIKSIALFECISIDAIL
                     AFGDNGNDYEMLKNAGKGILMKNANKFVKNNLSNNEVTKFNNDEDGVAKFLIEFFNLD
                     IQF"
     misc_feature    complement(439045..439821)
                     /locus_tag="BT0421"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase_3; pfam08282"
                     /db_xref="CDD:254707"
     misc_feature    complement(439132..439821)
                     /locus_tag="BT0421"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    complement(<439564..439821)
                     /locus_tag="BT0421"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(order(439708..439713,439804..439812))
                     /locus_tag="BT0421"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    complement(439795..439812)
                     /locus_tag="BT0421"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    complement(439711..439713)
                     /locus_tag="BT0421"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            439985..440509
                     /locus_tag="BT0421A"
                     /db_xref="GeneID:4642776"
     CDS             439985..440509
                     /locus_tag="BT0421A"
                     /EC_number="2.4.2.8"
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine-guanine phosphoribosyltransferase"
                     /protein_id="YP_945420.1"
                     /db_xref="GI:119953211"
                     /db_xref="GeneID:4642776"
                     /translation="MSDKISTLFTEEKIKSKIKDLAQKIRNYYEDKNNVVFISLLKGS
                     FIFFADITREIGLNVKIDFLQASSYKNKTLSSLNVLIKKDIDINIQNSYVIIFDDIID
                     TGLTYKKIVEHLKTKNPKEIKICTLFNKPSRRLIELKIDYSGFEIENDFIVGYGIDFN
                     EQHRTLKNVAKISK"
     misc_feature    440036..440422
                     /locus_tag="BT0421A"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(440105..440107,440111..440113,440276..440284,
                     440288..440302,440372..440374)
                     /locus_tag="BT0421A"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            440519..441802
                     /locus_tag="BT0421B"
                     /db_xref="GeneID:4642546"
     CDS             440519..441802
                     /locus_tag="BT0421B"
                     /EC_number="6.3.4.4"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="YP_945421.1"
                     /db_xref="GI:119953212"
                     /db_xref="GeneID:4642546"
                     /translation="MSIYAVIGTQWGDEGKGKIIDFLSSKIDYVVRFNGGNNAGHTIV
                     VNNKKFIFNLLPSGVLQGAKCILGPGVVIDPLILIKELEALKHNNIKTEIFISDKAHI
                     IMPYHIKLDELNEQKKGVYKIGTTKRGIGPCYADKINRTGIRAVDLLDIKIFERKLKI
                     NLDEKNEIIEKIYNHKPFNYDDILSKYKKCIAILQYAITNTEEILNQAINSGKIILIE
                     GAQGTMLDIEHGTFPFVTSSNTLITATTGCGIPISKIKEKIGIVKAFSSRVGSGPFVT
                     EILGPIGDKIREKGQEYGSTTNRPRRIGWLDLLTIKKSISLNELNHLALTKLDILNNI
                     EDLKICTAYEFKGKIYDYIPTSCEILENVKPVYKVFKGFKQNIRNISHYEDLPIEAKE
                     YIEFIEREVGVQISILSLGAEREKTIFRNQKWINI"
     misc_feature    440525..441751
                     /locus_tag="BT0421B"
                     /note="Adenylosuccinate synthetase (AdSS) catalyzes the
                     first step in the de novo biosynthesis of AMP. IMP and
                     L-aspartate are conjugated in a two-step reaction
                     accompanied by the hydrolysis of GTP to GDP in the
                     presence of Mg2+. In the first step, the...; Region: AdSS;
                     cd03108"
                     /db_xref="CDD:239382"
     misc_feature    order(440555..440557,440561..440569,440636..440644,
                     440648..440650,441497..441499,441503..441505,
                     441749..441751)
                     /locus_tag="BT0421B"
                     /note="GDP-binding site [chemical binding]; other site"
                     /db_xref="CDD:239382"
     misc_feature    order(440561..440563,440570..440572,440639..440641)
                     /locus_tag="BT0421B"
                     /note="ACT binding site; other site"
                     /db_xref="CDD:239382"
     misc_feature    order(440630..440632,440885..440887,440894..440896,
                     441179..441181,441224..441226)
                     /locus_tag="BT0421B"
                     /note="IMP binding site; other site"
                     /db_xref="CDD:239382"
     gene            441787..443190
                     /locus_tag="BT0421C"
                     /db_xref="GeneID:4642496"
     CDS             441787..443190
                     /locus_tag="BT0421C"
                     /EC_number="4.3.2.2"
                     /note="Catalyzes two discrete reactions in the de novo
                     synthesis of purines: the cleavage of adenylosuccinate and
                     succinylaminoimidazole carboxamide ribotide"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="YP_945422.1"
                     /db_xref="GI:119953213"
                     /db_xref="GeneID:4642496"
                     /translation="MDKYINPLKSRYASKEMLYIFSPKFKYTTWRKLWYNLALVQKEL
                     GINISNKQLNKLSKHIENIDFELVKKYESKFQHEVMAHLYAYADLAGDDARKILHLGV
                     TSAYLMDNTDLVQIKEALLLIENKLLKLINTLKKFSIKHKNLVTLAYTHLQEAQLTTL
                     GKRSSLWLQSLIFDFEELKFIMSNMRFRGVKGTVGNQSSFKELFASNFEKVKDLDINL
                     AKKMGFDKVYQITSQTYDRKFDSSILNFLSNLAQSAHKITNDIRFMQHLKEIEEHFEP
                     HQIGSSAMPYKRNPIYSERIASLAKFIMSLQSSGGFIAATQWLERTLDDSACKRLNIP
                     QAFLAADATLILLSKVFNNIRVNKKMIEKHVKTEMPFILTEDILMKATKNGGDRQILH
                     EKIRIYSMKVKENIYSGTTENDLIKLILNDQSFKLTSKDIDEILNPNENIGFASYQVE
                     NFITEIIDPILEKNKEN"
     misc_feature    441808..443118
                     /locus_tag="BT0421C"
                     /note="Adenylsuccinate lyase (ASL)_subgroup 2; Region:
                     Adenylsuccinate_lyase_2; cd03302"
                     /db_xref="CDD:176471"
     misc_feature    441817..443151
                     /locus_tag="BT0421C"
                     /note="Adenylosuccinate lyase [Nucleotide transport and
                     metabolism]; Region: PurB; COG0015"
                     /db_xref="CDD:223094"
     misc_feature    order(441850..441855,442018..442020,442045..442047,
                     442075..442080,442084..442089,442231..442248,
                     442252..442254,442270..442275,442282..442284,
                     442291..442296,442312..442317,442363..442374,
                     442381..442383,442468..442470,442474..442479,
                     442498..442500,442510..442512,442531..442533,
                     442552..442554,442564..442566,442570..442575,
                     442579..442584,442648..442653,442666..442668,
                     442678..442680,442687..442692,442696..442701,
                     442708..442713,442720..442725,442735..442755,
                     442765..442770,442774..442776,442789..442791,
                     442909..442911,442921..442923,442930..442932,
                     442948..442953,443110..443112,443116..443118)
                     /locus_tag="BT0421C"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176471"
     misc_feature    order(442015..442017,442081..442083,442237..442239,
                     442483..442485,442645..442647,442651..442653,
                     442666..442668)
                     /locus_tag="BT0421C"
                     /note="active site"
                     /db_xref="CDD:176471"
     gene            complement(443187..443765)
                     /locus_tag="BT0422"
                     /db_xref="GeneID:4642882"
     CDS             complement(443187..443765)
                     /locus_tag="BT0422"
                     /EC_number="3.2.2.21"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-3-methyladenine glycosylase II"
                     /protein_id="YP_945423.1"
                     /db_xref="GI:119953214"
                     /db_xref="GeneID:4642882"
                     /translation="MFWFRIVLMDREFFMQDAVTVAKSLLGHLLVRKIGAKEIISRIV
                     ETEAYMGVMDKACHAYGGRRTSRTSAMYNIGGYAYVYMIYGMYYMLNVVASNEHNPHA
                     VLIRGVELISPKIDGIFTNGPGKLAKFLNIDLKFNKVDLINNGELFLKRGLSFNFEVS
                     CSKRINVDYAGEEYANKLWRFYIRGNKYVSKY"
     misc_feature    complement(443196..443729)
                     /locus_tag="BT0422"
                     /note="Alkyladenine DNA glycosylase catalyzes the first
                     step in base excision repair; Region: AAG; cd00540"
                     /db_xref="CDD:187726"
     misc_feature    complement(order(443271..443273,443448..443450,
                     443454..443456,443493..443495,443514..443516,
                     443529..443531,443592..443594,443619..443621,
                     443625..443627))
                     /locus_tag="BT0422"
                     /note="active site"
                     /db_xref="CDD:187726"
     misc_feature    complement(order(443268..443273,443364..443366,
                     443391..443402,443448..443450,443454..443456,
                     443493..443495,443505..443507,443514..443516,
                     443523..443525,443562..443564,443571..443573,
                     443577..443579,443592..443594,443598..443600,
                     443619..443621))
                     /locus_tag="BT0422"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:187726"
     gene            443906..443979
                     /locus_tag="BTT0008"
                     /db_xref="GeneID:4642752"
     tRNA            443906..443979
                     /locus_tag="BTT0008"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:4642752"
     gene            complement(444516..444590)
                     /locus_tag="BTT0009"
                     /db_xref="GeneID:4642305"
     tRNA            complement(444516..444590)
                     /locus_tag="BTT0009"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:4642305"
     gene            complement(444653..446203)
                     /locus_tag="BTR0002"
                     /db_xref="GeneID:4642229"
     rRNA            complement(444653..446203)
                     /locus_tag="BTR0002"
                     /product="16S ribosomal RNA"
                     /note="ssuRNA"
                     /db_xref="GeneID:4642229"
     gene            complement(446363..447751)
                     /locus_tag="BT0422A"
                     /db_xref="GeneID:4642424"
     CDS             complement(446363..447751)
                     /locus_tag="BT0422A"
                     /note="Sms; stabilizes the strand-invasion intermediate
                     during the DNA repair; involved in recombination of donor
                     DNA and plays an important role in DNA damage repair after
                     exposure to mutagenic agents"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_945424.1"
                     /db_xref="GI:119953215"
                     /db_xref="GeneID:4642424"
                     /translation="MIKNRDKEIYKCLNCGYKSLKWLGKCPECFSWESLELYSEFKSG
                     YEGDLSKSKNEIFSLRDFKQVDNVRHLTGIEEFDRVLGAGIVIGSAILISGEPGIGKS
                     TFLLQISSILSLSDKNVLYLAGEESIPQIKLRANRLRISSDILITNEINVDSLIKMLA
                     NIELDFIVVDSIQTLHSKEVQGGLGGVAQLKHCVYKLIEWARGKNITLCLVGHITKDG
                     ILAGPKVIEHMVDSVFYFEEAEKSLRMLRATKNRFGAINEVGIFEMTGLGLVEIKDPS
                     SIFLEKKEEISSGIAIGIINEGSRVLFVEIQALVTRTGMNIPRIFSEKIDSKKISRIL
                     AVLSKYLNLSFNNDDVYVNVSGGLRMDDIEIELAVLVALFSAKTNVIINQDLIFTGEI
                     SLSGKIKASSNIESKVIAAKKAGFQHVLGANLRENYYNGYEGIESVLGVVRRLVRDSK
                     REGHGDSRLKNR"
     misc_feature    complement(446417..447751)
                     /locus_tag="BT0422A"
                     /note="DNA repair protein RadA; Provisional; Region:
                     PRK11823"
                     /db_xref="CDD:236994"
     misc_feature    complement(446624..447724)
                     /locus_tag="BT0422A"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    complement(order(447446..447454,447464..447469))
                     /locus_tag="BT0422A"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(order(447239..447244,447380..447385,
                     447389..447391,447446..447454,447464..447466))
                     /locus_tag="BT0422A"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(447242..447256)
                     /locus_tag="BT0422A"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    complement(446492..>446650)
                     /locus_tag="BT0422A"
                     /note="Lon protease (S16) C-terminal proteolytic domain;
                     Region: Lon_C; pfam05362"
                     /db_xref="CDD:191262"
     gene            complement(448139..448813)
                     /locus_tag="BT0427"
                     /db_xref="GeneID:4642839"
     CDS             complement(448139..448813)
                     /locus_tag="BT0427"
                     /EC_number="2.1.1.-"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_945425.1"
                     /db_xref="GI:119953216"
                     /db_xref="GeneID:4642839"
                     /translation="MLYIVGTPIGNLGDITYRAIDILRLVDVVFAEDTRVAKRLLSHY
                     GIVKKLISCNAIIEHKRIGLLLEYLSNGKSVAFVSDAGTPCLSDPGGLLVDAAFKNGH
                     KVSPIPGVSSLNTVISVNPFKDKVVVFEGFLPNKGIKRIKRIEELYHRGDAFVLLESS
                     HRILKLLFEISLVNLDANVLVGREMTKLYEEYKIGKPLELKEYFEENNKNKGEFTVLV
                     SRKSKS"
     misc_feature    complement(448157..448810)
                     /locus_tag="BT0427"
                     /note="Ribosomal RNA small subunit methyltransferase I,
                     also known as rRNA (cytidine-2'-O-)-methyltransferase
                     RsmI; Region: RsmI; cd11648"
                     /db_xref="CDD:212507"
     misc_feature    complement(order(448169..448177,448259..448264,
                     448268..448270,448343..448345,448478..448483,
                     448553..448558,448565..448573,448787..448789))
                     /locus_tag="BT0427"
                     /note="putative SAM binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212507"
     misc_feature    complement(order(448421..448435,448460..448465,
                     448472..448477,448481..448492,448496..448498,
                     448529..448534,448538..448543,448550..448567,
                     448754..448756,448760..448771))
                     /locus_tag="BT0427"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:212507"
     gene            449083..449403
                     /locus_tag="BT0428"
                     /db_xref="GeneID:4642455"
     CDS             449083..449403
                     /locus_tag="BT0428"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945426.1"
                     /db_xref="GI:119953217"
                     /db_xref="GeneID:4642455"
                     /translation="MFKLIKKIFIIYFLCITLTGLTMVFIDSKFSERQTIQDGKSKII
                     KHVIDPNLIMLTSAIGGFLGIYSGIWFFDHGKDNFYLSWGSLIILIYNIGLIISVYSK
                     SKNK"
     gene            complement(449413..449811)
                     /locus_tag="BT0429"
                     /db_xref="GeneID:4642470"
     CDS             complement(449413..449811)
                     /locus_tag="BT0429"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945427.1"
                     /db_xref="GI:119953218"
                     /db_xref="GeneID:4642470"
                     /translation="MLEMISGLNPTLKLFKEHRILYSNMERGLKPLLEVDNFINKYIQ
                     NKEGLEIYDKVVGKAAAVIIYNIGLQNVQAGVISQPAKDFLESRGIRVTFKRLVEKIN
                     DKTENLIESLENPEEVYKYLIKRGIIVSNS"
     misc_feature    complement(449452..449808)
                     /locus_tag="BT0429"
                     /note="Domain of unknown function (DUF1893); Region:
                     TM1506; pfam08973"
                     /db_xref="CDD:255131"
     gene            449917..450495
                     /locus_tag="BT0430"
                     /db_xref="GeneID:4642860"
     CDS             449917..450495
                     /locus_tag="BT0430"
                     /EC_number="3.4.13.9"
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-Pro dipeptidase"
                     /protein_id="YP_945428.1"
                     /db_xref="GI:119953219"
                     /db_xref="GeneID:4642860"
                     /translation="MMLIPKENIYSKIEVKKSIFLSYIFHVEKKEEINKILKEYKLKF
                     KNATHVIYGFRIGNSNSFINGMNDDKEPRLTAGKPTLEAILNKNLTDTLIITVRYFGG
                     TLLGKQGLIKAYSKAAQEVINKSNLTEKKEMETLCLNLNYNQYNLLIRTKNKMEIKIT
                     DAKFLDKINTTIKFNIKDKKNIITFLQANSLL"
     misc_feature    449923..450489
                     /locus_tag="BT0430"
                     /note="uncharacterized protein, YigZ family; Region:
                     IMPACT_YIGZ; TIGR00257"
                     /db_xref="CDD:129359"
     misc_feature    449959..450285
                     /locus_tag="BT0430"
                     /note="Uncharacterized protein family UPF0029; Region:
                     UPF0029; pfam01205"
                     /db_xref="CDD:250442"
     gene            450687..451439
                     /locus_tag="BT0431"
                     /db_xref="GeneID:4642174"
     CDS             450687..451439
                     /locus_tag="BT0431"
                     /codon_start=1
                     /transl_table=11
                     /product="Soj protein"
                     /protein_id="YP_945429.1"
                     /db_xref="GI:119953220"
                     /db_xref="GeneID:4642174"
                     /translation="MKIISIINQKGGVGKTTSAINIAYSITLLNKKALLIDIDSQGNT
                     SSGFNILKKEDTNSSYELIYKKQKITPIKNFNLDIIPSSLKLALLEKELIHEIARENF
                     LKNALEQYKQDDYDFIILDCPPTLSILTINALVASKYLLIPIETEFFAFEGINQLLDT
                     ITAVKQINQELEITGIFINKYDIRNKSKEKYIDYLKKVFKEKFLNTKIRKNISISKSQ
                     EENIPVYMYNKESNAAKDFLELTKEIIEKIKG"
     misc_feature    450687..451436
                     /locus_tag="BT0431"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    450693..451223
                     /locus_tag="BT0431"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    450714..>451061
                     /locus_tag="BT0431"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    450714..450734
                     /locus_tag="BT0431"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(450732..450734,451047..451049)
                     /locus_tag="BT0431"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            451442..452146
                     /locus_tag="BT0432"
                     /db_xref="GeneID:4642575"
     CDS             451442..452146
                     /locus_tag="BT0432"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945430.1"
                     /db_xref="GI:119953221"
                     /db_xref="GeneID:4642575"
                     /translation="MSDNLDTLMALMGQKLKNNVKNEKTLAKQELIIIQNKSFKYEKL
                     DKEIADFLKMKQYEIFNIFNNTYTEIGRILKEAQEKLRGNNQYDGLFYKWFTSMGFKK
                     DKVYSLISRYELLVENSDKQLIINNLPLSLSYEISKKSCPTHLKMEVLNGKIKSLKEF
                     KSRYQKDEHNKKNLEINFNKTQLNREDIIKLIELLLQELENIKNIKLDKIENKKEFLI
                     ILKDIRQKINLIKKIT"
     gene            complement(452139..452951)
                     /locus_tag="BT0434"
                     /db_xref="GeneID:4642732"
     CDS             complement(452139..452951)
                     /locus_tag="BT0434"
                     /codon_start=1
                     /transl_table=11
                     /product="probable chromosome partitioning protein ParB"
                     /protein_id="YP_945431.1"
                     /db_xref="GI:119953222"
                     /db_xref="GeneID:4642732"
                     /translation="MYYYKEVFDKMSETFKMVDINLVDVDKSQPRKSINLAELEELSI
                     SIRENGILQPIVVFHDNGRYHLVIGERRFRAAKLAGMRQISIIEIETTRKNKDFMSLI
                     ENIQRENLTPVEEAYAYKNLMDKHSLTQRALSEKIGKNRSHVANLVRILDLEQEILNS
                     LHKKEISLGHAKVLLSLKDSQDRYGLYLLIIKKKLSVRETENYVKNFYKPINDKSEIS
                     RDPFLNSVKEFLISRIQTKISIKGSKEKGKIEISYFTSSDLKRIISIFESIK"
     misc_feature    complement(452379..452921)
                     /locus_tag="BT0434"
                     /note="ParB/RepB/Spo0J family partition protein; Region:
                     parB_part; TIGR00180"
                     /db_xref="CDD:232860"
     misc_feature    complement(452637..452906)
                     /locus_tag="BT0434"
                     /note="ParB-like nuclease domain; Region: ParB;
                     smart00470"
                     /db_xref="CDD:214678"
     gene            complement(453056..455503)
                     /locus_tag="BT0435"
                     /db_xref="GeneID:4642543"
     CDS             complement(453056..455503)
                     /locus_tag="BT0435"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="YP_945432.1"
                     /db_xref="GI:119953223"
                     /db_xref="GeneID:4642543"
                     /translation="MIGALMAIEEDKEQILNIKIEDEVKTSYLNYAMSVIVSRALPDV
                     RDGLKPVHRRILYSMHEMGLRADKAFKKAGRIVGDVLGKYHPHGDQSIYEALVRLAQD
                     FSLRYPIVSGQGNFGSIDGDPPAAMRYTEARMAKIAEELVKDIDRQTVDFRANYDDSL
                     LEPEVLPAAFPFLLVNGSSGIAVGMATNMAPHNLREICDAIVYMLNHDSVSVYDLIAI
                     VKGPDFPTYAEIIYNESLVKAYTTGKGSVVIRSRYHIEEKREDHIAIIITQIPYAVNK
                     SSLLMKIAFLIKEEKLEGISDIRDESDREGIRIVLEIKKGFDPHVVMNLLYEYTELRK
                     NFSINNLALVNGIPKQLNLKELISEFIDHRKEIVRRRVEFDLKKARDKAHILEGLNIS
                     LRHIDRVIEIIRFSRLVKDAKECIIKEFNLSEIQANSILDMKLQKLTSLEIEKLEEEF
                     KIVLDLIKDYEDILVSPERVVNIVREEIINLSLKFGDERRTKIIYDEEVLKTSMSDLM
                     QRENVIVILTKQGFIKRILQDEYKLQGIGGKGLGSFDLQDKDQVNIALCVNTHDFLLM
                     ISNEGKLYVINAYGIKDSSRTSKGQNIRELINLGETEEILAIKNCNELSLDNYLLITT
                     ANGKIARIETEGFKTVKSRGVIVIKLDDKDFVTSAEIVSKNDKIICISKKGNAFAFNS
                     NDIRLTHRGTQGVSGMKVREGDMLIKALSAKQGSHLLIVSENGYGKRLEISRVTELKR
                     GATGYTCYKKSDEKAGAVVDAITVAQDDEILLVSKTSKVLRTLVDKISEQGKDARGMQ
                     VLSLDEDKLMSVSKFIK"
     misc_feature    complement(453059..455473)
                     /locus_tag="BT0435"
                     /note="DNA gyrase subunit A; Validated; Region: PRK05560"
                     /db_xref="CDD:235502"
     misc_feature    complement(454061..455395)
                     /locus_tag="BT0435"
                     /note="DNA Topoisomerase, subtype IIA; domain A';
                     bacterial DNA topoisomerase IV (C subunit, ParC),
                     bacterial DNA gyrases (A subunit, GyrA),mammalian DNA
                     toposiomerases II. DNA topoisomerases are essential
                     enzymes that regulate the conformational changes...;
                     Region: TOP4c; cd00187"
                     /db_xref="CDD:238111"
     misc_feature    complement(order(455006..455008,455015..455086,
                     455090..455146,455150..455299,455312..455395))
                     /locus_tag="BT0435"
                     /note="CAP-like domain; other site"
                     /db_xref="CDD:238111"
     misc_feature    complement(455117..455119)
                     /locus_tag="BT0435"
                     /note="active site"
                     /db_xref="CDD:238111"
     misc_feature    complement(order(454172..454222,454262..454267,
                     454298..454309,454316..454324))
                     /locus_tag="BT0435"
                     /note="primary dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238111"
     misc_feature    complement(453827..453964)
                     /locus_tag="BT0435"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    complement(453668..453820)
                     /locus_tag="BT0435"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    complement(453515..453652)
                     /locus_tag="BT0435"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    complement(453365..453508)
                     /locus_tag="BT0435"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    complement(453212..453355)
                     /locus_tag="BT0435"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     misc_feature    complement(453068..453202)
                     /locus_tag="BT0435"
                     /note="DNA gyrase C-terminal domain, beta-propeller;
                     Region: DNA_gyraseA_C; pfam03989"
                     /db_xref="CDD:252298"
     gene            complement(455500..457419)
                     /locus_tag="BT0436"
                     /db_xref="GeneID:4642908"
     CDS             complement(455500..457419)
                     /locus_tag="BT0436"
                     /EC_number="5.99.1.3"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_945433.1"
                     /db_xref="GI:119953224"
                     /db_xref="GeneID:4642908"
                     /translation="MCGRFMSYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYE
                     VVDNSIDEALAGFCDKIEVVINSDNSVTVNDNGRGIPTDIHEEEGISALELVLTKLHS
                     GGKFNKGTYKVSGGLHGVGISVVNALSSFLEVVVSRDGNFFKQTYSRGIPTSEVEIVG
                     VSSNRGTKVTFLADSEIFETLEYDFETLSKRLRELAFLNDKIRISIEDKRLGKERFLE
                     FYFEGGIKAFVDFITNNSKNIQSEPYFIEGTYDDVIVSVGLKWTEGYSDNILSFVNNI
                     NTREGGTHVAGFKSGFLKAMSEAFKDSKISKKDVPNLTLDDFKEGLTAVISIKVPEPQ
                     FEGQTKGKLGNSYIKKIVETIVHNELLKVIGNNLLEVDIILNKAIRAARAREAARKAR
                     ESERKKSAFESLALPGKLADCASKNPVEREIYIVEGDSAGGSAKMGRDRFYQAILPLW
                     GKMLNVEKTREDKVITNDKLIPIIASLGAGVGKNFYIEKLRYHKIIIMADADVDGSHI
                     RTLLLTFFFRYMRELIDNGHVYIAMPPLYKIKYENSVHYFYDDSEKEVFLSSIETGKR
                     DKISLQRYKGLGEMNPTQLWETTMNPATRKMKLIEIDDAIQAENIFVTLMGDDVEPRR
                     EFIEQNALDVVNLDV"
     misc_feature    complement(455503..457404)
                     /locus_tag="BT0436"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    complement(<457033..457308)
                     /locus_tag="BT0436"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(457054..457065,457180..457185,
                     457189..457191,457195..457197,457201..457203,
                     457267..457269,457276..457278,457288..457290))
                     /locus_tag="BT0436"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(457276..457278)
                     /locus_tag="BT0436"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(457057..457059,457063..457065,
                     457183..457185,457189..457191))
                     /locus_tag="BT0436"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(456292..456753)
                     /locus_tag="BT0436"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    complement(456598..456600)
                     /locus_tag="BT0436"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(456406..456408,456412..456417,
                     456424..456426))
                     /locus_tag="BT0436"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(order(456400..456402,456406..456408))
                     /locus_tag="BT0436"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    complement(455818..456159)
                     /locus_tag="BT0436"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(455908..455910,455914..455916,
                     455920..455922,456127..456129,456136..456141))
                     /locus_tag="BT0436"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    complement(order(455920..455922,456139..456141))
                     /locus_tag="BT0436"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    complement(455536..455727)
                     /locus_tag="BT0436"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            457651..459105
                     /locus_tag="BT0437"
                     /db_xref="GeneID:4642907"
     CDS             457651..459105
                     /locus_tag="BT0437"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_945434.1"
                     /db_xref="GI:119953225"
                     /db_xref="GeneID:4642907"
                     /translation="MQEGKNIWSLILAAIRKELSEEEFYIWFENLYFIDATDESIKIS
                     APNSFHKNQVEKRFSKRIKEILTEKGHNTINVEFINPPKEPKTHSMELKNTSLKDISI
                     QQDSPEKRTILNTHTKNIIEHTKHYVIKEDIHTKYRNPFLKKKYTFENFIIGPNNKLA
                     YNASLSIAKNPGKKYNPCLIYGGVGLGKTHLLQSIGNKTEELHKEFKILYVTAENFLN
                     EFVESIKTNETKRFKKKYRHLDMLLIDDIHDLQKKEGIQEELFHTFNALYEDNKQMVF
                     TCDRQPSELINFTDRLKSRFTRGLNVDISKPNFELRVAIIEKKAEEDGIKVPKNILNL
                     VAKKVTTNIRDLEAAVTKLKAHIDLEDIEIDTSIVDKIIKEIIAYENDKTNTNNTINI
                     ESIKKVILRELKLTNKDIEGNSKKPEITKARHIYAYLLRNFTELSTIEIGKIIGGKTH
                     STVLYSINKIDKERNNDLEINNLIIELMNKINKN"
     misc_feature    457663..459099
                     /locus_tag="BT0437"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    457663..457854
                     /locus_tag="BT0437"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    458119..458541
                     /locus_tag="BT0437"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    458194..458217
                     /locus_tag="BT0437"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(458197..458220,458383..458385,458482..458484)
                     /locus_tag="BT0437"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    458371..458388
                     /locus_tag="BT0437"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    458521..458523
                     /locus_tag="BT0437"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    458824..459093
                     /locus_tag="BT0437"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(458893..458895,458917..458922,458941..458943,
                     458959..458967,458992..459006,459013..459015,
                     459022..459027)
                     /locus_tag="BT0437"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            459346..460506
                     /locus_tag="BT0438"
                     /db_xref="GeneID:4642906"
     CDS             459346..460506
                     /locus_tag="BT0438"
                     /EC_number="2.7.7.7"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta chain"
                     /protein_id="YP_945435.1"
                     /db_xref="GI:119953226"
                     /db_xref="GeneID:4642906"
                     /translation="MNEKFILCDTEQISNEIDKAKSIILNRNINDIWSAILLEVKNSN
                     LKIKATDRNIFFESTIPIVSAENFKVLINASNFSDAVKALNLYNELKIKFIEDESKLS
                     IIGESENKNDNFINDHLSEPTFSSEEIEIYNYDINEEIYNLTVELTQREFKKIINKVS
                     FSASHDESKNVLNGIYFTKDKNSALTFVSTNSHRLSVYKTDLIFEEDINFIVPVKMVN
                     LLRQMMVGEGIIKLKISDKKFYVEFNNYKIVCSLINGNYPDYESIIPNEQQNKALIDV
                     SILKDRLSRVSSYTDKRSKKVILNFAGNQLRLMAEDPITGRKGEFFVQSPNYDYEGSE
                     EVVAINSAYFTEAMGVFDTSKLEIKFSGGGILKLSDPANFGFIHLIMPMVLN"
     misc_feature    459355..460500
                     /locus_tag="BT0438"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    459361..460494
                     /locus_tag="BT0438"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(459424..459426,459568..459570,459589..459591,
                     459988..459990)
                     /locus_tag="BT0438"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(459571..459573,459580..459582,459691..459693,
                     459697..459699,460207..460209,460300..460305)
                     /locus_tag="BT0438"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(459913..459915,459919..459930,460363..460365,
                     460486..460494)
                     /locus_tag="BT0438"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(459913..459915,459919..459924,460132..460134,
                     460237..460239,460276..460281,460372..460374,
                     460486..460494)
                     /locus_tag="BT0438"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            460519..461595
                     /locus_tag="BT0438A"
                     /db_xref="GeneID:4642905"
     CDS             460519..461595
                     /locus_tag="BT0438A"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_945436.1"
                     /db_xref="GI:119953227"
                     /db_xref="GeneID:4642905"
                     /translation="MAKMIKKVEFFNFKNIENRVINFDFNNIYFCGENGSGKTNILDA
                     IYCLAFASSFLVRTDRELITYGKTEFYLKCFYNTEGKAGEIGLSLRNGKKEIKVNNSI
                     VKDRKNLILNIPSVIFSNYDTDFIIGAPAKKRWFFDQAISLVSLSYLDSLRKYRKILQ
                     QRNLILRQGNKDLLKVYNETFVDFAFEITKMRENFIKHFYEFFKYYYSFIFDVSYSLE
                     IKYLPSVKCSKRDEFLQTLLLKEQDELYSESTLIGPHRDLYEILSGERVFTHHSSTGQ
                     IRALALIYRLIQVIMFNKQFGIAPILLFDDVFLELDSMRRKRIFDILPKDSQCFFTFL
                     DDCYDIKQDSKFIVYRIKNGRFQL"
     misc_feature    460531..461583
                     /locus_tag="BT0438A"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    460531..461583
                     /locus_tag="BT0438A"
                     /note="Recombinational DNA repair ATPase (RecF pathway)
                     [DNA replication, recombination, and repair]; Region:
                     RecF; COG1195"
                     /db_xref="CDD:224116"
     misc_feature    460612..460635
                     /locus_tag="BT0438A"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(460621..460626,460630..460638,460876..460878,
                     461431..461436,461521..461523)
                     /locus_tag="BT0438A"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    460867..460878
                     /locus_tag="BT0438A"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    461332..461361
                     /locus_tag="BT0438A"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    461419..461436
                     /locus_tag="BT0438A"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    461443..461454
                     /locus_tag="BT0438A"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(461509..461523,461524..461526)
                     /locus_tag="BT0438A"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            461576..461875
                     /locus_tag="BT0439"
                     /db_xref="GeneID:4642904"
     CDS             461576..461875
                     /locus_tag="BT0439"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945437.1"
                     /db_xref="GI:119953228"
                     /db_xref="GeneID:4642904"
                     /translation="MEDFSFKKAADVLKEYLNTDICANEKLNASFILSKNWQIIFKDL
                     ADRVKLLNLKDNKILFVAVKNSSVLYTVSLNRSKIIKLIKESTGLEILDIKVLIR"
     misc_feature    461597..461863
                     /locus_tag="BT0439"
                     /note="Protein of unknown function (DUF721); Region:
                     DUF721; cl02324"
                     /db_xref="CDD:261245"
     gene            461966..462121
                     /gene="rpmH"
                     /locus_tag="BT0440"
                     /db_xref="GeneID:4642903"
     CDS             461966..462121
                     /gene="rpmH"
                     /locus_tag="BT0440"
                     /note="in Escherichia coli transcription of this gene is
                     enhanced by polyamines"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="YP_945438.1"
                     /db_xref="GI:119953229"
                     /db_xref="GeneID:4642903"
                     /translation="MKRTYQPSRVKRNRKFGFRARMKTKGGRLILARRRAKGRSKLTV
                     SDEKKKY"
     misc_feature    461966..462097
                     /gene="rpmH"
                     /locus_tag="BT0440"
                     /note="Ribosomal protein L34; Region: Ribosomal_L34;
                     pfam00468"
                     /db_xref="CDD:249883"
     gene            462102..462446
                     /locus_tag="BT0441"
                     /db_xref="GeneID:4642902"
     CDS             462102..462446
                     /locus_tag="BT0441"
                     /EC_number="3.1.26.5"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P protein component"
                     /protein_id="YP_945439.1"
                     /db_xref="GI:119953230"
                     /db_xref="GeneID:4642902"
                     /translation="MKKRNISIKSKVEIQELFKKGRFIRIEGINIFYEFTSLSISRMI
                     VTFPKVFKGAVKRNRVRRIFKECFRKQLALLKNRYVDFIFVVYPQRVDVNYCEVDTML
                     KNIIVHVMKRKV"
     misc_feature    462111..>462359
                     /locus_tag="BT0441"
                     /note="Ribonuclease P; Region: Ribonuclease_P; pfam00825"
                     /db_xref="CDD:250159"
     gene            462443..464080
                     /locus_tag="BT0442"
                     /db_xref="GeneID:4642901"
     CDS             462443..464080
                     /locus_tag="BT0442"
                     /note="functions to insert inner membrane proteins into
                     the IM in Escherichia coli; interacts with transmembrane
                     segments; functions in both Sec-dependent and -independent
                     membrane insertion; similar to Oxa1p in mitochondria"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein translocase
                     component YidC"
                     /protein_id="YP_945440.1"
                     /db_xref="GI:119953231"
                     /db_xref="GeneID:4642901"
                     /translation="MSQSKRILRAIYLSLFFIGIFMLVDDVFFSRKSPSVMEREIGFN
                     LDRDFDVEHHSIDENDTLSLSANSKEIGVETGIYYATFSTFGGNLVSLKLKDHLNLER
                     NPTEMVKVNMDREGLFYITFDNLTKSLFSYDKINDYTHEFKTKFEYNDKYYEYIKRYT
                     FSSKDEYLIKLEIFLNNVDANDNFDIDFYKFVLSSDIENLSERGKLQYNNYLSQSIYY
                     DTKLRYGKDGLSVIKPKWVGSSTKYFEVLVSKENMNVEFKQENKVLKTFVLNKIGDTS
                     FSDTFYIYAGPRDNGYLDIFNENNLNSFGLSNVEFGMSVEKSLLYFIQVPMQLIMQIF
                     YDVIPNWGLSIIFLTIVVRILIFPLTFKSFRATAELSKLQPKMKEIQVKFKNDPKRLN
                     EEMGKLYREEGVNPLGGCLPILLQLPVFFALYGLVNNFFLLRGASFIPGWIDDLSIGD
                     SIYYFGYKVFVWTDIRILPFIMMITQLLSTIISSNVSFKNLGSQQKFLYFGMPIMFFF
                     ILYDMPSGLLIYWITTNIFTILQQYYIKMNVSERRNR"
     misc_feature    462446..464077
                     /locus_tag="BT0442"
                     /note="membrane protein insertase; Provisional; Region:
                     PRK01318"
                     /db_xref="CDD:234942"
     misc_feature    462650..463423
                     /locus_tag="BT0442"
                     /note="YidC periplasmic domain; Region: YidC_periplas;
                     pfam14849"
                     /db_xref="CDD:258986"
     misc_feature    463460..464050
                     /locus_tag="BT0442"
                     /note="membrane protein insertase, YidC/Oxa1 family,
                     C-terminal domain; Region: yidC_oxa1_cterm; TIGR03592"
                     /db_xref="CDD:234272"
     gene            464077..464799
                     /locus_tag="BT0443"
                     /db_xref="GeneID:4642900"
     CDS             464077..464799
                     /locus_tag="BT0443"
                     /codon_start=1
                     /transl_table=11
                     /product="Jag protein"
                     /protein_id="YP_945441.1"
                     /db_xref="GI:119953232"
                     /db_xref="GeneID:4642900"
                     /translation="MSYEFYGKTEQEAIKKAMRDLDLREGEFDVEILDKEKVGFLFKK
                     EMIKIKVSPHVKEDTLKSEAQINEGICDKVLDFIKEMINKMGYCVDLKIESREGEYIK
                     ISIDTDSPNILIGREGRNLDALQLLANVYMSRLIGDNGIFNRIVLDIEDYRERFKSRF
                     INLAINSLHKVKRSRRSILLPTMNPFERRIIHTTLNRYSDIKTESEGDGNLKRVRISY
                     VRSSKYNNNFRSYQKRDSNVRK"
     misc_feature    464080..464733
                     /locus_tag="BT0443"
                     /note="Predicted RNA-binding protein [General function
                     prediction only]; Region: Jag; COG1847"
                     /db_xref="CDD:224760"
     misc_feature    464086..464235
                     /locus_tag="BT0443"
                     /note="Jag N-terminus; Region: Jag_N; pfam14804"
                     /db_xref="CDD:258941"
     misc_feature    464302..464541
                     /locus_tag="BT0443"
                     /note="jag_K homology RNA-binding domain. The KH domain is
                     found in proteins homologous to the Bacillus subtilis
                     protein Jag, which is associated with SpoIIIJ and is
                     necessary for the third stage of sporulation.  The KH
                     motif is a beta-alpha-alpha-beta-beta...; Region: jag_KH;
                     cd02414"
                     /db_xref="CDD:239097"
     misc_feature    464419..464430
                     /locus_tag="BT0443"
                     /note="G-X-X-G motif; other site"
                     /db_xref="CDD:239097"
     misc_feature    464533..464733
                     /locus_tag="BT0443"
                     /note="R3H domain found in proteins homologous to Bacillus
                     subtilus Jag, which is associated with SpoIIIJ. SpoIIIJ is
                     necessary for the third stage of sporulation. The name of
                     the R3H domain comes from the characteristic spacing of
                     the most conserved arginine...; Region: R3H_jag; cd02644"
                     /db_xref="CDD:100073"
     misc_feature    order(464638..464640,464650..464652)
                     /locus_tag="BT0443"
                     /note="RxxxH motif; other site"
                     /db_xref="CDD:100073"
     gene            464950..466008
                     /locus_tag="BT0444"
                     /db_xref="GeneID:4642899"
     CDS             464950..466008
                     /locus_tag="BT0444"
                     /EC_number="5.1.3.6"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucuronate 4-epimerase"
                     /protein_id="YP_945442.1"
                     /db_xref="GI:119953233"
                     /db_xref="GeneID:4642899"
                     /translation="MRVFLTGIAGFIGFHVAKRLADNGHEVLGVDVLNDYYEPNLKYE
                     RLEVLGFDRKNIGSKKVIQSNKYNNLSFIYLDILDKDKVLSLFSDYKFTHVCHLAAQA
                     GIRDSIENPDSYISVNIVGFFNVLDACRIHKSHIEHFVYASTSAVYGINKKMPSDEDS
                     ITDHPLNLYAASKKSNEVIAHAYSSSFNIPTTGLRFFTVYGPYGRPDMALYLFADGII
                     KQTPINVFNNGDMARDFTYVDDVADGVYSVLKKPAESDVNFDVQNPNSSSSLAPYKIY
                     NIGTGHATELLEFINELETNLGNKACKNFLPMQKADVVKSCCNISKLKTDFAYESLIS
                     IKEGIKKFANWYKSKIVE"
     misc_feature    464950..465996
                     /locus_tag="BT0444"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    464950..465993
                     /locus_tag="BT0444"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(464968..464970,464974..464979,464983..464985,
                     465040..465048,465241..465249,465373..465381,
                     465454..465456,465466..465468,465535..465546)
                     /locus_tag="BT0444"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(465301..465303,465379..465381,465454..465456,
                     465466..465468)
                     /locus_tag="BT0444"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            466129..467208
                     /locus_tag="BT0445"
                     /db_xref="GeneID:4642898"
     CDS             466129..467208
                     /locus_tag="BT0445"
                     /EC_number="4.1.2.13"
                     /note="catalyzes the formation of glycerone phosphate and
                     glyceraldehyde 3-phosphate from fructose 1,6,
                     bisphosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="YP_945443.1"
                     /db_xref="GI:119953234"
                     /db_xref="GeneID:4642898"
                     /translation="MGVLDKIKPGVVYGKELHTLYEICKSEGFAIPAINCVGTNSINA
                     VLEAAKEINSPIMIQFSNSGSAFVCGKGLKVEKPQGTSILGAISGAMHVHLLAEHYGV
                     PVVLHTDHCAKKLIPWVEGLLEYGEKYYQEHKRPLFSSHMLDLSEEPIKENIEISKKF
                     LERMSKIEMFLEIELGITGGEEDGVDNSDREQHELFSTPEDIYYGYSELMKVSPNFQI
                     AAAFGNVHGVYKPGNVQLTPKVLRDGQNYVISKTNSSDPKPVSYVFHGGSGSTIEEIH
                     EALSYGVVKMNIDTDTQWAAWEGILNYYKNNENRLQGQLGDGSNADVPNKKFYDPRVW
                     LRESEISIKERVKLACKSLNNINRN"
     misc_feature    466168..467205
                     /locus_tag="BT0445"
                     /note="Class II Type A, Fructose-1,6-bisphosphate (FBP)
                     aldolases. The enzyme catalyses the zinc-dependent,
                     reversible aldol condensation of dihydroxyacetone
                     phosphate with glyceraldehyde-3-phosphate to form
                     fructose-1,6-bisphosphate. FBP aldolase is...; Region:
                     FBP_aldolase_IIA; cd00946"
                     /db_xref="CDD:238476"
     misc_feature    order(466231..466233,466453..466458,466558..466560,
                     466648..466650,466654..466656,466663..466674,
                     466801..466809,466813..466815,466921..466926,
                     466930..466932,466987..466989,466993..466998)
                     /locus_tag="BT0445"
                     /note="active site"
                     /db_xref="CDD:238476"
     misc_feature    order(466240..466248,466255..466257,466318..466320,
                     466327..466335,466390..466392,466402..466404,
                     466411..466416,466672..466674,466996..467001,
                     467005..467010,467017..467019,467029..467031,
                     467038..467040)
                     /locus_tag="BT0445"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238476"
     misc_feature    order(466456..466458,466558..466560,466648..466650,
                     466669..466671,466804..466806,466921..466923)
                     /locus_tag="BT0445"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:238476"
     misc_feature    order(466801..466803,466807..466809,466813..466815,
                     466924..466926,466930..466932)
                     /locus_tag="BT0445"
                     /note="Na+ binding site [ion binding]; other site"
                     /db_xref="CDD:238476"
     gene            467477..467887
                     /locus_tag="BT0445A"
                     /db_xref="GeneID:4642789"
     CDS             467477..467887
                     /locus_tag="BT0445A"
                     /codon_start=1
                     /transl_table=11
                     /product="small heat shock protein"
                     /protein_id="YP_945444.1"
                     /db_xref="GI:119953235"
                     /db_xref="GeneID:4642789"
                     /translation="MLLTNYKKNFLDFLNDDFDFMSPKGVHDIPVNIKDEGKSFILEA
                     YLPGIKKDDISISIKNDYLTISYESKDESEEKHDKYLRVERRDISFARSFRLSGNIDQ
                     DKIKSELKNGVLHIKLPKKAEVIEKIQEKKIAIE"
     misc_feature    467501..467884
                     /locus_tag="BT0445A"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    467570..467836
                     /locus_tag="BT0445A"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    order(467570..467584,467603..467605,467609..467611,
                     467615..467620,467750..467752,467810..467815)
                     /locus_tag="BT0445A"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            complement(467915..469672)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /db_xref="GeneID:4642423"
     CDS             complement(467915..469672)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /EC_number="6.1.1.12"
                     /note="catalyzes a two-step reaction, first charging an
                     aspartate molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; contains discriminating
                     and non-discriminating subtypes"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="YP_945445.1"
                     /db_xref="GI:119953236"
                     /db_xref="GeneID:4642423"
                     /translation="MFKTIKCNQINDKLINQKIEINAWVKKIRHHGKVTFINLRDRYD
                     EAQVLVNDEKLLKITSQIKMEYCIKVQGKLELRPSNLVNKEMRTGAFEILAENINIIS
                     RCNELPFMIEDNNNANENAKLEYRYLDLRREEQKQKIILRSKVTHTIRNYLTKKDFLE
                     LETPTFVKSTPEGARDFLVPSRIHKGHFYALPQSPQIYKQLTMIAGLDKYFQIARCYR
                     DEDSRGDRQPEFTQLDIEMSFIKKENIFKLMENLIFTIFKNTLNISLPKKFKRMTYKH
                     AMNTYGSDKPDTRYELLIQDMGKYFKQSSFNVFKDILQNKGTIKALIIKNQAHNFSRS
                     KINNLEEHAKIYKTSGLYFAKIENNEFVGGIAKFLNKIKQTLFQTYSLKNNDIIFFIA
                     DSWETACKAMGQIRIKIANELNLTNKNTFEFLWIYDFPLFEYDEDTKNYKAAHHMFSL
                     PQQKYIDTLESNPSKVLGEVYDLVLNGMELGSGSIRVHTRELQQRIFNIVGFKDTIAE
                     ERFGFFLKALEYGAPIHGGIAIGIDRLLMIMTHSSSIKDVILFPKNSFAASPLDKAPS
                     KVPNEQLRELNLTIEDYKN"
     misc_feature    complement(467930..469672)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="aspartyl-tRNA synthetase; Validated; Region: aspS;
                     PRK00476"
                     /db_xref="CDD:234775"
     misc_feature    complement(469271..469666)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="EcAspRS_like_N: N-terminal, anticodon recognition
                     domain of the type found in Escherichia coli aspartyl-tRNA
                     synthetase (AspRS), the human mitochondrial (mt) AspRS-2,
                     the discriminating (D) Thermus thermophilus AspRS-1, and
                     the nondiscriminating (ND)...; Region: EcAspRS_like_N;
                     cd04317"
                     /db_xref="CDD:239812"
     misc_feature    complement(order(469358..469363,469367..469369,
                     469547..469549,469601..469603,469655..469657,
                     469664..469666))
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239812"
     misc_feature    complement(order(469349..469351,469397..469399,
                     469424..469426,469442..469444,469484..469486,
                     469532..469534,469565..469567,469580..469588,
                     469592..469594))
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:239812"
     misc_feature    complement(468008..469258)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="Asp tRNA synthetase (aspRS) class II core domain.
                     Class II assignment is based upon its structure and the
                     presence of three characteristic sequence motifs. AspRS is
                     a homodimer, which attaches a specific amino acid to the
                     3' OH group of ribose of...; Region: AspRS_core; cd00777"
                     /db_xref="CDD:238400"
     misc_feature    complement(order(468014..468016,468020..468025,
                     468107..468118,468122..468127,468134..468136,
                     468941..468943,468956..468958,468986..468988,
                     469016..469018,469028..469030,469046..469051,
                     469058..469063,469106..469117,469127..469141,
                     469148..469150,469169..469189,469193..469204,
                     469211..469213,469220..469225,469232..469234,
                     469241..469249))
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238400"
     misc_feature    complement(469169..469183)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="motif 1; other site"
                     /db_xref="CDD:238400"
     misc_feature    complement(order(468071..468073,468080..468082,
                     468086..468091,468215..468217,468227..468229,
                     468236..468238,468335..468340,468977..468979,
                     468983..468985,468992..469000,469013..469015,
                     469019..469021,469076..469078,469085..469087,
                     469091..469093,469151..469159))
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="active site"
                     /db_xref="CDD:238400"
     misc_feature    complement(469013..469024)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="motif 2; other site"
                     /db_xref="CDD:238400"
     misc_feature    complement(468467..468748)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="GAD domain; Region: GAD; pfam02938"
                     /db_xref="CDD:251630"
     misc_feature    complement(468071..468082)
                     /gene="aspS"
                     /locus_tag="BT0446"
                     /note="motif 3; other site"
                     /db_xref="CDD:238400"
     gene            complement(469676..471796)
                     /locus_tag="BT0447"
                     /db_xref="GeneID:4642422"
     CDS             complement(469676..471796)
                     /locus_tag="BT0447"
                     /codon_start=1
                     /transl_table=11
                     /product="Na(+)/H(+) antiporter"
                     /protein_id="YP_945446.1"
                     /db_xref="GI:119953237"
                     /db_xref="GeneID:4642422"
                     /translation="MNKKILYKILFIINPILSFGMADYMKDTSHNIDAKISSFIMSLA
                     IIVISASLLGNLVSKFGIPKVIGQITAGILLSPTFLGKIKIPLLFPLGIISVSDHYLI
                     NEEIFAISTIASIILLFMAGLETDLKLFLKFLPRGGLIGITEVIGTFTSFALISTILF
                     DVQLISPTALFIGIIATPSSAGIAASILSAKKKMSTSEGVTIISTSIIDDVLSMIMLT
                     SVITISRSLSDLDIAISITATIKNILIWFCLTFILILLSEPISKLLKSFNSVTLATVI
                     TITFTFIVASFFQNLGMSFVIGAYIFGLAMSKTDIVCVIQDKLTIFERFFIPIFFTSI
                     GLMADINVILSKEVLILGTLLSLIAIATKLIYCFIPSCFLGFNKLGALRIAFGMVPRG
                     EISLIIANLALSSEFISQKIFGITIIIVFLPTIIVTPIINILFQINKNGLKKEIKTEQ
                     NTQITVSFKYDNLTKILVWELKNELRKEGFFTQQIKNDFSQYINARYNDISLSIKREG
                     SKITFECPNKHLIIIQDLFRETILNLERITEEVKTVSVKAQKLNYSINYDKIRSNIAL
                     NKRIKKENIILELKATNKTEVLRELLGVIKIEIDKEIILQDLMEREKLITTALKEGFA
                     IPHLKTNLITKMHIAIGISHDGIDFNATDKNLSHIFILILYPAKEYVNYPRILASIVG
                     KVDSNKKEMLKAKTDKEIYNIIVG"
     misc_feature    complement(470459..471691)
                     /locus_tag="BT0447"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     misc_feature    complement(470039..470404)
                     /locus_tag="BT0447"
                     /note="Sexual stage antigen s48/45 domain; Region: s48_45;
                     cl15295"
                     /db_xref="CDD:265666"
     misc_feature    complement(469685..470089)
                     /locus_tag="BT0447"
                     /note="PTS_IIA, PTS system, fructose/mannitol specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This...; Region: PTS_IIA_fru;
                     cl00163"
                     /db_xref="CDD:260228"
     misc_feature    complement(order(469916..469918,469964..469966))
                     /locus_tag="BT0447"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    complement(469916..469918)
                     /locus_tag="BT0447"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            complement(471793..472074)
                     /locus_tag="BT0448"
                     /db_xref="GeneID:4642421"
     CDS             complement(471793..472074)
                     /locus_tag="BT0448"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein HPr"
                     /protein_id="YP_945447.1"
                     /db_xref="GI:119953238"
                     /db_xref="GeneID:4642421"
                     /translation="MQAITIEINNKEGLHSRPSSMIAELASKYPYCNVKLVTEDGREA
                     DAKSTVEIMILGVIYKEKIKIIANGKKETEIIDILSELLKSNFKKEIQK"
     misc_feature    complement(471826..472062)
                     /locus_tag="BT0448"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    complement(472051..472062)
                     /locus_tag="BT0448"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    complement(order(471913..471918,471925..471936,
                     471994..471996,472003..472005,472015..472020,
                     472024..472029,472033..472035))
                     /locus_tag="BT0448"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    complement(472030..472032)
                     /locus_tag="BT0448"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    complement(471931..471933)
                     /locus_tag="BT0448"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            complement(472089..472385)
                     /locus_tag="BT0449"
                     /db_xref="GeneID:4642419"
     CDS             complement(472089..472385)
                     /locus_tag="BT0449"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated factor Y"
                     /protein_id="YP_945448.1"
                     /db_xref="GI:119953239"
                     /db_xref="GeneID:4642419"
                     /translation="MEPKIQAINYHLSDHTKDFIIKKLEKLGTHIKQNSESLKITIKK
                     ENDIFDIDAHLHFNWGKIIHITEHGKELYALIERLVERLQNTANKEKNKKDTVK"
     misc_feature    complement(472104..472385)
                     /locus_tag="BT0449"
                     /note="RaiA ('ribosome-associated inhibitor A', also known
                     as Protein Y (PY), YfiA, and SpotY,  is a stress-response
                     protein that binds the ribosomal subunit interface and
                     arrests translation by interfering with aminoacyl-tRNA
                     binding to the ribosomal...; Region: RaiA; cl00250"
                     /db_xref="CDD:260300"
     misc_feature    complement(order(472107..472109,472119..472124,
                     472164..472166,472173..472175,472179..472181,
                     472188..472190,472194..472196,472203..472208,
                     472212..472217,472224..472226,472251..472253,
                     472263..472265,472275..472277,472281..472283,
                     472299..472301,472308..472310,472362..472364,
                     472368..472370,472374..472376))
                     /locus_tag="BT0449"
                     /note="30S subunit binding site; other site"
                     /db_xref="CDD:238308"
     gene            complement(473576..474163)
                     /locus_tag="BT0451"
                     /db_xref="GeneID:4642418"
     CDS             complement(473576..474163)
                     /locus_tag="BT0451"
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transport protein"
                     /protein_id="YP_945449.1"
                     /db_xref="GI:119953240"
                     /db_xref="GeneID:4642418"
                     /translation="MFSNIYNTKNILSKKGINLILINLFITFFKIGILNFGGGNGIAT
                     IINKEIIDNKGWITKEEFINIITISRITPGPVATNIATYVGTKVAGITGAIIATIALI
                     TAPILIITFITLTLHKINFLNYYLKSLRPVIIALWIMTIIILFESIFLKISYNGTEFL
                     KSFAIAGLNLIILLFYKNITPAILIISSGILYIFM"
     misc_feature    complement(473582..474106)
                     /locus_tag="BT0451"
                     /note="Chromate transporter; Region: Chromate_transp;
                     pfam02417"
                     /db_xref="CDD:251281"
     gene            complement(474112..474690)
                     /locus_tag="BT0452"
                     /db_xref="GeneID:4642912"
     CDS             complement(474112..474690)
                     /locus_tag="BT0452"
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transport protein"
                     /protein_id="YP_945450.1"
                     /db_xref="GI:119953241"
                     /db_xref="GeneID:4642912"
                     /translation="MDKTKKTPYELLTLFYLVLKITTITIGGGLLIISELRKIIVNKK
                     KLISDKEFNEILATSNVVPGVTAINFAFLIGKKLKGFKGAIMLTIAGILPSILVITMI
                     ALYVNLNSNNIYAQKFLEGAKISSTIIMSIIILEFSKKMLKQSITKWITCLLITYTLY
                     KFNIDISYILITVLFICSLTYTIQKIFFQKKV"
     misc_feature    complement(474160..474663)
                     /locus_tag="BT0452"
                     /note="Chromate transporter; Region: Chromate_transp;
                     pfam02417"
                     /db_xref="CDD:251281"
     gene            474864..475730
                     /locus_tag="BT0453"
                     /db_xref="GeneID:4642915"
     CDS             474864..475730
                     /locus_tag="BT0453"
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel"
                     /protein_id="YP_945451.1"
                     /db_xref="GI:119953242"
                     /db_xref="GeneID:4642915"
                     /translation="MDKQSKTFSVFREIFVFQDYVNEIFEMVIVYGLKVLVALVVWCV
                     SRFFVKRVGRLFFSAFEKSKLETKLDSTILNFFKSFFKVMIDMVLILMILPYLGVSTT
                     SIFAIFGSLGLAVGLAAQGILSDFVSGFVVLNSSFFKIGDYISCDDVEGEVNDIHIFF
                     TTLQTVDGKIIKIPNSKFTDTSVTNFSTNPERRIAFDFQVPYDTDIGSLKSRIENLAF
                     SFNKEQYGINKPSVVVKEYTPYYIVMQVRSFVKTEFFWDFQYFIAENIKGILDDMGIK
                     FPIHNVDFSKLR"
     misc_feature    474879..475715
                     /locus_tag="BT0453"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    475104..475694
                     /locus_tag="BT0453"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            complement(475727..476878)
                     /locus_tag="BT0454"
                     /db_xref="GeneID:4642207"
     CDS             complement(475727..476878)
                     /locus_tag="BT0454"
                     /EC_number="2.4.1.157"
                     /codon_start=1
                     /transl_table=11
                     /product="1,2-diacylglycerol 3-glucosyltransferase"
                     /protein_id="YP_945452.1"
                     /db_xref="GI:119953243"
                     /db_xref="GeneID:4642207"
                     /translation="MKIAIFTDTYLPDKNGVATSIKQIKEGFERKGHSVYIFCPQSQK
                     TDLQEDHIYRCFSIKLNQTVDAKIAFPNKTRIKKIIQEYQPEIIHTHSEFTMGKIGKK
                     LALQHNIPIVHTNHTMWNYYLHYLGIFKYLTNPDKMMKKFYDQIHHFIYPSIKSHNKY
                     FHLATNADYKIIPNGVDRKIFIKDLSQEKRQEILTKHGISKNDKIIIFVGRINEEKNI
                     CLLMKHLKKLLIENKNCKLILIGKGKEETKIRRFRKQYELEKQIILIGTIPWEEMYYY
                     YKISDVFTSLSRSEVYPMTTIEALTAGIPAVLINDIIYKDVIQQGKNGFLIDDYENLY
                     KYIKEIIENEEKLQTLKKNTEETSMMFSSSFFVEKIEQYYSEIIKNKKY"
     misc_feature    complement(475736..476878)
                     /locus_tag="BT0454"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    complement(475748..476875)
                     /locus_tag="BT0454"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. UDP-glucose-diacylglycerol
                     glucosyltransferase (UGDG; also known as
                     1,2-diacylglycerol 3-glucosyltransferase) catalyzes the
                     transfer of glucose from UDP-glucose to 1; Region:
                     GT1_UGDG_like; cd03817"
                     /db_xref="CDD:99987"
     misc_feature    complement(order(475994..475996,476063..476065,
                     476246..476254,476831..476833))
                     /locus_tag="BT0454"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99987"
     gene            476938..477927
                     /locus_tag="BT0455"
                     /db_xref="GeneID:4642071"
     CDS             476938..477927
                     /locus_tag="BT0455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical cytosolic protein"
                     /protein_id="YP_945453.1"
                     /db_xref="GI:119953244"
                     /db_xref="GeneID:4642071"
                     /translation="MKEIYLLLGKEQGLKEAYLNNIFSKLNADNICVTKLFMSELSSI
                     ELSERLLTNSFFSKEEVFIIYESENLKNKKDLELVYSTILKSLNKIIIFVSNENSISF
                     DPKGSLNLVKKTFYELSDTDKFLFVKKSFFKLGIKITDKAIHLMLFMLDADTKILQFY
                     VNSFALMIKNKTIDEHDVNSWLSFMRPENPFSLFESILKKDMEYALVKIKSILEQGED
                     LVNIVMSLGWQFKKFLKVKIDCESLHDIPSVFKKHKIFVSLEKVYKIGLKNYSIFDIK
                     FILKLLHKFDLYARIYGKNMHLNLSYFMILVLLSQDDTILDNFSSKFKFTNVL"
     misc_feature    476938..477798
                     /locus_tag="BT0455"
                     /note="DNA polymerase III, delta subunit [DNA replication,
                     recombination, and repair]; Region: HolA; COG1466"
                     /db_xref="CDD:224383"
     gene            complement(478027..479835)
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /db_xref="GeneID:4642081"
     CDS             complement(478027..479835)
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrC both incises the 5'
                     and 3' sides of the lesion. The N-terminal half is
                     responsible for the 3' incision and the C-terminal half is
                     responsible for the 5' incision"
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="YP_945454.1"
                     /db_xref="GI:119953245"
                     /db_xref="GeneID:4642081"
                     /translation="MREHLNCLHKKVQEFPTTSGCYKMYSQDNKILYIGKAKNLRSRL
                     KNYFLEKISLKTKILMRNVVNIEVITTNSEYEALLLECNLIKEHKPDYNIKLKDDKGY
                     PMIRITCEKYPKVFKTRKIINDGSEYFGPYVNAKHLDLVLNLINKTFKTRKCKKKSKN
                     PCLYFHMGQCLGVCYRNDLEEQYKEEVNKIRHILNGNISKLLDEIEIKMKEVIKREDF
                     ESAIKLKETKRSLIEISQTQIITKINKLSTDYIYIHKTDNLNVIVIFKYKDGKLVEKD
                     INFDESIYEEEELIAEFITQYYTSLNMIVPDKICIFKKIETEDITKLINELKSTNTEI
                     VYEETKDAIKIMEMAISNAEIALKAYNNEKNKALENLKIILEMTKLPKTIEGFDIAHL
                     NGYKTVASLVTFKMGKPFKDGYRVYKINSLNDGEINDFKAIKEIISRRYTKLINEQLE
                     LPTLILIDGGKGQLNAAYSILKGLKIEDKVTICALAKQEETIFLPNKTQGIKLPKGNP
                     ALKILQNVRDESHRKANSFNRKLRKNIKLNYSKIEGIGEKKAKNILKTLGTYKDIFLL
                     NEDEIAQKMKINIKMAKKIKKFSEDQNLKNTHSIES"
     misc_feature    complement(479554..479793)
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="Catalytic GIY-YIG domain of nucleotide excision
                     repair endonucleases UvrC, Cho, and similar proteins;
                     Region: GIY-YIG_UvrC_Cho; cd10434"
                     /db_xref="CDD:198381"
     misc_feature    complement(order(479731..479739,479770..479778))
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="GIY-YIG motif/motif A; other site"
                     /db_xref="CDD:198381"
     misc_feature    complement(order(479557..479559,479593..479595,
                     479695..479697,479707..479709,479728..479733,
                     479737..479739,479770..479772))
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="active site"
                     /db_xref="CDD:198381"
     misc_feature    complement(478045..479766)
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="excinuclease ABC subunit C; Provisional; Region:
                     uvrC; PRK14670"
                     /db_xref="CDD:173133"
     misc_feature    complement(order(479593..479595,479707..479709,
                     479737..479739))
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198381"
     misc_feature    complement(order(479593..479595,479707..479709,
                     479737..479739))
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:198381"
     misc_feature    complement(479593..479595)
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:198381"
     misc_feature    complement(478264..478725)
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="UvrC Helix-hairpin-helix N-terminal; Region:
                     UvrC_HhH_N; pfam08459"
                     /db_xref="CDD:254815"
     misc_feature    complement(478072..478218)
                     /gene="uvrC"
                     /locus_tag="BT0457"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     gene            479953..481470
                     /locus_tag="BT0458"
                     /db_xref="GeneID:4642090"
     CDS             479953..481470
                     /locus_tag="BT0458"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_945455.1"
                     /db_xref="GI: