GenomeNet

Database: RefSeq
Entry: NC_008710
LinkDB: NC_008710
Original site: NC_008710 
LOCUS       NC_008710             917330 bp    DNA     linear   CON 07-FEB-2015
DEFINITION  Borrelia turicatae 91E135, complete genome.
ACCESSION   NC_008710
VERSION     NC_008710.1  GI:119952806
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02603508
            Assembly: GCF_000012085.1
KEYWORDS    RefSeq.
SOURCE      Borrelia turicatae 91E135
  ORGANISM  Borrelia turicatae 91E135
            Bacteria; Spirochaetes; Spirochaetales; Spirochaetaceae; Borrelia.
REFERENCE   1  (bases 1 to 917330)
  AUTHORS   Porcella,S.F., Raffel,S.J., Schrumpf,M.E., Montgomery,B., Smith,T.
            and Schwan,T.G.
  TITLE     The genome sequence of Borrelia hermsii and Borrelia turicatae:
            Comparative analysis of two agents of endemic N. America relapsing
            fever
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 917330)
  AUTHORS   Porcella,S.F., Raffel,S.J., Schrumpf,M.E., Montgomery,B., Smith,T.
            and Schwan,T.G.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-DEC-2004) Laboratory of Human Bacterial
            Pathenogenesis, Rocky Mountain Laboratories, National Institutes of
            Allergy and Infectious Disease, National Institutes of Health, 903
            S. 4th Street, Hamilton, MT 59840, USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 12/05/2014 13:13:56
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 452448)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 855
            CDS                          :: 815
            Pseudo Genes                 :: 4
            rRNAs                        :: 3 ( 5S, 16S, 23S )
            tRNAs                        :: 32
            ncRNA                        :: 1
            Frameshifted Genes           :: 3
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..917330
                     /organism="Borrelia turicatae 91E135"
                     /mol_type="genomic DNA"
                     /strain="91E135"
                     /db_xref="taxon:314724"
     gene            complement(713..1738)
                     /locus_tag="BT0_RS00005"
                     /old_locus_tag="BT0002"
     CDS             complement(713..1738)
                     /locus_tag="BT0_RS00005"
                     /old_locus_tag="BT0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-N-acetylhexosaminidase"
                     /protein_id="WP_041178544.1"
                     /db_xref="GI:752506679"
                     /translation="MLFGLLLSSLVLLGSIPDIDYDYFENDKFDLVDIDKFLGRVNVK
                     NILRERCFFIGIRNVANPSAVQALSKEELGKIREINPVGIILFRENFKDAQQTKELIE
                     GIKRYLGSDILIAVDEEGGLVSRASENKKLGVYNFPAMESVGKTGDSQLAYKIGEILG
                     KQLRRLGINVNMAPVADAKFVPNSPLGSRTFGYSSYNIGLMVEAFIDGIQREGVFAVV
                     KHFPGLGGTKVDTHKDLALLPYSKNFLMVNNFIPFLFGKEAKFIMLGHVLVPKISGDV
                     SSMSKDIVDIIRHNLNIFSIIMTDAYDMGAIVNNFSLGHAIRKSLNSGIDVVLIPEGF
                     KKLNVEE"
     gene            complement(1743..3197)
                     /locus_tag="BT0_RS00010"
                     /old_locus_tag="BT0003"
     CDS             complement(1743..3197)
                     /locus_tag="BT0_RS00010"
                     /old_locus_tag="BT0003"
                     /EC_number="2.7.7.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771967.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UTP--glucose-1-phosphate uridylyltransferase"
                     /protein_id="WP_011771967.1"
                     /db_xref="GI:500095960"
                     /translation="MYEVIDEIFSKKMLDMLNMHKLKTLSISVKNFPDESHGSILSLA
                     NNSVKLKFKKELVEHNLKKYIDDFTKFSVSSESNFYVFTGDDLERLGLLLYPYLSFGI
                     LNGGSATSYFDILKNNDFNEELYSLYADKILEARRLFGHLPKGITPAYVNRDGSYGFS
                     FLALKMRHLLMLSNRYCELYGKSIKPSIFQMTSFKTYKPISNFLDNIFDDNLIKDLNS
                     CGLQRADILTAIQPLVYCYNKLDDGQYEYFSYCTNGKRSFLALPAGHGQNFKVLRDIY
                     FKLYNSGKKFVYIGNVDNIGFTVNLQTLAIMAITNSSSGFEFSVKTPLDTKGGVLVLD
                     DDNHLTCVDIGSVISKEAVLKAECRGSRILFNCATGLFNLEYLIENMDRIISDMPIRI
                     IEQDKEFGRYTAIEQITWEVMRIVDNPLIFEVNREDRFLPAKLFVDTLIMSNYMNDKF
                     SGNISDIARYLNYALNNALKNKYDLVFRQGKWDV"
     gene            3352..5145
                     /locus_tag="BT0_RS00015"
                     /old_locus_tag="BT0004"
     CDS             3352..5145
                     /locus_tag="BT0_RS00015"
                     /old_locus_tag="BT0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771968.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglucomutase"
                     /protein_id="WP_041178545.1"
                     /db_xref="GI:752506680"
                     /translation="MLKRYILNMTNLSNAINEMILSHSGFRKIFAKSKNENSIEYEIN
                     DDDKILVALITLTISNYFKDKPKKYINVGSDSRATGNIISEIIIKTLILNNNSVKFFG
                     ILPIPEILAYTKENQNSKGFIYISASHNPTGYNGIKIGLNDGGVLNSNETKKIICQIR
                     SNIENETLINNLITNLQKFNTNALHLKTYETIITSQARHKTQSYNSYKSLMQQIIYSD
                     THNQKNIDILKKTIKKEPIGIIGEMNGSSRINSIDREMIESLGIKLEFHNTEIGIFKH
                     GMTPEGTSLNMCKQILEQKFKNDNSFKLGYVPDCDGDRGNLVAILKKEQASIITPQKI
                     FALSVLSELSYLYHTGIKDNLAIVVNDATSLNIEKIASLFNTKVYRVEVGEANLTEMA
                     DLLRNKGLIVKILGEGSNGGNITYPSKVRDPLTTLFSIIKLLKIKNLYKIWCSISNNS
                     YNEHYTLGDILKTINFYSNVEVSSEKAMLKIKVENQEILKTNYEKLLDKEFNNNNNTV
                     LHKLPIHNYEIINYEGIKQNISRTGDSSGGLKVLFKNNKHEIIASLWFRGSKTEPIFR
                     VLSEVISEHNDLLYPLLDFHIDLIHSANSLI"
     gene            complement(5227..6282)
                     /locus_tag="BT0_RS00020"
                     /old_locus_tag="BT0005"
     CDS             complement(5227..6282)
                     /locus_tag="BT0_RS00020"
                     /old_locus_tag="BT0005"
                     /EC_number="6.1.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tryptophanyl-tRNA synthase"
                     /protein_id="WP_011771969.1"
                     /db_xref="GI:500095962"
                     /translation="MQRKVMLTGDRPTGSLHLGHYIGSIVNRLKYQEEYETYIIIADL
                     HTLTTKPDLKSINEISVNVREMVLDYLACGINPEKVNIYLQSAIPELLELNLILSMIV
                     MVNRLQRIPSIKDMSVAAGLSEVPYGLLGYPVLMSADILMTKANLVPVGRDNEAHIEL
                     TRELARKFNYLYGDFFPIPEAIFTDSQALVGIYGKAKMSKSLGNAIFLSDDEKSLRKK
                     VMSMFTDPKRVRADIPGEVDGNPVFIYHDLFNSNVDELYEFKTRYRKGTIGDVEVKER
                     LFEVLNQFLIPIRERRKFFEAKKGYIDEIIFEGTSKTRKVAIEVIKNAKNLMGISRTW
                     NGVRRNVEKILKNNLSI"
     gene            complement(6285..7358)
                     /locus_tag="BT0_RS00025"
                     /old_locus_tag="BT0006"
     CDS             complement(6285..7358)
                     /locus_tag="BT0_RS00025"
                     /old_locus_tag="BT0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011771970.1"
                     /db_xref="GI:500095963"
                     /translation="MSLELKPTDRLKFVKLQSVFYVIALIVMLIAILKIAQTIFKPLA
                     IAVVLGFLVYPIYTFLKKLKIPRVLIVFVIFFVLFSFSYLVFSFVYYSVTVLIDQLPY
                     YQKQLIFIMVDILEKYKLDSAIISTIDFSKYIYPFLTRISNEIIGFASSLVVLFLLLY
                     FLLSEIHIFDIKVKNAFKQSVSSIFIEALSTINSQISKYLGIKLFVSCLTGFLVFIGL
                     KLFGQDFPRVWAVLTFVFNFIPSIGSILAVFFIMIAALVQFYPNLNLVFYIFIYNTFV
                     QMLIGNILEPKMQGHRLDLSPFLLLCFLFFWGWLWGIVGLLIAYPFTVIIKVIVDNIA
                     CLKPFSVFLSGSKILSVDNNKES"
     gene            complement(7455..8312)
                     /locus_tag="BT0_RS00030"
                     /old_locus_tag="BT0007"
     CDS             complement(7455..8312)
                     /locus_tag="BT0_RS00030"
                     /old_locus_tag="BT0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421790.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178402.1"
                     /db_xref="GI:752506537"
                     /translation="MGKKEKIIALIFDFDDTLIYGNMQQVLFDEYNVNASLFWDEVEN
                     LSITYNKNHCNIIANEMIYLSHFLTYVKEGIFKGLNNKILFELGSKLRFFEGVISLFK
                     EIDEINRSLKKSDTVINIYIVSSGFRQMILGSSIAPYVTKVWACEFIDTYLMPFYQNL
                     DNKFSENVVLSSVCYFVDHTIKTRVIFELNKGSYDKINKRIPKGRREIPFENMFYIAD
                     GFNDIPAFEILNNSLNHYKNTLTVYHGNDENAKRLVKEKRVGDLAEANYSKGTKLYNW
                     IMEKIHLNI"
     gene            8446..9216
                     /locus_tag="BT0_RS00035"
                     /old_locus_tag="BT0008"
     CDS             8446..9216
                     /locus_tag="BT0_RS00035"
                     /old_locus_tag="BT0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178546.1"
                     /db_xref="GI:752506681"
                     /translation="MIDISSINQIKDIFSKVLDVSLISILVYYIYKNVINSYSVNLLK
                     GMIIITSIGIVSYYFNLYTINWLLNYIANILPIAMLILFHQEIKKIIMQIGNFNLSFK
                     LANNKEETTKTIVEIIKTIKHLSENKSGSLICIEKKIQLDQIINKGIRLDSIVSNEIL
                     ISIFDYETPLHDGAVIISNNKIVYAGSFLPLSNVESISKTFGTRHRAGLGISENSDAI
                     TIITSEETGSISLTQNGKLEYNLSLNEIKKKLNLALIE"
     gene            9220..10215
                     /locus_tag="BT0_RS00040"
                     /old_locus_tag="BT0009"
     CDS             9220..10215
                     /locus_tag="BT0_RS00040"
                     /old_locus_tag="BT0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421792.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771973.1"
                     /db_xref="GI:500095966"
                     /translation="MIITKKFMNIIKLLFEDWQNKAISILIAIIMFTTSYFHSIESIT
                     IEKKFNILLEDEVTLGKIPDFNKMLLTVKINKKDLKYLDLDRITLLVEANNIKEAGEY
                     ELPIKIKNFNPIPIVEYKLSKNKITLNLDKKISKLVKVEPKFKLLEKEGKGEYFIAKY
                     NIVPEKLKIHGPEKVIKTINSIKTKIKEFDINTVFISEHLEVISPNPLITLEKNHVIV
                     NITLGKKYIHTTIKNPNLIFNNLKNGLEIKNKEKILDPENEMFIKIRSGLSEKIIKMH
                     IANKNINLNLDLSQIATPGIYNINTDIILKNNTHGIEVYEYEPKTIKIEVISTEQ"
     gene            10217..10594
                     /locus_tag="BT0_RS00045"
                     /old_locus_tag="BT0010"
     CDS             10217..10594
                     /locus_tag="BT0_RS00045"
                     /old_locus_tag="BT0010"
                     /EC_number="2.7.8.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYG3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ACP synthase"
                     /protein_id="WP_011771974.1"
                     /db_xref="GI:500095967"
                     /translation="MTKSIGCDIIKVTRFNSFLQNRKKLERFFTQREIENSAMKGKGV
                     LESLAGKFSAKESLIKALSPLINIKIKYSLKDIEIISLPKGNIIFQLHNDIKTLINQM
                     NLKLYLTISHEREYAIAFVIVEN"
     gene            10598..11446
                     /locus_tag="BT0_RS00050"
                     /old_locus_tag="BT0011"
     CDS             10598..11446
                     /locus_tag="BT0_RS00050"
                     /old_locus_tag="BT0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421794.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771975.1"
                     /db_xref="GI:500095968"
                     /translation="MKKISYLTKYEIECPLCKHKFRKEELLTGSSRLIAGELKVDLKR
                     EYIKNEKYGNIYPRIYSITVCPNCYLAAFPNEFNAIALINNNIKQILIIRTDERKEIK
                     SIFEDNLNFNEPRRLQEGAASYILAIMCYEHLDKTHNPTFNQAKCAIRSAWIFEDLDK
                     EYPNQNYNYLQKIFYHKAAYLYKLTIEKEQNNSEPINAEIVFGPDTDKNYGYDSVLYL
                     SSLLEYFYGNKEDKQYRYNQLVDIKTLLSKITGMGKSSKEKPSILLDKIKEVYFKISN
                     EIKTFK"
     gene            11447..12184
                     /locus_tag="BT0_RS00055"
                     /old_locus_tag="BT0012"
     CDS             11447..12184
                     /locus_tag="BT0_RS00055"
                     /old_locus_tag="BT0012"
                     /EC_number="4.2.1.70"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S1K1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA pseudouridine synthase A"
                     /protein_id="WP_011771976.1"
                     /db_xref="GI:500095969"
                     /translation="MKKVLAKITYDGSLYYGFQIQPKKPTIQGEIEKVLEKISKTKIK
                     IHSAGRTDKGVHARGQIISFYIKINIKLKNLKTAINSLLKDDIRIIKLKYVEDKFQPR
                     FDAKRRKYSYYILNNENHYPWEGYRAYYVKKKLNINRLNEMAEMLIGIHDFTTFSCIR
                     DQTNSKLKEIYYARFKKKNKFIIFEIIGSSFLWKMVRSIVGVMIDIEIKNEPVDTFKK
                     ILNSKNRKLTRKTAPAKALFLDKVFYE"
     gene            12177..12755
                     /locus_tag="BT0_RS00060"
                     /old_locus_tag="BT0013"
     CDS             12177..12755
                     /locus_tag="BT0_RS00060"
                     /old_locus_tag="BT0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421796.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771977.1"
                     /db_xref="GI:500095970"
                     /translation="MNKSKLLKKLILLRTLKNNISENIYSKQEEFEKLKNQIIKARNI
                     KILKHTEQKDIKENNRLIKSTGYKINKNDKKGLLIVYIDKKYLNQNAKIIVKKWCESI
                     KILNYKIIDNPNTLTFEINNQQPKAILACEEVALFLNQHLRIQIVRGFELNFKGIPIV
                     FTYLPTNQVTNPEIKKEIWQDLKIIKGIIKYG"
     gene            12748..14724
                     /locus_tag="BT0_RS00065"
                     /old_locus_tag="BT0014"
     CDS             12748..14724
                     /locus_tag="BT0_RS00065"
                     /old_locus_tag="BT0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal protein N'"
                     /protein_id="WP_011771978.1"
                     /db_xref="GI:500095971"
                     /translation="MDKNSEHNFYYEIAFNIPVNRLFFYKYNLKLETGIRIITNFNGK
                     DTIGIIIKRYAKEELKENFTFEIKDIIKVIDKNAIIIEHNINLAHWISQKTFSGFGET
                     LFCGLPKISTSNKEIKNNDNENLSYKLPIQLNEEQNSIYKEIIESNIQNTFYLFGVPG
                     SGKTEIFIKLCENYLEQKKQIIFLIPEISLGYQIIKRIKSNLSTNKVYEYNSKVSNST
                     KTLIWNKVKNGENLIIIGVKSALMLPFKNLGLIIMDEEHEYTYKSENTPRFHSRHIGF
                     FLQSTFNAKFVMGSATPSLEAYLAMENNQIKKMVLKNKFFERTFKELKIIDMKKERQI
                     ISSELLYSIQKSLIDKRQALIFINKRGYSKTLECKICGHIIYCPHCSFNLIYHKSENK
                     LICHYCNYKTNIINNCPNCNSQDIIYKTYGIQFIERELKNFLPNARIARTDSDLNKKE
                     IIQSINAFENGQLDILIGTQIIAKGFNFKQIKTLGIINADIGMGLPDFRSSERIFAII
                     SQVLGRAARFQSDNTIIIQTKNPDYYPIKYAYEGKYEEFYKEEIKIRKELNYPPFKKI
                     IRIVIRSKKQETARHKCLEFFEISKELLNDKIEYLGPSKAPMSKISKYYRYNIIYLSK
                     SFNLLEKLIRHTKEKIKLTRDTYIEIDYYPISLL"
     gene            complement(14721..15341)
                     /locus_tag="BT0_RS00070"
                     /old_locus_tag="BT0015"
     CDS             complement(14721..15341)
                     /locus_tag="BT0_RS00070"
                     /old_locus_tag="BT0015"
                     /EC_number="2.7.1.48"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYG8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridine/cytidine kinase"
                     /protein_id="WP_011771979.1"
                     /db_xref="GI:500095972"
                     /translation="MVKIIGITGGSGSGKTTVVNKISEVIPEFVLISQDNYYKSVGDY
                     EYEFLDVNFDHPDAFDNNLFYKHLKKLKENKLIHMPLYDFINHKRKDETVEIVPTPVV
                     IVEGIMIFVEERVRNLIDLKIYIDTPNDIRFIRRLERDMSKRGRTLESVIEQYLSTTR
                     AGYYRFIEPTKEYADLIIPEGGHNDKALYVLSSFLRTLGQESSVFF"
     gene            complement(15334..15723)
                     /locus_tag="BT0_RS00075"
                     /old_locus_tag="BT0016"
     CDS             complement(15334..15723)
                     /locus_tag="BT0_RS00075"
                     /old_locus_tag="BT0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771980.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese-related sulfurtransferases"
                     /protein_id="WP_011771980.1"
                     /db_xref="GI:500095973"
                     /translation="MIVSYIKLICLIVFLFFYIWFFIVLKMKRTNLVLLEKIKNGAKI
                     LDIRSPKEYSKSHYAKSINIPFKDLFAKKDKLGNVETQIIIYGKTFNKSIEAKKILKG
                     LGFNNVFVAGTLKNMPKLPSSKEEVNG"
     gene            15852..16820
                     /locus_tag="BT0_RS00080"
                     /old_locus_tag="BT0017"
     CDS             15852..16820
                     /locus_tag="BT0_RS00080"
                     /old_locus_tag="BT0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011771981.1"
                     /db_xref="GI:500095974"
                     /translation="MKKKRNKWTRIKQKIKFIILKILRKQLKNILKDPKLILISTLQI
                     TTGSLLMAISTNILYIPHGLLSGGIAGIALMMHYLLNFNLGLTIFILNIPLFIIGIKF
                     LNITFVIQSWIAMALYSLIVNYSQFLQYKMQINDMILVSILAGLISGLGLGLIFRAKG
                     SSGGTDIVSMIIKEKYSISIGTTNFLFNLAVLLIAAAFFNIEIALYTLIASFVTAIMT
                     DKTSTGFGNQKAILIISDKGKEISYLLTNKLKVAATLLEGKGAWAGNDKTIVFIVVPT
                     MRMSRIKYISQKIDPNCFITVLNTNEITGGKKIIESPITNKYDTTT"
     gene            complement(16817..17797)
                     /locus_tag="BT0_RS00085"
                     /old_locus_tag="BT0018"
     CDS             complement(16817..17797)
                     /locus_tag="BT0_RS00085"
                     /old_locus_tag="BT0018"
                     /EC_number="4.2.1.70"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421801.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal large subunit pseudouridine synthase
                     D"
                     /protein_id="WP_011771982.1"
                     /db_xref="GI:500095975"
                     /translation="MKKFQKEFIVRKDSQRLDIYLSEDLCLFTRSQIKKREVKAFKYH
                     DGVFVAIKLSRPVFVDDKILIEFNEEINLREYVRPLNLPISILYEDINVIVVDKPQGI
                     LSHPGISNLENTIVNFLLYHISGLRDSFQEDKLRPGIVHRLDKETSGVMICAKNLKTL
                     NFLSRQFKERFVKKVYIAVVKGNFKIDSGIIETFIDRDRHDRKRFSVHENRGKRALTE
                     YRVLASIGNYSLVALKPKTGRTHQLRVHMKHLNHPILGDSIYARLDKEFKEMSLMLHA
                     FKLEINIKEGSLKKFISVFPQRFINFLSIFYDKETLSILVNDFIVFLDKF"
     gene            complement(17798..18295)
                     /locus_tag="BT0_RS00090"
                     /old_locus_tag="BT0019"
     CDS             complement(17798..18295)
                     /locus_tag="BT0_RS00090"
                     /old_locus_tag="BT0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771983.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771983.1"
                     /db_xref="GI:500095976"
                     /translation="MMIRFLLLLFNVFILYSNSLDYFKFELEYLNYKFSLRDKISSSE
                     NNIDFGSEFFVRLESNDDFFYKDVQENKDLNIEKTINSNWGKKLFRFSAISVGTFPIA
                     LFVGLYCFDLSYYFNNMDGKNFPYPFSSGFELSKDETFKKFMISASAGLAISLIIALI
                     DCFSY"
     gene            complement(18300..19964)
                     /locus_tag="BT0_RS00095"
                     /old_locus_tag="BT0020"
     CDS             complement(18300..19964)
                     /locus_tag="BT0_RS00095"
                     /old_locus_tag="BT0020"
                     /EC_number="2.7.1.90"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771984.1"
                     /note="catalyzes the formation of fructose
                     1,6-bisphosphate from fructose 6-phosphate and
                     diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diphosphate--fructose-6-phosphate
                     1-phosphotransferase"
                     /protein_id="WP_011771984.1"
                     /db_xref="GI:500095977"
                     /translation="MVSVFQKERYKYIPKLPKILENDFQNISVVFGEKTEALGDRDAL
                     REIFKNTYGLPVVNFTQGSSNVDFTRVLNVGIILSGGPAPGGHNVVAGIFDAIKKSNP
                     NSKIFGFKGGPSGLLEDKKIEITQELIDSYRNTGGFDIVSSGRTKIETDAQYEQALSV
                     ILKNNLNALIVIGGDDSNTNAALLAEFFKKKHHDIQVIGVPKTIDADLRNAHIQISFG
                     FDSATKTYSEMIGNLCRDAMSTRKYWHFVKLMGRSASHVALECALKTHPNICIISEEI
                     LAKKKTLSELVRDITSVVVKRSLKGYDFGVVIVPEGVIEFIPEVKSLMIELCSIFDSN
                     ESEFKGLDVEDIRKIFISKLSGYMREVYVSLPLFIQIELVNSVLERDPHGNFNVSRVP
                     TEKLFMEMVNVRLEELRKLGEYSGKFVPIDHFFGYEGRSVAPSNFDSDYCYSLGYNAA
                     ILVLNGLTGYMSSVKNLNKNATEWLAGGVPLTMMMNMEERYGVAKPVIKKALVDLKGA
                     PFNEFVKNREEWAVNNLYVSPGPIQYFGVSELVDEVTLTLKLELEN"
     gene            complement(20033..21070)
                     /locus_tag="BT0_RS00100"
                     /old_locus_tag="BT0021"
     CDS             complement(20033..21070)
                     /locus_tag="BT0_RS00100"
                     /old_locus_tag="BT0021"
                     /EC_number="5.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine tRNA ribosyltransferase"
                     /protein_id="WP_011771985.1"
                     /db_xref="GI:500095978"
                     /translation="MDTKEFYFDLPCKLIAQYPSEKRGLSRLMVLDSGNQKIYHNDSI
                     NDIFKYINSNTFLVFNDSRVRKSRIYAKTEHGGSIEFLILDRLAGDEFTSLISKAKKQ
                     NIGKVYMFPQGLLAQIISKTDNEFIIKFNKCVSESYFEQHGLIPLPPYIKRNYDRADE
                     ERYRTIYSKYIGSSASATAGLHFSEELFSKLDENNIEYDFITLHVGLGTFLPVRTKTI
                     EEHKMHFESFSIKNSVALRLEESKALGKKILAIGTTTLRALESAYDKQKGFVRGEQKT
                     NLFIYPGKGYEFKFVDMLFTNFHTPESTLLMLVSSFGGKDFVFSAYREAVKMNYKFFS
                     YGDATLFLNHM"
     gene            complement(21060..22103)
                     /locus_tag="BT0_RS00105"
                     /old_locus_tag="BT0022"
     CDS             complement(21060..22103)
                     /locus_tag="BT0_RS00105"
                     /old_locus_tag="BT0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771986.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvB"
                     /protein_id="WP_011771986.1"
                     /db_xref="GI:500095979"
                     /translation="MDFGGGSKFLSSDKNFLYDRNESELRPKSLKDFVRQSHIKENLN
                     IFIKASRDRNEALDHVFLSGPPGLGKTTLASIIAFEMNTTIKMTSAPALDKPKDIVGI
                     LTTLDDKSILFIDEIHRLKPVIEEMLYIAMEDYKIDWIIGQGPAARTVRMPIPKFTLI
                     GATTKPGKVASPLYARFGIVFRFDLYNEDELVKIIQRNSIILNVKLEDKAAWLLARSS
                     RGTPRVANRLLRRMRDFAQVGGYGLITESIVSSGLEMLKIDHKGLDEQDRNILRSLIL
                     KFKGGPVGVETLAISVGETADSLEDFYEPYLILKGLIERTSRGRKATDFAYFHLNLNK
                     NNHDDLNTGEYGY"
     gene            complement(22158..22748)
                     /gene="ruvA"
                     /locus_tag="BT0_RS00110"
                     /old_locus_tag="BT0023"
     CDS             complement(22158..22748)
                     /gene="ruvA"
                     /locus_tag="BT0_RS00110"
                     /old_locus_tag="BT0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYH6.1"
                     /note="plays an essential role in ATP-dependent branch
                     migration of the Holliday junction; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Holliday junction DNA helicase RuvA"
                     /protein_id="WP_011771987.1"
                     /db_xref="GI:500095980"
                     /translation="MINKICGKIVEKRESSIVIVALPFEFEILVSSFCNAELGLQEDV
                     EILTYLHLREDEIRLFGFLNVSEREVFEKLISVDGIGPKAALRILSGIKYNEFRDAVE
                     REDVKLISNVKGIGNKMAGKIFLKLRGKLVKVNEASSGVLKFKELEQSIVNMGFDRKL
                     VAAAIKEIMLIDEFLMLRQVDQEQFLFREILRKLSG"
     gene            complement(22836..23315)
                     /locus_tag="BT0_RS00115"
                     /old_locus_tag="BT0023A"
     CDS             complement(22836..23315)
                     /locus_tag="BT0_RS00115"
                     /old_locus_tag="BT0023A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014967206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178403.1"
                     /db_xref="GI:752506538"
                     /translation="MRILGIDPGLANVGWGILDRKGSKYMYVQDGTVITHPFMSLKDR
                     LKLISDEIILIIDNFKPDVASIENIYFAKNKKTAISVSEARGAIILTFALKNLDFYEY
                     TPIQVKNSISGFGRIEKVQVKYVIRILLGMKPDFIFTSDHSSDALALAICHGNYHIL"
     gene            complement(23347..24081)
                     /locus_tag="BT0_RS00120"
                     /old_locus_tag="BT0025"
     CDS             complement(23347..24081)
                     /locus_tag="BT0_RS00120"
                     /old_locus_tag="BT0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYH8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011771989.1"
                     /db_xref="GI:500095982"
                     /translation="MSGHSKWSTIKRKKGALDAKRNKIFTKLIREISIAAKMGGGDIE
                     SNSRLRLAVNKARVSNMPKDNIEKAIKKGSGDDNIGSEYFELTYEAYAPHGVALIIKC
                     LTDNKNRTASEVRSVLSKSGGSLGAPGSVSYMFHKKGLISYSLDKYPEDEIIELALEA
                     GAEDIYSEGSQIEVITSAENFEAISSFLRTKFEEDIAEIALIPGNKLSLNKEQMDKVL
                     ALIEKLEDFDDVQEVVHNLEIIDEIN"
     gene            complement(24082..24987)
                     /locus_tag="BT0_RS00125"
                     /old_locus_tag="BT0026"
     CDS             complement(24082..24987)
                     /locus_tag="BT0_RS00125"
                     /old_locus_tag="BT0026"
                     /EC_number="1.5.1.5"
                     /EC_number="3.5.4.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methenyltetrahydrofolate cyclohydrolase"
                     /protein_id="WP_011771990.1"
                     /db_xref="GI:500095983"
                     /translation="MNNVFDGKLFANQYYLLLKEFLIHHDLVDKVSLKVILANDNPAS
                     KLYVAVKERVSREIGINFHVIKLAGNSEQDNILTLIEAENINEYTDGIIVQLPLASEI
                     DVNMVLNSIMSTKDVDGLSAINLGKLISGDRKGFIPCTAFAVLKVLFDKGIEISGKTV
                     VVIGRSSLVGRPISILLSSKPYDATVITCHSKSTNLDVYVRQSDIIISAVGKPKLIKA
                     SMIDGYPYVIDIGISRVEIDGNSVLIGDVDFESVKEKVKFITPVVGGIGPVTVLMLMF
                     NTIKAHLIRYNKFDILEKLEKLVEV"
     gene            25147..25782
                     /locus_tag="BT0_RS00130"
                     /old_locus_tag="BT0027"
     CDS             25147..25782
                     /locus_tag="BT0_RS00130"
                     /old_locus_tag="BT0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771991.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771991.1"
                     /db_xref="GI:500095984"
                     /translation="MKKNFLVGLTLLFLLHANVNRIEAYSIDRNGNSIIEVDLSLGIP
                     LFYHSLSKVFSSNLYPGGIGALKYKYHILSNLAIGFELRYMFNFDINHSFNLLNPDSG
                     IGKTFSTVPITFLTAYVFDIGEIFQIPIFSNIGFSLSSYGDKSDNISNLRTFDAMPVM
                     SIGSGILWNFNYQWALGITTAWWTMFELGNMAKIGHFLLISLSVIVNINKL"
     gene            25789..26820
                     /locus_tag="BT0_RS00135"
                     /old_locus_tag="BT0028"
     CDS             25789..26820
                     /locus_tag="BT0_RS00135"
                     /old_locus_tag="BT0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771992.1"
                     /db_xref="GI:500095985"
                     /translation="MDKKGYKKFMIIILIMLVLSCSSESIFSQLSKLQKINSNNNILD
                     TSSPSGISLVNDTLYVAAMHLFKKSNGNVERVNFSNSYEFVIDLVNISGKTYLLVQNK
                     NGQLELYSLESNNWKLLFQKNLIPIKFLKSIGTSGITSAFILALGENGNQTILDTNGN
                     NQTPNSTTNNDKFYQISNDQQSITGKSAKIWKLKGGGVINVKSTNEIMAIIETSIRGS
                     KETLVFTGRNHDTSDHKFKIYSSTNNYQDPIFNRDGIGEFIAYFAREVDGIILIGSNN
                     GFVELVRDKNTFDLQPPSQSVLPGSYNGSQLSKTRLNDIIPTSNKTIYILTQGKGLWK
                     IENKKLIKE"
     gene            complement(26806..27237)
                     /locus_tag="BT0_RS00140"
                     /old_locus_tag="BT0029"
     CDS             complement(26806..27237)
                     /locus_tag="BT0_RS00140"
                     /old_locus_tag="BT0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771993.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771993.1"
                     /db_xref="GI:500095986"
                     /translation="MLNKIFVDADSCNLQVIKFLQNFVSNRNVRLILVANRHLNLEMS
                     KNTSVKIARDVDSLILELIDKNSMVVTRDILFVKNLLNLQIKVMNDEGQIFDTNNINY
                     LYFRSKLNINLGIKVKKYFHEETNKVRYSNFAMNFYRLFFN"
     gene            complement(27227..27862)
                     /locus_tag="BT0_RS00145"
                     /old_locus_tag="BT0030"
     CDS             complement(27227..27862)
                     /locus_tag="BT0_RS00145"
                     /old_locus_tag="BT0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="WP_011771994.1"
                     /db_xref="GI:500095987"
                     /translation="MAAYLTFEQRLLRKKRRQNFLKIILLFLVLNYFFTKFVLQIFIF
                     QGDEMLPLITKNDSLIFISKYMRSFFVPLKVNDVVLYEDSNLRRNFILNFFRDLFFLN
                     KIFNTRSYKIAKIVATQGDLVYVKGFDILVHRRDDNSYYLNGNFMSGYRLNDFFNFNE
                     VIRCFALKKNEFFLLNENLKILNDSRVFGPVEQSHILSFLVLRIMDYKFVK"
     gene            complement(27865..28845)
                     /locus_tag="BT0_RS00150"
                     /old_locus_tag="BT0031"
     CDS             complement(27865..28845)
                     /locus_tag="BT0_RS00150"
                     /old_locus_tag="BT0031"
                     /EC_number="3.4.21.89"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="WP_011771995.1"
                     /db_xref="GI:500095988"
                     /translation="MYLEKLDKFANFLVKIIEKYLTYRKKRKYFYKLKAKRRGFMLNF
                     LLELLGASIFVLGINQYFLQAYRIPSGSMENTLQIGDLLFVDKFSYGPELLPGVCKIN
                     GVKEPNEAEIVIFENVEYESKGLFFDILHRLLYMLSFSFVDLDRDENGNPSVRFLVKR
                     ALFADGKLVRFRNGTVFVRKEGEESFIEENSYKASLGYNFGIKKVIEDVDYKVYDNLA
                     MFIALNQLSVDLENISDFSFFNVREVDRFEIERLEYRYLVAFMPYVDYYMEKAIMRDY
                     GIYVPYGYVLPIGDNRDNSYDGRFFGVINKSKILGRAFFMYFPFSRIGLI"
     gene            29037..30506
                     /locus_tag="BT0_RS00155"
                     /old_locus_tag="BT0032"
     CDS             29037..30506
                     /locus_tag="BT0_RS00155"
                     /old_locus_tag="BT0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771996.1"
                     /db_xref="GI:500095989"
                     /translation="MLKENDRLDINEELLTVKLKPILGITPKIYVFFTIIILPLILVF
                     SLIINTKLNNPGAYLKIKTNVNNAHVYLDEKYIGRTPLKKYINTTKGTLKIQRLGFET
                     YEKKIDIQNKFFTSYQFNIDLRLKNPDKIIAQRQKELSVMTKIKNNNDNIQLIPVFSL
                     IVNDLPNSPEHIKKFFKTSIPHIHSNTMFKDFLIAYKDMYSINNNNSKEIWKSLQQNF
                     NLENRTIIWFFENLDKEQQKQISNETWFKTLIEKLKNENKILNFETKNINLHLKDFKK
                     IAPQNIESTQNYKLYSQNLTLKTTYKLKEFLIQNRNVTKTEYQKFLNENPKWTLNNKD
                     NLIKEELVDESYLKTFKQMPSNEDITHISYHAATEYAKWYSSNLPKGFKARLPISQEW
                     EVYQKEVPKAIESLNTNEISKKVGFWNLMQNPNINDSILFQDENDIYYAHSNFNSLIT
                     EIRTYNYNNNSTLKPSTQASFLKHWCSPNIGFRLVIEKE"
     gene            30509..30958
                     /locus_tag="BT0_RS00160"
                     /old_locus_tag="BT0033"
     CDS             30509..30958
                     /locus_tag="BT0_RS00160"
                     /old_locus_tag="BT0033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_011771997.1"
                     /db_xref="GI:500095990"
                     /translation="MSILLLENKKARFNYFIEDKINCGIILKGTEVKSIKLKKFSFND
                     SFASIKKDEVWLENLHIAKYKEGNIFNHEEIRRRKLLLTKKEIQKLKKFKEKEGYTLV
                     PISIYLKNSLIKVELGVCKGKKLFDKREVLKQKSIKKDLNREIKQYR"
     gene            complement(31174..31698)
                     /locus_tag="BT0_RS00165"
                     /old_locus_tag="BT0034"
     CDS             complement(31174..31698)
                     /locus_tag="BT0_RS00165"
                     /old_locus_tag="BT0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011771998.1"
                     /db_xref="GI:500095991"
                     /translation="MKKILILMLVFFCAFVSFAQNHDELVGSGGNVEKMLLYETYKKD
                     AVVPCLLNLFVGFGIGSLVQGDITGGLLSLGFDVVSIGLLSYGTYSIIESHYEKKEKP
                     TVLALSLAAVGGATLVLTRIIEAVLPFTYASSYNRKLQENLGITLGGLQPEVDMNFNE
                     DARLMLEVSFTKRY"
     gene            complement(31829..33715)
                     /locus_tag="BT0_RS00170"
                     /old_locus_tag="BT0035"
     CDS             complement(31829..33715)
                     /locus_tag="BT0_RS00170"
                     /old_locus_tag="BT0035"
                     /EC_number="5.99.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011771999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit A"
                     /protein_id="WP_011771999.1"
                     /db_xref="GI:500095992"
                     /translation="MDIKTLLKDNFLQYSSYVIKDRAIASVIDGFKPVQRRIIHSLFE
                     MNDGNFHKVANVVGNTMKYHPHGDTSIYEALVNMANKDLFIEKQGNFGNLLTGDPASA
                     SRYIECRLTPLAFEVLYSKEITSYEPSYDGRNDEPLIFPAKIPVILVQGSEGIAVGMA
                     AKILPHNFNEILSAVKSELLGESYELYPDFPTGGIVDVNEYADGNGKVLVRARIEPTD
                     DNKAILIKELPFGETTESLIASIERAIRKNYIKVSSINDFTTENVEIELTLPRGVYAS
                     EVIEKLYHYTNCQVSISVNLLLLSDRYPVIYTVTDIIKFHAEHLQKILKMELELERNK
                     ILEKIFSKTLEQMFIEKKIYKILETISKESDVVNIVLSEILKYKDSFLYRDIVLDDIE
                     NLLKIPIRKISMFDIDKNNKDIRNLSKELKSVESNIKSIRGFSINFIDTLLEKYSKVY
                     RRKTEISLIKSKNVKEIATKNMKVYLNLKAGFVGTSLIDGEFIGNASYYDKILIFKKN
                     SYVLKNIEDKTFIDKNNVNVLVYDINNSKDQVFSIIYLNKADNFYYVKRFKIDKFITD
                     KIYEFLNDGDEFIDFALNPEFVEFSTSKDIVRMISIDDFMIKSRISVGKRISSSIIKK
                     VKFK"
     gene            complement(33715..35511)
                     /locus_tag="BT0_RS00175"
                     /old_locus_tag="BT0036"
     CDS             complement(33715..35511)
                     /locus_tag="BT0_RS00175"
                     /old_locus_tag="BT0036"
                     /EC_number="5.99.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772000.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase IV subunit B"
                     /protein_id="WP_011772000.1"
                     /db_xref="GI:500095993"
                     /translation="MNTNSYDESKIVTLSSLEHIRLRSGMYIGRLGDGSNIDDGIYIL
                     VKEIIDNSIDEFIMGHGKEILIKKENNIISVRDYGRGIPLGKVVESVSVINTGAKYND
                     DVFQFSVGLNGVGTKAVNALSSNFLVRSIRDGNFFEAIFSKGNLINTIEGKSNEQNGT
                     YIEFLADTEIFGKYKYSEDFLRRRFFHYACLNKGLKINYNDQIFQSDNGLLDFINAEI
                     KGEDLLYDFVYYSSKTLEFAFSHTNNYGETYFSFVNGQYTSDGGTHQTGFREGFARAI
                     NDFLKKTYSSTDIREGLIATLSVKIKDPIFESQTKNKLGNIETRSSVAKEVQRIILEI
                     LYKDKTLAKAIENKVVDNERLRKELSSVRKEAKERAKKISFKIPKLKDCKFHFNEKSM
                     HSDSTMIFLTEGDSATGSMVSCRDVYTQAIFSLRGKPQNMFEKNKSEIYKNEELYNMM
                     VALGIEESIENLRYNKIVIATDADFDGFHIRNLLLTFFLTYFEDLVLNGHMYILETPL
                     FRVRNKSSTIYCYFEEEKQKAVRELKNPEVTRFKGLGEISPSEFRSFIDVSNIRLTKV
                     DLVNIKEIKEHLGFYMGPNTPERRNFIMENLI"
     gene            complement(35498..36271)
                     /locus_tag="BT0_RS00180"
                     /old_locus_tag="BT0037"
     CDS             complement(35498..36271)
                     /locus_tag="BT0_RS00180"
                     /old_locus_tag="BT0037"
                     /EC_number="2.3.1.51"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
                     /protein_id="WP_011772001.1"
                     /db_xref="GI:500095994"
                     /translation="MKILRSIVTYINFFFFVLVFTVLFPVFLIFKIFRFENYFIKFSF
                     ILVRFAIKISLWFAGIKVIVTKDDDCSLPEDGVVIMANHIASMDPLFLIYVFMKPFVI
                     VAKKSLLKIPLINFLLISMGSIFINRNSIKSSAITQRKAAKVIQEGGAIGIFPEGTRN
                     RGGSTRDFKRGSVNLALRTNSSIIPVTLFNTHKVFVKNLILNSGLSIYVHVHSLIDVS
                     NLTDDDKAQLHIIVRDKIIKKLEKMKIQYNVDRNLNEYK"
     gene            complement(36277..37728)
                     /locus_tag="BT0_RS00185"
                     /old_locus_tag="BT0038"
     CDS             complement(36277..37728)
                     /locus_tag="BT0_RS00185"
                     /old_locus_tag="BT0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772002.1"
                     /db_xref="GI:500095995"
                     /translation="MCFKKWIIFLFVTLFSCVKGSKDFIVFNKEMKKISEISYSDTGL
                     SGDTGEDVFGSLIDLKGYKILSVHQENLNLDVYFEQVVLAQNFADLKTYLFIIGFDPK
                     SHEAVVLFKTQVNIDSKNSYNMYLEDITGDYNFDIVIQGFLDEDSVLYIFQRAVANDV
                     ASYRPIFFDKVNGSIIINKYDRSSAYDDKKSRESYSISLERYEKQGEDMIVSKIEKYE
                     YSQLQGKYYPLSASEKVRRIDNDVYQTLKNLPKEEVYKFLYGVWYDSNAHQRLRKSNF
                     EDALFLSFNRHLNEISIFKNNAQEIAHIEYISRPAYNTLNISTKSIFSDLIVYNFWIK
                     IIDIDNIEIKIDTGTDAYDKYGFSGVFKRFNDSVLVEDDKDSLFIPNGNYVCKDIIYD
                     FSYPNLTYIVGDNIYYGIFNVFSLNNNLVLEYEISMDENKISEAFIIEYSERIVQKQK
                     FSTILLNPIKILKDEVSLVKGQKLKLERIEKLG"
     gene            complement(37793..39286)
                     /locus_tag="BT0_RS00190"
                     /old_locus_tag="BT0039"
     CDS             complement(37793..39286)
                     /locus_tag="BT0_RS00190"
                     /old_locus_tag="BT0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772003.1"
                     /db_xref="GI:500095996"
                     /translation="MRKRVNQAKEVISKVDFNDKKVGTWGLLALIVIVFGFIIAPLMP
                     GLFDTTDSSSLKFGSYKGQPVYYEKDNKFAQYVKSYSNFYSKLKKNNSLDIEYFIWNL
                     AFMKYVEDIAFIDLAKTNSFYVSKNILNKNLMNSPVYLDSSGNFSPKRYNKVSDYQKF
                     KIHNETVDNLLSSNIQVLLSSSFILPDSLLNAIKSMNEIRRNIVYVSLSYQDFPKDKV
                     ISYADQNQKLFKSLDIVSIRFKNLSDAGGAYEKLSKGMPFEEVAKFYSEDVTNFKGIA
                     SSKKYYFDLDLVLEKKEDLAAIFSLKMNEFTSPIKSKNGNGYDIYKALSNIGDFDKNS
                     EHDISSVRNYIETYEPSVIETFLEKKLNDILTEVNFDGPQQVFKKHNLVLKKDVVNLA
                     YNMNIYPSTLRELSVFSNSKDFYDVIFDLKEGQWSKPFLADQRVYLFSFSSSVNDSVN
                     SDNLIKEDRMLDILYQANNKLVLDYILNKNNFKENFNEAFFSLQDFS"
     gene            39488..40327
                     /locus_tag="BT0_RS00195"
                     /old_locus_tag="BT0040"
     CDS             39488..40327
                     /locus_tag="BT0_RS00195"
                     /old_locus_tag="BT0040"
                     /EC_number="2.1.1.80"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="WP_011772004.1"
                     /db_xref="GI:500095997"
                     /translation="MNNEFNIKINQEEFNRLTKIIYNNFGINLNDKKKLLIESRLSST
                     IRAKNLSNFTEYINYLEKQNNQISLIELVDKISTNHTYFFREPNHFEFLEKKLLPKML
                     KQMAQSREEEIRIWSAGCSSGEEPYTIAMILNEYINNNKIHCKAKILATDISITVLNE
                     AKMGIYSEDRVKTLPNHLKIKYLNKITNDKFEVKDILKKMIQFKKLNLMNAIFPFKKK
                     FDLIFCRNVMIYFDEKTRNKLAEKFTQHLKDDSYLLIGHSEAIRDSKNLEYIMPATYK
                     KIN"
     gene            complement(40375..41046)
                     /locus_tag="BT0_RS00200"
                     /old_locus_tag="BT0042"
     CDS             complement(40375..41046)
                     /locus_tag="BT0_RS00200"
                     /old_locus_tag="BT0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014695953.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PhoU family transcriptional regulator"
                     /protein_id="WP_011772005.1"
                     /db_xref="GI:500095998"
                     /translation="MIRRRLTKQLEVIKDYLWDMKECVLKIIENSLIALESRDKNLAK
                     KIINEDEKMIDDYQYDIEDLCGRIIATEHPVATELREILAIIKIISSLERIADHSTKI
                     VKVVLLLESNVGDFSSVDIYQKPLREMADTAKDMLANIFDAYFDGDFVKILKIVKYDN
                     IIDKLFSKQKTIVIDAMKNNPENLDYLLNILFLNSFLERVGDHVATIGELLYFVKVGE
                     KVNLT"
     gene            complement(41058..42083)
                     /locus_tag="BT0_RS00205"
                     /old_locus_tag="BT0043"
     CDS             complement(41058..42083)
                     /locus_tag="BT0_RS00205"
                     /old_locus_tag="BT0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772006.1"
                     /db_xref="GI:500095999"
                     /translation="MSKECFIYFNFLFFIINIIPSLAFENRYSTYELDFSSEKQEFLV
                     NTNSKFNFFFKDSTWIYIKNVKNNAFIRLVSESYQNGAMFTFQTSKNIGIIILTFKYQ
                     NVKDSREFTKNVILKIAKREESSNLNEMNPKGNLSLDKFIKTDKSNNNLSLRDIMKRA
                     LNLSYINDYKGAIALLNKYDFDDNEYTLLKAELYYKSGDYLNSYLNYLSLRDVYFNKI
                     FLNLIDLGIKLSKVENVLRDVRFLVENNIDFSENTYLDILEFLLMNGEYEFFLNLSLL
                     YYPKYLNSRFPDRYNYLLGKLYETESKYKDFIKSLSYYKRVIDSYPFSSYYELSKLRF
                     LFLKRFF"
     gene            complement(42080..42466)
                     /locus_tag="BT0_RS00210"
                     /old_locus_tag="BT0044"
     CDS             complement(42080..42466)
                     /locus_tag="BT0_RS00210"
                     /old_locus_tag="BT0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421825.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772007.1"
                     /db_xref="GI:500096000"
                     /translation="MREKKFRFQKYFLILILLSIIVSFFTYFYSYRMIEKTRSNTEEH
                     LNQKLKLLNIEDFYFDLNSSLNMDDFFFPKPNLPDGKLGDSVMHHQSISEELLKSLWV
                     KSDNLFNIDLEKENESLVDKILENYK"
     gene            complement(42494..44959)
                     /locus_tag="BT0_RS00215"
                     /old_locus_tag="BT0045"
     CDS             complement(42494..44959)
                     /locus_tag="BT0_RS00215"
                     /old_locus_tag="BT0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772008.1"
                     /db_xref="GI:500096001"
                     /translation="MGVALFLEKIGLLGFKSFVKMQELKLNSSLNFIVGPNGCGKSNL
                     LDAIRFCIGEDNLSVLRVKYITDLISDVKSGESNFAEVTLFFNNEDLSVSDFRDRFYI
                     RRRLYKDGTSEYFLNNDTLNLKSYESLINKLRLKNSPYMFINQGKIEKISSSGSINLK
                     SLIEEASGIDMLRVEEEQAYKRLEKSKENLNSLWTLRDELNEKYEKIKNDFFLKGKYQ
                     KLKMDLEILEKNLRLKKLFNINFELNELKSKLDIKDIDKILSLNSFSIESVKEKLEFY
                     SFREKNVIKNIEVIKKEIETLKSKLLEIEIKIQKLEHDRKGKLNLADIFMSNKVQIES
                     VKVGINEELVDLNNSLQSKKKDFFTVTDEINRYTRSFFELVDLVLSISKESNIEEFEL
                     LKKNILNSLKYFEDTLSIKYIKEIRENLLKYIVKEDKLLNLLKEKIEPIFEQNVDLRK
                     FLLAKNNSKTSLAKEITTIEGLVSNKTAKLNEILGEIEYTELSRLKNEDEIKLIDSNL
                     RFLFETRDELRERLNNLNLKLDELSLERSDINVNLDKFLSEAKGSELVASNEINSLNL
                     LDAFKNSSYYEYMKKQAEYDILFNSSLDIADEIKDFNLVNKNLEKFEFTEDMAKIGAL
                     QKEINMIEHNNYIFFNVEREYNEIKEKVERISSQIDDLNSTKESLNKLRKKIKREIDK
                     RFNDAFNEINNHFVYFFNRMFTGNGSLFYGKDSGEIEIKIDFKDKLAKGNKMLSGGEH
                     SLISIAFLFALYYYSPASFCVLDEIDASLDFENSNKLSVLLKELGQRVQLFIITHNMY
                     VAQGSKNLIGVTSDNGESVIFNI"
     gene            45017..45562
                     /gene="rnhB"
                     /locus_tag="BT0_RS00220"
                     /old_locus_tag="BT0046"
     CDS             45017..45562
                     /gene="rnhB"
                     /locus_tag="BT0_RS00220"
                     /old_locus_tag="BT0046"
                     /EC_number="3.1.26.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772009.1"
                     /note="RNH2; RNase HII; binds manganese; endonuclease
                     which specifically degrades the RNA of RNA-DNA hybrids;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease HII"
                     /protein_id="WP_041178404.1"
                     /db_xref="GI:752506539"
                     /translation="MICGIDEVGRGCIFGPVLSAAVIFKGNPKFLNALDDSKKLNKSK
                     REYLSSLILENSYYAFAEVPNEIIDKINIHHASLLAMQIAYEKLNIECNLVLVDGKFI
                     PKIKAKKIQAIIKGDSIINEIKAASIIAKVQRDKLMDEYDKIYPLYALKKNKGYPTKE
                     HKDAIKKYGISRLHRRSFQLI"
     gene            complement(<45637..45933)
                     /locus_tag="BT0_RS00225"
     CDS             complement(<45637..45933)
                     /locus_tag="BT0_RS00225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772010.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178547.1"
                     /db_xref="GI:752506682"
                     /translation="MGERGEVYSDKLFTNSDRTYFFNVKENRKGDYFLNIVESKRNVN
                     GDFERHSVFVYEENIEEFESNLLRAISVVKKKISKNSVTRGDYHNDFDRHRERSK"
     gene            46089..46161
                     /locus_tag="BT0_RS00230"
                     /old_locus_tag="BTT0001"
     tRNA            46089..46161
                     /locus_tag="BT0_RS00230"
                     /old_locus_tag="BTT0001"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:46123..46125,aa:Gly,seq:tcc)
     gene            46726..47412
                     /locus_tag="BT0_RS00235"
                     /old_locus_tag="BT0050"
     CDS             46726..47412
                     /locus_tag="BT0_RS00235"
                     /old_locus_tag="BT0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772011.1"
                     /db_xref="GI:500096004"
                     /translation="MNNEILWFIMLICTYSSLIIIYKLFGKKGLFAWVTSSVIIANIQ
                     VLKQITIFGFNATLGNIIYASSYVATDILSEFYGRKISKKAVYIGFISFIAFAFITNI
                     QLYFSTSSSDIYLKSLESIFSSIPILLVASIIAYIISQLNDIYLYQFIKDKFPKFLFI
                     RSNGSTLVSELIDTIIFVSIATYFNIFPKEAYLDIVISTYFIKGFAGILGTPFIYIAK
                     CVYQNKKNSI"
     gene            47464..48147
                     /locus_tag="BT0_RS00240"
                     /old_locus_tag="BT0051"
     CDS             47464..48147
                     /locus_tag="BT0_RS00240"
                     /old_locus_tag="BT0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_011772012.1"
                     /db_xref="GI:500096005"
                     /translation="MMDMILWMTLLVFVYLQLTLLYYLFGKSGLFCFNIIMTILSNLI
                     ILKKVFIFEQQISLAGIIFLSILCSLNLITEKYNDKLAIESTTLNMFIHITFVIMIHF
                     TLYFQQNEFDTSNIHLKVLFNNASYTAIIFTGTYIIYLCNYVNIKIYSILQKNNISNK
                     LINHNLSRLCSACIAYILANISMHVIAQLYPGNNINMVESSWIFTITIMIIDTFIYYF
                     LNALKVRKA"
     gene            complement(48134..48790)
                     /locus_tag="BT0_RS00245"
                     /old_locus_tag="BT0052"
     CDS             complement(48134..48790)
                     /locus_tag="BT0_RS00245"
                     /old_locus_tag="BT0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772013.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_041178548.1"
                     /db_xref="GI:752506683"
                     /translation="MSNEILKRIEILSEFITQRRRERIDEVLSNRTNYLTLVLEDIFQ
                     PQNASATMRTIEILGLSNIHIIETNNTYTLNPGVVLGASKWIDIIKYQCVESAFDNLK
                     GNGYKIVATSLDNEAIFLDDFPIDDKMAIFFGTELTGLSNTVLENADLHLKIPMYGFT
                     QSYNLSVAVSIVFYSLISRLRKSSIKYLLNEDEKLVLKLDYYRKIVKKYQTIEKLKLF
                     "
     gene            48870..49541
                     /locus_tag="BT0_RS00250"
                     /old_locus_tag="BT0053"
     CDS             48870..49541
                     /locus_tag="BT0_RS00250"
                     /old_locus_tag="BT0053"
                     /EC_number="3.2.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYK3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-DNA glycosylase"
                     /protein_id="WP_011772014.1"
                     /db_xref="GI:500096007"
                     /translation="MEVKIEESWKEMLKGEFCKSYFKRLVNFIKNEYKTKKDKIFPSP
                     KLIFNAFDSLPFKDIKIVILGQDPYHGKGQANGLAFSVNSDIKIPPSLQNIFKEIERS
                     LKIKTIPNGDLTRWATQGVFLLNSILTVEEGRPSSHKDIGWEIFTNEVIKIISKNLNN
                     VVFMLWGNFARGKKELIDASKHLILETSHPSPYSAHNGFLGSNHFSQTLKYLKEHNKI
                     SIDFQ"
     gene            complement(49605..49967)
                     /locus_tag="BT0_RS00255"
                     /old_locus_tag="BT0054"
     CDS             complement(49605..49967)
                     /locus_tag="BT0_RS00255"
                     /old_locus_tag="BT0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecG"
                     /protein_id="WP_011772015.1"
                     /db_xref="GI:500096008"
                     /translation="MELFRLLIFVFFIITSFMIVLLVLFQDEQGDSIGGVFGGGSSSI
                     FGAKSSNIAIRITAFFITLFFIFVIALSFINTRRVDNSLLKDVKTNEKSSTFWNDDTN
                     QNEENEDVVNEDTLKKEK"
     gene            complement(49979..50743)
                     /gene="tpiA"
                     /locus_tag="BT0_RS00260"
                     /old_locus_tag="BT0055"
     CDS             complement(49979..50743)
                     /gene="tpiA"
                     /locus_tag="BT0_RS00260"
                     /old_locus_tag="BT0055"
                     /EC_number="5.3.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772016.1"
                     /note="Reversibly isomerizes the ketone sugar
                     dihydroxyacetone phosphate to the aldehyde sugar
                     glyceraldehyde-3-phosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="triosephosphate isomerase"
                     /protein_id="WP_011772016.1"
                     /db_xref="GI:500096009"
                     /translation="MRKIFLAGNWKMHYTSMEAAGVAKQIVDGVKNIKDDVVVMITPP
                     FTSLCKVCEVTRGSNVLLGAQNMSYEDSGARTSEISPSMLLEFGVDYVILGHSECRTY
                     LGDTDEVVNKKVLAGLKHPFKYLILCIGETLEERENNKTLDVVLNQIRKGLISVSESD
                     LKRIILAYEPVWAIGTGKTATKEEAQEVHRAIRHEVELLYSVSAANNIIIQYGGSVNI
                     DNVKGLMGESDIDGALIGGASLKADSFLNIVNKVAK"
     gene            complement(50745..51923)
                     /gene="pgk"
                     /locus_tag="BT0_RS00265"
                     /old_locus_tag="BT0056"
     CDS             complement(50745..51923)
                     /gene="pgk"
                     /locus_tag="BT0_RS00265"
                     /old_locus_tag="BT0056"
                     /EC_number="2.7.2.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYK6.1"
                     /note="Converts 3-phospho-D-glycerate to
                     3-phospho-D-glyceroyl phosphate during the glycolysis
                     pathway; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycerate kinase"
                     /protein_id="WP_011772017.1"
                     /db_xref="GI:500096010"
                     /translation="MSIKTIKDCDFAGKRALVRCDFNVPLKEGNITDDTRIRAALPTI
                     EYLKSQGARVILMSHLGRPKGEKNLKYSLMPVAKRLSELLGQDVKMLPDCIGDEVATT
                     VSCMKNGDIVLLENLRFYKEEEENCDAFVRKLSQNGDIFVNDAFGTAHRAHASTAGLA
                     AYLPAVGGFLMEKEDEFLGKILRNPESPFVAIIGGSKVSSKIAVLESLLPKSNVMVIG
                     GGMAYTFLKVEGYSIGQSLLENEYIDVASSFLKKAKELDVKVILPLDHVVASEFREDS
                     IPEYVDSVDIPNDKVGMDIGEKTLRKIEEVLVSAKTVIWNGPLGVFEFNSFSKGTAKV
                     AEYVASCSGITVVGGGDSVAAVNKFNLSEKITHVSTGGGASLEYLEGKVLPGIKVLEK
                     "
     gene            complement(51952..52959)
                     /locus_tag="BT0_RS00270"
                     /old_locus_tag="BT0057"
     CDS             complement(51952..52959)
                     /locus_tag="BT0_RS00270"
                     /old_locus_tag="BT0057"
                     /EC_number="1.2.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421836.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glyceraldehyde-3-phosphate dehydrogenase"
                     /protein_id="WP_011772018.1"
                     /db_xref="GI:500096011"
                     /translation="MKLAINGFGRIGRNVFKIAFERGIEVIAINDLTDPKTLAHLLKY
                     DSTFGIYNKKVEARDGAIIVDGKEIKIIAERDPKNLPWGKLGVDVVIESTGVFSSATS
                     DRGGYLDHVEHAGAKKVILTVPAKDEIKTIVLGVNDHEITSDLKAVSNASCTTNCLAP
                     LAKVLHETFGIEQGLMTTVHAYTNDQKILDLPHADLRRARAAALSIIPTSTGAAKAVG
                     LVLPELKGKLNGTSMRVPVPTGSIVDFTVQLKKKDVTKEEINSALKKASESRELSGIL
                     GYTEDPIVSSDIKGNSHSSIVDGLETMVLLNGFVKVLSWYDNEFGYSTRVVDLAQKLV
                     K"
     gene            complement(53033..55018)
                     /locus_tag="BT0_RS00275"
                     /old_locus_tag="BT0058"
     CDS             complement(53033..55018)
                     /locus_tag="BT0_RS00275"
                     /old_locus_tag="BT0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772019.1"
                     /db_xref="GI:500096012"
                     /translation="MNLKRFLTMLLIFNLNFGSLIGDTTTAIKYYQKAQTYYLMQKYY
                     DAIDELLEAVKINPNYYEAYKFIAEIYYLLKIYNQAQFFIEKAYKMSNGDTKYKILYA
                     NILLKNNRTAQAKKFYSEVLAKQKNNIDALVGLASIFEEEGLLIAAANYYLSILEYNQ
                     TNYNAFERLMSIYEKLNMNDKAQHLINKVRGNFTSLPDFHKRVAEFSIKTNSLGVAEK
                     YAQNYLMLVRTTYRDFGLVDAYRLLALVYLYQSKYEDATDFLQKAILVDQNSDELYYL
                     LGYSYLKLERVDKAVLNFERAKSMKKDLEFYDIALEESFFVSNFRSSFQKNNGTNIGI
                     SKRYENEGLKAFKNLNLDRAVFNVRNAIDIYPDNDSARFLLAKIYKFMKLDVMAYEEL
                     YYLIEHRKVTDTKILDFYDVVAFDIRSSLFFKYGYKTIGDLNRLYNNQTVYRVGIFTQ
                     NENKVFGANDLILKYAERILDRNLNIEVVNYRFDYNKDKDYLVSSFSEEFSYARNNNL
                     DLFLMFDLDVDVFKNSANLRVDIFSGKTGVKVKTFDYNSGGVLYLSDILSSFSRDFND
                     YLPKKGEILQIKRDDVLINLGHVNDVKKGDVFLVLKEGALKYNSDSSSFMSYSKSDIL
                     GEISIEEIGDYISRGILKAPTLLRDYIQEGYTVFIKK"
     gene            complement(55015..55791)
                     /locus_tag="BT0_RS00280"
                     /old_locus_tag="BT0059"
     CDS             complement(55015..55791)
                     /locus_tag="BT0_RS00280"
                     /old_locus_tag="BT0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_041178405.1"
                     /db_xref="GI:752506540"
                     /translation="MFKFLSFKNKKIRDDDCKNIEEKSKFETSLLKNFNSLKETIVKE
                     IMIPRISVVFVDYSWSKDEILKVVTSSNHSRFPVYRETIDDIIGIIHTKDILLHMWKR
                     DFYEIDLRDIMRKVMFVPESKKIDSLLKEFQENHVHIAIVVDEYGGVAGLVTLEDILE
                     EIVGDIQDEFDNELDEIVPLDDGSYLCTARVLIEDLNEKLGLSLPDGDFDTLGGFVYD
                     LFGRIPLKNEKIKYNNLTFTIKNMHQRNIKVIKISQKEGL"
     gene            complement(55791..56237)
                     /locus_tag="BT0_RS00285"
                     /old_locus_tag="BT0060"
     CDS             complement(55791..56237)
                     /locus_tag="BT0_RS00285"
                     /old_locus_tag="BT0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S1P5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA maturation RNase YbeY"
                     /protein_id="WP_011772021.1"
                     /db_xref="GI:500096014"
                     /translation="MIKEELNLWAEGVEFKHWDAYYNFILSVLDFLCIKEYELSVILC
                     NNEYIQKLNSQFRQKSEPTDVLSFNYLEESGQIDHKIQGDLIISLEYLEFSSLEFNVE
                     LYDELQRNTIHGILHLIGYTHKTNDFQNEEMLIIQEKVLRETRRVF"
     gene            complement(56326..56679)
                     /locus_tag="BT0_RS00290"
                     /old_locus_tag="BT0061"
     CDS             complement(56326..56679)
                     /locus_tag="BT0_RS00290"
                     /old_locus_tag="BT0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421840.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_011772022.1"
                     /db_xref="GI:500096015"
                     /translation="MAISLTKQEFIDKVFDYKNNKEWDFKGKKPAIIDFYADWCGPCK
                     MLAPIYDELSKEYGDRIDFYKVNTDKEQEISMALGVQSLPTIIFVPVGEKPRVSVGFI
                     QKDSFEDAIKDLFKV"
     gene            56753..57475
                     /locus_tag="BT0_RS00295"
                     /old_locus_tag="BT0062"
     CDS             56753..57475
                     /locus_tag="BT0_RS00295"
                     /old_locus_tag="BT0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011772023.1"
                     /db_xref="GI:500096016"
                     /translation="MNLILINPDELKNGLILNDSRVKHINEILKLKNNETFKFGIIGE
                     EHIYSCVYQKDVKLFFRKNHKIAKSNKLKKLKVIIGLVRPIAAKRIITHLGSMGISEL
                     IFFNALLSEKSYSCSKLFKEREYEKYLIEGAMQGGITYIPKVNILNNLREVLKNTEYE
                     GSNTTKILLERESKNKLVDLNIKTKNTVVIIGPERGFITKEINLIKEYNFNAYNISSN
                     ILRTETATIVASAIITSKMNSK"
     gene            complement(57596..58585)
                     /locus_tag="BT0_RS00300"
                     /old_locus_tag="BT0063"
     CDS             complement(57596..58585)
                     /locus_tag="BT0_RS00300"
                     /old_locus_tag="BT0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178549.1"
                     /db_xref="GI:752506684"
                     /translation="MCEYNENFDSKVLTLPKHVAKGLILTIFGSLIISCAIFFIFLKS
                     NDIVVVPNLSELYLEDAITELQNKELIPYVELKFSSTSLDKGKVIDQNPKAGTVLRLD
                     SKVKIFISKGAVINKVDSFIGKNIDDVLINLKANSINNNRMFYHLLKPIEIESTLPKG
                     TIIRQEPSPGTKISSLVDLQFLVSKGQGDPPVKYVKNYIGLYYKDAIISLLNDEIDFD
                     VNLSSGNDFGSVIFQSLSPGSKIENLDKLTITINEPRSNDTGVFGFLTYKLDMYPSSV
                     DIMVKIKDPNGSSSLLYSFRSKGGLIKLPYEALKGSIIELYIYDRLVNQTVVN"
     gene            complement(58673..59602)
                     /locus_tag="BT0_RS00305"
                     /old_locus_tag="BT0064"
     CDS             complement(58673..59602)
                     /locus_tag="BT0_RS00305"
                     /old_locus_tag="BT0064"
                     /EC_number="2.1.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYL4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase"
                     /protein_id="WP_011772025.1"
                     /db_xref="GI:500096018"
                     /translation="MRIFFASSDSIALEVLRKVSDHYNVVGVLTAPDKPSGRGLFLKV
                     NDIKVEAINRNITVLDPVVLNSDVIGMVKKLKPDLMLVFSYGKIFRQEFLDIFPMGCI
                     NVHPSLLPKYRGPSPIQTAILNGDTIGGITVQKMALEMDSGNILAQSQFEIKSFNTSA
                     DIFRYVSLNSFNLVLEALSKLNKGHIGIVQDSNQATYCSFFNKQHRMLNFNLSAFEIK
                     NKINACNPWPLARAKLDKDEIIFHRADFIKTTDYSDQAIGKIVSFDPSKGILVKTEDG
                     ILLLLELQRSGRKVVDYKSFYNGNRDLIGKIFS"
     gene            complement(59599..60096)
                     /locus_tag="BT0_RS00310"
                     /old_locus_tag="BT0065"
     CDS             complement(59599..60096)
                     /locus_tag="BT0_RS00310"
                     /old_locus_tag="BT0065"
                     /EC_number="3.5.1.88"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide deformylase"
                     /protein_id="WP_011772026.1"
                     /db_xref="GI:500096019"
                     /translation="MKIVCYPNDLLRIKTKTVLNIDNELRNTAFKMVNLMDAKNGVGL
                     AASQVGLDLSIFVVRENAMSKPLIFINPLITETSFELVLYKEGCLSIPGVYYDLLRPK
                     SIIVEAYDENGEFFKIESSGLLARIVQHEMDHLKGVLFIDYYEDKLRNNLLRSYMKKR
                     RFVKT"
     gene            complement(60120..60809)
                     /locus_tag="BT0_RS00315"
                     /old_locus_tag="BT0066"
     CDS             complement(60120..60809)
                     /locus_tag="BT0_RS00315"
                     /old_locus_tag="BT0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772027.1"
                     /db_xref="GI:500096020"
                     /translation="MRFVSLFVIFIVFCFVHLFSLSSDIIFHDSYKDAMDEARSLHKN
                     VLILVGKDIKGNLIRDFLKSFEDDNLLKAIAKNNVFLIIDVNNEIFGEINLKKSPTLF
                     FVDSQSEQIKAAYVGSIRDTVQCNQEFLNYALGVSKLDDIIHKKNNYEINTLDDKVFF
                     YKTLDGHWRLRMNGQDKKLLPSKIELKEFLVFKDENEGKLYAFPKSRKGSIYFSEAEN
                     EEWKLFGQIKL"
     gene            complement(60806..62584)
                     /locus_tag="BT0_RS00320"
                     /old_locus_tag="BT0067"
     CDS             complement(60806..62584)
                     /locus_tag="BT0_RS00320"
                     /old_locus_tag="BT0067"
                     /EC_number="3.4.11.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M24"
                     /protein_id="WP_011772028.1"
                     /db_xref="GI:500096021"
                     /translation="MEISTKIFSLRNLMMKSEIDAYLIASYDPHMSEYSHVRFNVREF
                     ITGFTGSAGTVIVTETEAVLFTDGRYFLQASSELKGTEFKLMKLGVKGYPDIFGYINA
                     NLKGLRLGIYSEDVNIKFYNDLVQNCRYTDIEILHEDLVSKIWQDRPGLESNKIFELS
                     GAQKIDKRTDKLDKVNAKLEEKAIDFCIISSLDEIAWLLNLRGLDVESSALFYAFLFI
                     ARSERYKNVLFVNIDKLDSELSERFEAEGFEIEDYSNFYSFLAEINHEGKFFIPVESN
                     VKILESIGKPNAILGESIVNELKAIKSDYEISKMKEAHIIDAVSLIKFLYKFKSLNKD
                     ELSKLDEVDVANMLLNFRTARDEFFSSSFNSIVGFKENAALPHYRPTKGAKNLDGNGL
                     LLIDSGGSYLELGTTDVTRTILIGEASCKEREDYTLVLKSFIALASLKFPFGTLGSSL
                     DGIARFPLLKQGLNFAHGTGHGVGFFLNVHELPVSISPLSSYSFKGSEIASIEPGLYR
                     DSEYGIRTENLVFVKQSYSNEFGTFLEFENLTLVPFEKELIVTEMLSKDELDYINSYH
                     EFIYSSLKEYLSGDELKFLEILTNKI"
     gene            62706..63596
                     /locus_tag="BT0_RS00325"
                     /old_locus_tag="BT0068"
     CDS             62706..63596
                     /locus_tag="BT0_RS00325"
                     /old_locus_tag="BT0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_011772029.1"
                     /db_xref="GI:500096022"
                     /translation="MKDIKAVISDLDGTLLLSNSQIGAFSEIVIKKLTKENKKFIIAT
                     GRSKNEIISLTEHLNSHVSFFITLNGARVYNNQWQLISSYDLSSEIVNEILNLRENKY
                     KDIPHFLQKSEDIDEKLYADNTTKNAINNIFEKHELLRKHKYIEHELKDISIKYHEVN
                     SFREIKNFNNIAKILLLHDEEPQLIKYEATILEKYRKEINAYLSTPHSLEIVNNRVSK
                     GSALKDVLKSIHINLNEAIAFGDGFNDVDMLENVNKGLLMGNANYRLKKMLSYLEIIG
                     TNDNEAVAHYINDNILEEPV"
     gene            63610..64848
                     /locus_tag="BT0_RS00330"
                     /old_locus_tag="BT0069"
     CDS             63610..64848
                     /locus_tag="BT0_RS00330"
                     /old_locus_tag="BT0069"
                     /EC_number="3.4.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_011772030.1"
                     /db_xref="GI:500096023"
                     /translation="MKTDLIKYAELIILKGINLQKNQCVLITGSIENYEFLKILAQKA
                     YEYGAKYVELNIEDTDILKTRLKSSPEDLLEFIPDFKHKFFEEMINEKWAKIRIDNTE
                     NLDTLKDNDSKKISKYFKALNIASRKVSSAIMNNELAWCIICAPGPKWAAKVLNKPES
                     QKTLEEFFKIQKKIMLLDSKDPIKAWEDHGKKLHQRCKILNKLKLEKIIFKNQKTNLE
                     IYLLESSIWTGGSEKIRGTNIEFNANMPTEEVYTTPNYKKTNGIMYVTRPVTVLGNLI
                     TGIWLEFREGKVINFGCDNEQSRNILKRHMETDMQAQYIGEVALVDCNSPIYQSGLTF
                     CNILYDENASCHIALGNAYPSCLSNGQELKTDAEKLDYGCNVSLIHTDFMIGSNDINV
                     IGIDKSRKEHTIIQNGQFVI"
     gene            64866..65333
                     /locus_tag="BT0_RS00335"
                     /old_locus_tag="BT0070"
     CDS             64866..65333
                     /locus_tag="BT0_RS00335"
                     /old_locus_tag="BT0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772031.1"
                     /db_xref="GI:500096024"
                     /translation="MIKELFTNDLFLSCFVSGIVAQMIKYIIQAMKTKKFKTNPKYLL
                     KSIFLETGGMPSSHSSTVTALATSILITEGIDTNFIIALAFALITIRDSFGVRYMAGV
                     QAEYLNALSEQLKMKIKIEPLKIKVVKGHKKKEVFTGILIGIISAWVICNRII"
     gene            65356..66825
                     /locus_tag="BT0_RS00340"
                     /old_locus_tag="BT0071"
     CDS             65356..66825
                     /locus_tag="BT0_RS00340"
                     /old_locus_tag="BT0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772032.1"
                     /db_xref="GI:500096025"
                     /translation="MKLPKFLNILLILLLISCNMAKFGDYKPIYFKGEEDLKTANDYI
                     NSLGYKTISEYTTKVNILDFPDFKEITINKLIHLNDYDLRKDLFLKKLPNLFNIEKKK
                     ILYVESAFTSSDLRKLKQDQKIEAEMHSLNYKTKIKYFSSITFITIIILLLLLNIKYA
                     PFIILFLISSCTIFIFSDEILYFYPLTILSYLLFTLIDNFNKNYNKIYLRDISFTVLI
                     KKIKIPIFLFLFIVFYFIVIINFLTTNLEALLIIFVSISTLCIFLIFTWIKTESNLKH
                     TFLSLIEIKEQKRETKILKFKILIHIMLFIASLMPFFYAQNILNAYNNFNYLYSKKLN
                     YFDYLNPNNIYLMVGHNEEIPNIVGYMYHIFYQNELKYKITSQYGKVNTHVKEDYFEI
                     ENNKITINQKTVYKVDKEFISKNLNKELPKLFLDNGNPILIYKETPANIAINKDNFTI
                     LFSLSLPFFLLLFLFKAIRFTILLNMSEKSYRKYIRGNI"
     gene            66825..69128
                     /locus_tag="BT0_RS00345"
                     /old_locus_tag="BT0072"
     CDS             66825..69128
                     /locus_tag="BT0_RS00345"
                     /old_locus_tag="BT0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178406.1"
                     /db_xref="GI:752506541"
                     /translation="MSNSKTLKIKKQYKVNIDEIQMPECVLIPLETENAKSTIYIIEN
                     QRITEGQILSKNKNAELYTYSPISGTIEKIYTANLPGEHQLKSALIRFHGRIKNEQEL
                     SVEEESREKTLEKLIRLGIPWFNEHSLFQYVSKCKKIDKMLFLINGKDPFTNISEILI
                     KEKLDEIIYGFETIDKIFKFKEILIVLSNYHLKKELEHLNIFQDKRLTIKLIPNTSYP
                     YSNHEVIMHFLYNEESIKNNINPNKNILLANVEDLYNVYSTLKTNSPYKEKFITINGN
                     KKIQSKIIKVKIGTSIQQIINEDIDTKKYDIFINNPANKIKINNLNIPITRDIYSITI
                     LKKESILSKIKLLKTPSFSPRYMEEIILSKIKGKNNISNTQLQYLQYTETETEDEINK
                     VKKEIKEKILNLSLNNEPIYTENNLKDIYLTIILALIPSLIFSFTNNIKFLIDTLILT
                     MISLCSYITIMLKSKHKYLSFFIYTSLIINIILPLNFSIILKIISLLFTFLVFFYFSK
                     LSKFLVNPILISFMFLLLNFPSSFKHTYSKKLSEQEDIIPTWNKIMQQSSNIQNLESL
                     KEFKRYENKHIDMIEKFINDNILSNINIMIPRFHIENLLGLQNEKYLSPILIYIGFSF
                     ILGKFIINKLIPLSFYISLLLIAYILKNLGLYSHISFDMLTLIMSPIPMILVFTMSTE
                     LQIAPPFKFEQILYGITLSLVYFITLSYIPLETLAAVISIFILQISSTLIKRYSLTFQ
                     IKKILHHLSINQAKTIKYKNDNGEEII"
     gene            69717..70778
                     /locus_tag="BT0_RS00350"
                     /old_locus_tag="BT0074"
     CDS             69717..70778
                     /locus_tag="BT0_RS00350"
                     /old_locus_tag="BT0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772035.1"
                     /note="RF-2; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 2"
                     /protein_id="WP_011772035.1"
                     /db_xref="GI:500096028"
                     /translation="MNFWNKLKMSGGSFDSNKIKVKLKEYEKQINDENFWNDNKKAQE
                     ILKNQNILKAKIEPWEDLICKLKDLRELCEIAESEEDTALLDQDINKLREQYKHLLTL
                     SYFKEDIDINNAFLTIHSGAGGTEACDWVSMLYRIYLRYSERHGYKTELIDLLEAEGG
                     IKSVTIEIKGEYAYGFLKSEVGIHRLVRISPFDAAKKRHTSFASVFIDPVIDDKIEIT
                     IKPEDIRVDTYRASGAGGQHVNKTSSAVRITHLQTGIVTQSQTDRSQHRNKDLAMRVL
                     KSKLYEHYKILEQQKSKSKQEEKKDISWGNQIRSYIFQPYTLVKDHRTKFENPNIISV
                     MDGNIDNFIEEYLKWKNLS"
     gene            70760..72166
                     /locus_tag="BT0_RS00355"
                     /old_locus_tag="BT0075"
     CDS             70760..72166
                     /locus_tag="BT0_RS00355"
                     /old_locus_tag="BT0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772036.1"
                     /db_xref="GI:500096029"
                     /translation="MEKSKLIIILFLILTLKLAYPQSNIEYGFSYIINTQDENKNLQE
                     GIEQTLDKIYKTINEHIVNNNDKDFIRRIYINQNIVNKEQEISKLKEDMDKKKLQNAI
                     SSREENKIEIKINELKKDIENIKIKQKEFEEYLINLKKMKTKYIKHKEKIHPSNLNTE
                     FLISQELFFINYIHLKKIEKYYLVEISNITPQGVKVKKEIFHLSSSVDDIANKIAELS
                     FEEILGREFIKIKINVINNLDAKIYINEQFVSKGIYNNDIWDISKLPNKEIIINIIST
                     TYKPHTVKQKVKSGDTINLNINLQKANYRKIPITSNVTSKVFKKGIFIGETPIEIEEP
                     EGIESILLQAKGYKNMFKMISKEDKEINIEMLKDNKSELIIKRDQFYINLGIFTLSLI
                     GTAFAITKYNESSELYNIALKNIIKRKITPQDLYNVKSEQMITTFLLGTGITLSVGSF
                     IPLIIHLVKYIQEASRGE"
     gene            72217..73062
                     /locus_tag="BT0_RS00360"
                     /old_locus_tag="BT0076"
     CDS             72217..73062
                     /locus_tag="BT0_RS00360"
                     /old_locus_tag="BT0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsY"
                     /protein_id="WP_041178550.1"
                     /db_xref="GI:752506685"
                     /translation="MGIFDKIKNLFKNKEKTQIFEKLEDILLEADIKNDIVIEIIENI
                     KKLKVKDEEETFLKLKDFLKSYINQQSLNLENKRLNILLIIGVNGVGKTSSIIKLANK
                     FKNEGKNVLIAAADTFRAAAIEQIKIQSEKIGIKVISQNQGSDAAAVIFDSISSAKTK
                     NYDILIIDTAGRLQNKENLIKELQKMDNVIKKQMIKTDVNYKKILVIDSIAGKNINNQ
                     TEIFNKAIEIDGIIATKFDSSSRAGGIINISKLFKKPIYFFTFGEQVEHIKEFNTDDY
                     LNKLL"
     gene            73059..74093
                     /locus_tag="BT0_RS00365"
                     /old_locus_tag="BT0077"
     CDS             73059..74093
                     /locus_tag="BT0_RS00365"
                     /old_locus_tag="BT0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772038.1"
                     /db_xref="GI:500096031"
                     /translation="MTTKIVILFLIFIIPSTYGQNYFISDVFFNKYQEIYEIPQTGFY
                     IEYMKINEIEKFSLFKDLQLIKYKTQKTIKDDKKKLTFYNEKDIKTKEEIYDNLNNKI
                     QEIKYSPKGIILESVNYFYKNNDLIYKEIKILNQKPKTLHYMKDSNGKLLKITGSDFQ
                     VWNYGINGEIKSTYFDIKKSKTKVIQYDDQKRHLESIILDNNKIKSREKNQYLDDNEV
                     INTEEKEEGNIKIISKYKGPNLIKKEIYKNNEITEISDFEYNESGNVIVENVIVKENK
                     KEHNTKTKYEYNSDNRLTSKTIYENNLILLKTDYFNDHEYEQEIYYDGNPIFKVRYKN
                     DEIIEEIKRY"
     gene            74105..75352
                     /locus_tag="BT0_RS00370"
                     /old_locus_tag="BT0078"
     CDS             74105..75352
                     /locus_tag="BT0_RS00370"
                     /old_locus_tag="BT0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsX"
                     /protein_id="WP_011772039.1"
                     /db_xref="GI:500096032"
                     /translation="MGLNKFLLKRLILDEQNSLSLTIVIILSIVLGQIIIIITISIMN
                     GFQNDFFTSISTLESGNLKIESQLNDQELNALKEIKEIIQINKIYETQGIGIENYYYP
                     SILNIIALDTKDIIEDKNFILLTGLTQSELQLNDDEIIIGDVLSYNLGLLEGDIIGLI
                     LSDEIKNLQTLKNEIKYFKIKAIFKSNYAKINESTIFMNINYFYKKQIIKDSDIKYQI
                     KTQNLYPSKSLINKIKNINPNIQFKPWNEYNKEFYKALKIERNTMLIILTSIFLVIAV
                     NTYYLQKRIIINKSKSISIILSLGLKSQKIRKIFLIHSVIICILGGIIGLITGIIISS
                     NINEILNVIDILINSLINTINYILKLKLENIEIKIVKNTITPKIFLSDLMFTLFFACL
                     FTICSSLKVTKKIKYVDKINGAS"
     gene            75353..76033
                     /locus_tag="BT0_RS00375"
                     /old_locus_tag="BT0080"
     CDS             75353..76033
                     /locus_tag="BT0_RS00375"
                     /old_locus_tag="BT0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011772040.1"
                     /db_xref="GI:500096033"
                     /translation="MKNIICITEIHKTYTKNKTKIKVLENLNLNVKDGDFISIQGKSG
                     CGKSTLFNIISGIDKMDSGDIISCGISLKDANEKTLSLYKNKKIGLVFQNHNLIDEFS
                     VFENIILPKIIEGKDNLETINRKALRLMKILEIDKRGDHYPSELSGGEAQRAAIARAL
                     INEPNIILCDEPTGNLDINTAKTVESLLINTAKTFHKTLILVSHNPEFSNKADIKYEF
                     KEKTLKRI"
     gene            76030..77280
                     /locus_tag="BT0_RS00380"
                     /old_locus_tag="BT0081"
     CDS             76030..77280
                     /locus_tag="BT0_RS00380"
                     /old_locus_tag="BT0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011772041.1"
                     /db_xref="GI:500096034"
                     /translation="MMRPNIKELTKIAYIIFINSKNKKALIGSGMSLSLVMIPLIIVY
                     YMSNNIMNSTIEKYIENEGFSVQIEYNEIQKDTYLKSKLEKLKKEYQHDELRYFFERR
                     TYGIIGNNKKQGVLIRAVENKFIDENKHIKLIDGKKSFNKNEILISKQIKDRLNLNIN
                     ESIYIVVPNNKHQKIFPKAKKFNISGIIETGLREIDKNLVLISLQDSNIMSEEFSKSI
                     IGISIKPNTKEKTDNLKKNIKKEFQEYKIKTFYELYLNKYTNLDISKKLLIFIMAFIV
                     IFASINISSSLCMLILENKKKIAIFKSIGMNNSSLKLIFILIALVLSSISCIIGIIIG
                     NYITINIEHLINIIDIIINTILKIFGTDNTELLNSDYYISEFNIKISYKFSLIILLSY
                     TLISITTTLIPLNIISKFKEKEIL"
     gene            complement(77310..78593)
                     /locus_tag="BT0_RS00385"
                     /old_locus_tag="BT0082"
     CDS             complement(77310..78593)
                     /locus_tag="BT0_RS00385"
                     /old_locus_tag="BT0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772042.1"
                     /db_xref="GI:500096035"
                     /translation="MSKTSEERIKIYLSKLSKYKNKILKENSIKDIIERADISDADIE
                     NIEMRFSKIYDRARRLEEMGELSDSLRELETIYLYSLHNKSIFASFFNFYKRLIKRID
                     SKNLNKKLIHVSLQAREFGIVSGINLKDYDEAERLKHRVLILLLSFVLIAIIAFITYT
                     IMHSFIGGYEKLDEVKDVHRTTFQGLPSVTRASDLVVESVNLAAGPYVLYHVEVEDAK
                     VLVFEDAHAYQLKAGVVSAKDPIKRIYYGVTVYDDLGRPILNKVFEKTSDFPNKWSKG
                     VYAPIDFIYSISKEINGHPKKMVLDIRLVEFFSEVDNLSSVNLETSSSILNFKYLGSY
                     FNESFGIYEANSLIEVYNDSKDNIKDLEIEVTYVSKDSQIIRSLQRKLISESNSFLKP
                     YSRQSFSLKTIFPKEIYPNIKEELSSIKIVNVFVR"
     gene            complement(78586..78903)
                     /locus_tag="BT0_RS00390"
                     /old_locus_tag="BT0083"
     CDS             complement(78586..78903)
                     /locus_tag="BT0_RS00390"
                     /old_locus_tag="BT0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772043.1"
                     /db_xref="GI:500096036"
                     /translation="MKEIIYRFEKAEDYKLVPINNIYGSVTNTGEIFCDLVFESTEIP
                     EEIVYTKTKEGVLEEISGEFKGSKEKIILINSFVGISITKDTAKNIAYWLLKKVDELE
                     DNE"
     gene            79100..80368
                     /locus_tag="BT0_RS00395"
                     /old_locus_tag="BT0084"
     CDS             79100..80368
                     /locus_tag="BT0_RS00395"
                     /old_locus_tag="BT0084"
                     /EC_number="4.4.1.-"
                     /EC_number="4.4.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine desulfurase"
                     /protein_id="WP_011772044.1"
                     /db_xref="GI:500096037"
                     /translation="MDLNLIKDTNETVKILRKDFPILNKTINDKKIIYFDNAATSQKP
                     QSVISSIVEYYTNYNANVYRSGHELAIQSSLKVAKVRKIVKNFINAESCKNIIFNSGT
                     TDGINTVVNSLLFSKLLKKNDEIITTTLEHNSNLLPWINIAKFLKLKIKLAKFNEMGI
                     IQPEQIKNLITNKTRIIAISSINNILGTIQDLETIGKLARDNKIILFIDAAQMAPHMN
                     IDVKKIDCDFLVFSGHKMLAPTGIGVLYISDKIIDKLNSSKLGGNTIEDIFMKNGELN
                     FKTLEPPNKFESGTPNIAGIIGLGKAIEYINNVSMEFIQEHDRALIEYCVAKLKEIDE
                     VEFILNKDIKRKSIISFTVKDIHSHDIETYLDTMGIAIRSGKTCAYLAFFSENIKKDH
                     LLRISFYLYNTKEEIDTFISCLKSTIKAFY"
     gene            80539..80943
                     /locus_tag="BT0_RS00400"
                     /old_locus_tag="BT0085"
     CDS             80539..80943
                     /locus_tag="BT0_RS00400"
                     /old_locus_tag="BT0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772045.1"
                     /db_xref="GI:500096038"
                     /translation="MFSEETKKELIRFSKIKKYYFKTDKNQSSVYHQSKCGDQITFKI
                     NESNKKIRLKYNAYGCIIFLSSAYILTKLCDNKPRKEILEIITKTINKNFENLEEIDK
                     SLKNFENFLYTNRKDCFMLPYKALKEILNTIK"
     gene            80966..82495
                     /locus_tag="BT0_RS00405"
                     /old_locus_tag="BT0086"
     CDS             80966..82495
                     /locus_tag="BT0_RS00405"
                     /old_locus_tag="BT0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mg chelatase"
                     /protein_id="WP_011772046.1"
                     /db_xref="GI:500096039"
                     /translation="MKIYSHSSIGYEGELIEIEVDIRKGISGIDIVGLAGSEIKESRE
                     RVKSAIKNSEFTFPKDRILINLAPAGIKKIGTAIDLSIATSIITIKENQNNNLEVLIL
                     GELQLDGQIRAIKGVLPAISLAKKRGIKCIIIPFDNLEESLLIENLNIWGVKTLKEAL
                     EIISNLNNNIFPAKHTINFKTEYNEEKFEYDFKNIKGQHRTKRALEIAVAGGHNIMLF
                     GPPGSGKTLSIKCVQSILPPLTNKEIIETNRIWSVAGKLIDTKIIRQRPFRQPHQTAS
                     KEGIIGGGSNALPGEVSLAHNGILFLDEALEFQKSILQSLREPIEDKMISIVRASSKS
                     FKYPANFQLMIATNPCPCGNLGKNDTECFCSQQEVSNYWKKLGAAMLDRIDIRVPVKP
                     VDNAKLFQEDNESSCEIRQKIIKTRNIQSKRYANIENIHKNSDLKPEHIAIFCELDKI
                     LREEMIYILNKLNISSRATHSILKLARTIADLKEENHISRESLLEAIEHRKHGERLLE
                     E"
     gene            complement(82518..83468)
                     /gene="ldh"
                     /locus_tag="BT0_RS00410"
                     /old_locus_tag="BT0087"
     CDS             complement(82518..83468)
                     /gene="ldh"
                     /locus_tag="BT0_RS00410"
                     /old_locus_tag="BT0087"
                     /EC_number="1.1.1.27"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYN6.1"
                     /note="Converts (S)-lactate and NAD(+) to pyruvate and
                     NADH; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase"
                     /protein_id="WP_011772047.1"
                     /db_xref="GI:500096040"
                     /translation="MLKRNKVVLVGAGGVGSSFAYALTIDNSLVHELIIIDLAQDKAK
                     GEVMDLNHGQMFLEKNIKIEFGNYDDCSDADIVVITAGLNQKPGETRLDLVGKNTKIF
                     KEIVTSVVSSGFSGIFVIASNPVDIMTYVTMKYSNFPTHKVIGTGTTLDTSRLRYFLA
                     ERFNVNTQNIHSYIMGEHGDSSFATWDETKIAMKSLSEYLAEGKVSDAELDEMHKNVV
                     NAAYEVIKLKGATYYAIGLGIKKIVNAIISDQNLILPISSYINGQYGNFVKDIYIGAP
                     SVVCKDGIKEVLDFTISDRELEKFKISASQLKSYIDKIEF"
     gene            complement(83651..85318)
                     /locus_tag="BT0_RS00415"
                     /old_locus_tag="BT0088"
     CDS             complement(83651..85318)
                     /locus_tag="BT0_RS00415"
                     /old_locus_tag="BT0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012537859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor 4"
                     /protein_id="WP_041178551.1"
                     /db_xref="GI:752506686"
                     /translation="MDIERERGITIKSQAVTIDYKCSDGNTYELNFVDTPGHVDFSYE
                     VSRAISSCEGALLLVDASQGIEAQTVSNFYMAFEHNLEIIPVINKIDLPSANIDFVKE
                     QIEHDLGLDSNIAVPISAKNGIGIDELLEAICKYVPSPKGSVKSSLKALIFDSHYDSY
                     RGVIVHFRIFEGQIKTGNKIKLMHADREYLVEEIGIFRIILERKEILEAGDVGYFIAG
                     IKNISDVKIGDTVTLVDNPASAPLEGFKEVKPVVFSSIYPVDANQYDDLLKAMDRLKL
                     NDASLTFEKDASAALGHGFKCGFLGLLHLEVIQERIEREFDLNVILTSPSVRYKIIPK
                     KGNSYFIESPEQFPGNENIEVSLEPYIRANIIVPTEFLGNVMSVCLLKRGVQENLIYL
                     DTKRVEVIYKMPLAEILFDFYDKVKSVSRGYASFDYVLLGYEETDLVKLDILVNGDRV
                     DALSQLVFKDGARAKALSICKKLKDEIARQQFKIAIQGAIGSNIIARETISPVRKDVT
                     AKCYGGDITRKRKLLEKQKEGKKRLKMIGNIEIPQSAFLAILKSDDN"
     gene            complement(85497..86468)
                     /locus_tag="BT0_RS00420"
                     /old_locus_tag="BT0089"
     CDS             complement(85497..86468)
                     /locus_tag="BT0_RS00420"
                     /old_locus_tag="BT0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178552.1"
                     /db_xref="GI:752506687"
                     /translation="MLLFIFSFIFNLNSSGVKEFPYWILLEKGRQFIYSKEGFIKSNL
                     TSAINYLQEALLRKGIYPEANYYLSIAYSMIGNVVFEKLHLQKALEDKDYLLDKSFEK
                     NILFSLAKIAEIEDNYVDMIDYLNEILSKFSSSDDYYNYHYVVQKYENTTGSTGNKFN
                     MSFYLHSYLKQVRGTSGLDFTFNLYRFNKYNIIDTHQSLSKVYLKIGAYELAITHGLV
                     AAIGILTKMYDCVSYYEPLYEFKNLRSFVQKINEYTDVKTSFESTDFWEIVYTIAYAT
                     YSYDDHKHTLRAIDTWKLIVDLAPKFSPYVLKSKIHIRNFLLNKSVY"
     gene            complement(86547..86981)
                     /locus_tag="BT0_RS00425"
                     /old_locus_tag="BT0090"
     CDS             complement(86547..86981)
                     /locus_tag="BT0_RS00425"
                     /old_locus_tag="BT0090"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772050.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the K subunit is a
                     nonenzymatic component which binds the dimeric form by
                     interacting with the G and E subunits; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit K"
                     /protein_id="WP_011772050.1"
                     /db_xref="GI:500096043"
                     /translation="MNIGLIGVNSALAIAAIGSALGMGAAGSAAIGAWKRCYMQGKPA
                     PFLLIVFVSAPLTQIIYGYILMNTLAGIMTQADPWLLFGAGFGGGLAISISAFAQGRT
                     AAGACDAFAETGKGFATNLLVLGLIESVALFVMVFLMIFKFV"
     gene            complement(87003..88823)
                     /locus_tag="BT0_RS00430"
                     /old_locus_tag="BT0091"
     CDS             complement(87003..88823)
                     /locus_tag="BT0_RS00430"
                     /old_locus_tag="BT0091"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit I"
                     /protein_id="WP_011772051.1"
                     /db_xref="GI:500096044"
                     /translation="MIVKMSKVLILTLLKYKKESLEILRELGVVHINFCNRVSESLEK
                     VIEERGILVQALSLLGDDSEVKLLSSSNENFLDVAKSIISLGSEIKDLRDMQQSLLHK
                     RDIISFWGYFSLELVNKLRESNIYVQFFKSGIAEYKKLLACSETKVALINNYKGTAYF
                     VAINYSKQTIDTAEEYEFEFDLDFIENKLRFVDEILDQKLTQLSILNKYRDVLRDEIK
                     EYDQIVEFEQVMADMDVACDNFVYITGFVPEDKREDLKNLKGKFVVQFAEPDDDVVPT
                     YIKRRGIAKLAKPIFDVLDTIPGYKERDVSCVFMLFFFMFFGMIIGDAAYGIIFLLVG
                     IFLSLGNFIKGKPLTSIHALIFYLSTSAIIYGSMTGTWFGSNPFILELFPILKSLKLG
                     YLTGTNGMQNIMFICFTIGVLQISLAHIWNFVQKVKEKPHIHSIAQIGWLIIMPGLYY
                     LVLNLILGKDRFPMHSIILNMIYGGVILVFIFEKQDGSNFFMCVLKSFGGIIEQFLAT
                     VSGFADIISYIRLFAVGLAGLAISDSFNSMSAALLKSSNIGLIISGIIVMLFGHILNI
                     TLSLLSVVVHGVRLNMLEFSNHLGQEWNGYSYRPFRKIKN"
     gene            complement(88834..89430)
                     /locus_tag="BT0_RS00435"
                     /old_locus_tag="BT0092"
     CDS             complement(88834..89430)
                     /locus_tag="BT0_RS00435"
                     /old_locus_tag="BT0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit D"
                     /protein_id="WP_041178553.1"
                     /db_xref="GI:752506688"
                     /translation="MPKVKLTKNELKKQKDSLKMLGRYLPTLQLKKQQLYLEIRKVEA
                     LKRARKLEQDRLKRDIKSWIALFGEKFTFQDWIQIKRVVRSFANIAGINIPVFDFVEY
                     EDIKHDLLLTPYWVDRGIEVIKSMIQINAELEVLDDQIRLLESELNTTSQRVNLFEKV
                     MIPAAKINIKKINIYLGDQQTAAVVRGKMAKASLIKNR"
     gene            complement(89433..90734)
                     /locus_tag="BT0_RS00440"
                     /old_locus_tag="BT0093"
     CDS             complement(89433..90734)
                     /locus_tag="BT0_RS00440"
                     /old_locus_tag="BT0093"
                     /EC_number="3.6.3.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S1S7.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the B subunit is part of the
                     catalytic core of the ATP synthase complex; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit B"
                     /protein_id="WP_011772053.1"
                     /db_xref="GI:500096046"
                     /translation="MKRVYSKIESIVGNVITVMAQNVKYGELAIVRSKDSSSLAEVIK
                     LDRDKVSLQVYNGTIGISTADEVKFLGHPMQVTFSENLLGRIFDGAGNPKDGGPRLED
                     DLIEIGGPSANPAKRIVPRNMIRTGIPMIDVFNTLVESQKLPIFSVSGEPYNELLIRI
                     ALQAEVDLIILGGMGLKNDDYLTFKDYLEKGGALSRTIFFVNTANDPVVESLTVPDIS
                     LAVAEKFALQGKKVLVLLTDMTNFADAMKEIAITMEQVPSNRGYPGDLYSQLASRYEK
                     AIDFEGAGSITILAVTTMPGDDITHPVPDNTGYITEGQYYLKGGRIEPFGSLSRLKQM
                     VNGKTRDDHRTIMDAMIKLYASSKESIEKKAMGFNMTEWDEKLIKYSGMFESKLMDLS
                     VNIPLEEALDLGWEILFSCFEPKETGIRTELVEKYWPQKKD"
     gene            complement(90744..92474)
                     /locus_tag="BT0_RS00445"
                     /old_locus_tag="BT0094"
     CDS             complement(90744..92474)
                     /locus_tag="BT0_RS00445"
                     /old_locus_tag="BT0094"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S1S8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit A"
                     /protein_id="WP_011772054.1"
                     /db_xref="GI:500096047"
                     /translation="MEARGKVVGVIGNLVTIEIVGTVSMNEIVFIKTGGRSLKAEIIR
                     IRDGEVDAQVFEMTKGIAVGDDIEFTDKLLTVELGPGLLSQVYDGLQNPLSELAAQCG
                     FFLERGLYLSALDRSKKWSFNATAKVGDIVVAGDYLGFVVEGTIKHKIMVPFYRKDSY
                     KIVEIVSDGNYTVDDKIAVIENDAGGRHVITMSFHWPVKVPITSYKDRLIPSEPMVTQ
                     TRIIDTFFPVAKGGTFCIPGPFGAGKTVLQQVTSRNADVDVVIIAACGERAGEVVETL
                     KEFPELIDPRTGKSLMDRTCIICNTSSMPVAAREASVYTAITIGEYYRQMGLDILLLA
                     DSTSRWAQAMREMSGRLEEIPGEEAFPAYLESVIASFYERAGIVVLNDGNVGSVTVGG
                     SVSPAGGNFEEPVTQATLKVVGAFHGLTRERSDARKFPAINPLESWSKYRGVVESEKT
                     GYARSFLAKGNEINQMMKVVGEEGISIGDFLVYLKSELLDACYLQQNSFDSVDTAVSP
                     ERQNYMFDILYDILQSDFKFENKLEARSFVNELRQNILDMNLNPFKEEKFNKLENTLK
                     DLVRSKKLDF"
     gene            complement(92486..93031)
                     /locus_tag="BT0_RS00450"
                     /old_locus_tag="BT0095"
     CDS             complement(92486..93031)
                     /locus_tag="BT0_RS00450"
                     /old_locus_tag="BT0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772055.1"
                     /db_xref="GI:500096048"
                     /translation="MLSPYYYVMSSLPYLDLKIGKGGSISGFFDNIEIALSREDFLCL
                     KDLSESRFARGNLKVIDQFLEFEEMMRYTLATIRAEKLGFSRDVYLESSYFSSYYLGI
                     LKPLCLKENPFEVELGLDMLKWQFLTELEVGNDFNFEKLVIYLLKLMLVSRRSLFIEE
                     IGEKNFDDICQKLSMQMSKNF"
     gene            complement(93042..93638)
                     /locus_tag="BT0_RS00455"
                     /old_locus_tag="BT0096"
     CDS             complement(93042..93638)
                     /locus_tag="BT0_RS00455"
                     /old_locus_tag="BT0096"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYP5.1"
                     /note="produces ATP from ADP in the presence of a proton
                     gradient across the membrane; the E subunit is part of the
                     catalytic core of the ATP synthase complex; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase subunit E"
                     /protein_id="WP_011772056.1"
                     /db_xref="GI:500096049"
                     /translation="MQFEVKDLINKIKKDGLEEAEKLANEIILNAKRDAEAIVLKAES
                     DAKDLKMQAEAEANEYKRYSLEASRQAVRDLIIGTEKNIKSLFKTALKDSVSRVYDDN
                     FLRDLIIKVVDIWSKNDKIDIMLNESDFSNLLSVLRAKIGNRLDDAIEIKPFKGISKG
                     FTIQQRDGNLYYDFTSETVADILFEYLNPRFKEVIKLI"
     gene            complement(93749..94144)
                     /locus_tag="BT0_RS00460"
                     /old_locus_tag="BT0097"
     CDS             complement(93749..94144)
                     /locus_tag="BT0_RS00460"
                     /old_locus_tag="BT0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772057.1"
                     /db_xref="GI:500096050"
                     /translation="MGISRFEEFENALFKICLDVDCVLEDEFGNSYKVHPSRLSRGKA
                     ANGLLDGLFRVTTSFTLGYGSKFGRGYLVIIEIITLDMVDIEFSNRVIERGIKVFGEK
                     LKERFPGKKLFIVHDINVYKIIGDFFSGV"
     gene            complement(94145..96481)
                     /locus_tag="BT0_RS00465"
                     /old_locus_tag="BT0098"
     CDS             complement(94145..96481)
                     /locus_tag="BT0_RS00465"
                     /old_locus_tag="BT0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS"
                     /protein_id="WP_041178407.1"
                     /db_xref="GI:752506542"
                     /translation="MQEKYLEKIDFYQILSSVASYVAISDTLNLLGEQQILKTEEEIN
                     RVCCFVKLIKNLIEVYDEYPNSCLESISDSIILLLKEKSRISIEEIKNIIFFLREVLR
                     IMLFLDRNEFKIQDEVEILKELLFVDPSLKHLLETLCKYIDLDELKIKRGVVKNYDEI
                     DFEIRNLDKKIEKQLKQIISLNSQYLTSTLIYYKSGKYTIALKSSFKNKIKGNIISIS
                     SSGETFYIEPNDIVSENNRLGFLGFEKTRIVLKILQELSDEIRRHIVLLKSLYNKFLY
                     YDSLKARAIYGIRNQGVFPRFDSNINIINARHPLIQHAKSINFCPLNNKVVVITGPNA
                     GGKTATLKTVALLSAMFQFGIPVPVDESSTFKIFDNILVDIGDDQSIANSLSTFSSHM
                     NNIAYILKYATRDSLLIFDEFCSGTDIEQGQALAVAVLEHLININSCVIISTHYNALK
                     YFAYTHEFVVNASMQMDLDKMEPNYNLMFSVPGESFAFSVASKSSIDANIVLRAKEIH
                     SSNKTGVNEILERLTKKEQEIHLLEEELKDKLKLIELKEIEINNIRNNIILKEKDLEE
                     RLINEQKEFLKNSRKILENLVREIKEGSVCTTKNKEFISNITDNIITKTTKIRLLNQE
                     IATKIEFRVGDKVRVAGSNASGEIIGVTKKGFIVNTGVFKITVSSSNLEKILDDKKSK
                     NDRDKNFSFSFENQDDELSLTVDIRGMRVVEAIDFLNRKIDNMLLRNVCKFEIIHGKG
                     EGLLMEGVHAFLRDVKFVKKYYFAHPSDGGVGKTIVEF"
     gene            complement(96453..97394)
                     /locus_tag="BT0_RS00470"
                     /old_locus_tag="BT0099"
     CDS             complement(96453..97394)
                     /locus_tag="BT0_RS00470"
                     /old_locus_tag="BT0099"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome biogenesis GTPase RsgA"
                     /protein_id="WP_011772059.1"
                     /db_xref="GI:500096052"
                     /translation="MNDLRFEILWGVNNIYSIVNVNTNEIYEGVIKGKVLNTQDKEYS
                     PLVPGDFVCGDIYDEGKVYIKERLKRKSVLWRYNKKAALRQVIVSNIDNVLIVSSANL
                     PEIKNSFIDRALVVAEEQGITPIILINKIDEGISTKVDTLIKIYENLGYRVIKTSAIT
                     LQGIEEIKEIIKNSRASFVGQSGVGKSSLINEVDLNAAQAINEISYKYSRGRHTTVYA
                     MAFHSDNGVVIDTPGIKEFGIESLEPLKLRYYFREFKDLNDFCRFNSCLHANEPNCFI
                     MNQIGFRISEVRYNSYLKIINELKRYKSYAREIFGKN"
     gene            complement(97391..98155)
                     /locus_tag="BT0_RS00475"
                     /old_locus_tag="BT0100"
     CDS             complement(97391..98155)
                     /locus_tag="BT0_RS00475"
                     /old_locus_tag="BT0100"
                     /EC_number="5.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate racemase"
                     /protein_id="WP_011772060.1"
                     /db_xref="GI:500096053"
                     /translation="MSNLKNVIVIFDSGVGGLSYFEYISKRFVKRNYVYVADNKNFPY
                     GEKSSDFLLKEILELILKLEQMYNVAAIVIACNTASISVYDKLNFSFPVIYTLPSVCL
                     VEELAYKRVILVATHATINSKFIQREKDCHWDLILKPASELVNFVEYGDRFKEDALKY
                     LNFLKLEVKASRRDMVFLGCTHYLHIKDMIENFLGIPVYENRELVTNELIKELKSIES
                     RDDCFTRYFYLTQDENLYFYKNFCKKYGLHFKGIIN"
     gene            98298..99683
                     /locus_tag="BT0_RS00480"
                     /old_locus_tag="BT0101"
     CDS             98298..99683
                     /locus_tag="BT0_RS00480"
                     /old_locus_tag="BT0101"
                     /EC_number="6.1.1.22"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparaginyl-tRNA synthetase"
                     /protein_id="WP_011772061.1"
                     /db_xref="GI:500096054"
                     /translation="MHKSIKEILNNPILDSIITVKGWIRTKRSNGKISFVEINDGSNI
                     KGIQAIINEEDHQFEKKELKKLTTGASISLTGILILSPAKGQTYEIKTTNFNIIGEAD
                     QETYLLQKKRHTFEFLREIPHLRIRTNTFGAVARIRNQISYKIHEYFQKNGFLYIHTP
                     IITSNDGEGAGEIFRVSTLDFNNITNGKEVDFKDDFFGKQAFLTVTGQLHGEAYAMAL
                     SKIYTFGPTFRAENSNTTRHASEFWMIEPEMAFFTLEDNINLAENFLKYILKETLNNC
                     NQDIEFFDNFIEKGLIKKIEDVINSNFEVITYTQAIKQLENATKTFEIKPYWGMDLQT
                     EHERYLTEEIIKKPAIVIDYPKEFKAFYMKMNEDGKTVKGMDILVPRIGEIIGGSERE
                     DNLDKLNKRIKELNLEIETLNWYLDLRRFGSTPHSGFGLGLERLIQYITGMANIRDVI
                     PFPRTPKTLYF"
     gene            99707..100285
                     /locus_tag="BT0_RS00485"
                     /old_locus_tag="BT0102"
     CDS             99707..100285
                     /locus_tag="BT0_RS00485"
                     /old_locus_tag="BT0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772062.1"
                     /db_xref="GI:500096055"
                     /translation="MKIKILCQITLTLSALMLFSNEKFENNLKIFSNVEKEITGKKSN
                     YQYSKEKPRINKSNKINYPHKKEDYHHNIIKKKDTNLQIDKTNKKQDVQKPINNIVKI
                     RKSNKIYYPQDKNNIQTSKSKKNIWYNIKVYSTHTKDRFKKIKALNKINTQIENNFAL
                     IGPILEDYLGEITKALHVIGYSELEYIKVEQN"
     gene            complement(100282..100872)
                     /locus_tag="BT0_RS00490"
                     /old_locus_tag="BT0103"
     CDS             complement(100282..100872)
                     /locus_tag="BT0_RS00490"
                     /old_locus_tag="BT0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyl transferase"
                     /protein_id="WP_011772063.1"
                     /db_xref="GI:500096056"
                     /translation="MKKFVSYEEIRINGLKLAYKIYKNGFIPDIMYVSLRGGAYLGNI
                     ISEFFKFIKLEKPLLYAAVVARSYDISNKQKKIMIDGWTYDPKYLRAGDNVLFVDDIF
                     DTGRTIIHLREEVLKRGIDSQNVKIAVYDYKERGYVDYKPDYYVNKYSSEDELNTWIH
                     YSNHELIGLSEDEYKLSFLNLDDELNDILKFLSSKL"
     gene            complement(101226..102668)
                     /locus_tag="BT0_RS00495"
                     /old_locus_tag="BT0104"
     CDS             complement(101226..102668)
                     /locus_tag="BT0_RS00495"
                     /old_locus_tag="BT0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="WP_041178408.1"
                     /db_xref="GI:752506543"
                     /translation="MKKNFISVFLASFLALTIGFFVGIHYLGSDKNTIVFAQEKGDAG
                     ESLQDSFRKVSKKILPSTVEIYATGIVKTRDLFHLFFFFDIPGLNLEKKAQWGGSGVI
                     IGRDSKKTNLFYALTNSHVVDNAIEFEVGTYDNKTYKAKLVGKDDKKDIALVSFEAND
                     AAIEIAELGDSDMLEIGDWVIAVGSPHNFSFSVTAGIISGLHRSVNPNLKARNSFIQT
                     DAAINRGNSGGPLVNIKGEVIGINTWISASPSGGNLGLGFAVPINNAKSIFDVLMSGK
                     KSESAWMGVDLHRLRSKDPELLKSLGYEDNFESLAIIAGVYDGTSAFRAGLKAGDVIS
                     KINDVSMNFFYDVKQYINDFYAKEKIKVEILRGKEKKNVEIELDVKPKISNEKEYISE
                     LKLMPGFTVYPLTKEVRTQLGLRNWTNGVVVDSVDPTLGTNPKISTGDIIMVVNSKSI
                     KSLRDFYDAVEHGKNTYTVLRDGQTFKVSF"
     gene            complement(102727..103479)
                     /locus_tag="BT0_RS00500"
                     /old_locus_tag="BT0105"
     CDS             complement(102727..103479)
                     /locus_tag="BT0_RS00500"
                     /old_locus_tag="BT0105"
                     /EC_number="3.4.11.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionine aminopeptidase"
                     /protein_id="WP_011772065.1"
                     /db_xref="GI:500096058"
                     /translation="MKLRLKSRAEIEKIRASARLLAQTFLEIEKNIVPGINTKTLDLI
                     ASDFITKNGAKSAFKGYAGFKGTICASINEEVIHGIPGTRELKDGDVISIDCGVILDG
                     FYSDMAKTFKVGKVSPRVNKLLEVTEAALYRGIDEMKAGNRVLDISKAIENYIKPFGF
                     GIVRDYTGHGVGFALHEEPSVPNYYEPFFKNVRIQEGMVLAIEPMVNLGGHKVSVKND
                     DWTVFASDFSCSAHFEHTVAVVDGLPLILSKI"
     gene            complement(103484..105136)
                     /locus_tag="BT0_RS00505"
                     /old_locus_tag="BT0106"
     CDS             complement(103484..105136)
                     /locus_tag="BT0_RS00505"
                     /old_locus_tag="BT0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772066.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772066.1"
                     /db_xref="GI:500096059"
                     /translation="MKANKVLLFFILFLVLFISIFVYLSLNPYVLYMLKGELDFNEIL
                     VEVDGYLLNENLESAENAIRFYSYYADTEYKWLSLIKRAKLYSVKIKHYLLMRDILDL
                     SVKSLPGNLKLRALEVYSKLKVGAVLEAYDIAKQYLLGYKEYKHLYDEAFIKSLILSY
                     DVKDIKSFLIKMERERDALAFETIGLNLQNNAFLIDAMLLYIEKKDLDSAKRILLKIK
                     EDKDFSKELAYISYGLDNLDFTIANLKLNNSNEPSLMFLLADAYLKKGDINNAKIEYL
                     KLYTDFPDYSMMVYLGLAFIAKKENDLKRAIAYLNKANENFKENEMVNYYLANIYFEA
                     NDYFNANEIAKKYRDSPLFFKLYFVLNYANLKYEAKKSFLWRLFYRSNYSTDIAQLLA
                     WNLLLYSDLKDLDLFFKIYDSVDEVQDWYYFYKFYYFFLKKDLSVAEKIIIENQVGKY
                     LYGFYYNLGVLKLYQKNYKESEEYFSKTVSLLPFTLDDKSKITLREREDVAKVYLKRG
                     INYLYLGEFEKGREAILTSNFFYETNEGKLYMNMIEILKERN"
     gene            complement(105123..105557)
                     /locus_tag="BT0_RS00510"
                     /old_locus_tag="BT0107"
     CDS             complement(105123..105557)
                     /locus_tag="BT0_RS00510"
                     /old_locus_tag="BT0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitermination protein NusB"
                     /protein_id="WP_041178409.1"
                     /db_xref="GI:752506544"
                     /translation="MDLRHKARVLAFQKIYSIDINCKAKDNIYDIFNLEDHGLELEEN
                     LKLFYSVLVNGTYDNLEFIDKLISDISLNWRLDRMDKVDLAILRMSVYSLKFQNLDVP
                     KRVIIDEAILIAKKYGSKNSYKFVNGILDALLKNMESSFESK"
     gene            complement(105583..106593)
                     /locus_tag="BT0_RS00515"
                     /old_locus_tag="BT0108"
     CDS             complement(105583..106593)
                     /locus_tag="BT0_RS00515"
                     /old_locus_tag="BT0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178410.1"
                     /db_xref="GI:752506545"
                     /translation="MGNVLCFLLFFVVGITSFAQNTPVVIINLHSNEIITKTEFDSKV
                     NTLKKTQGRDLSNAERKQVLQILIADVLFGQEALKQGIKVEDAEVMQTIRTQFGLLNL
                     TDEQIKQMVESQGTNWNELLSSMKRSLSAQKLILKMAQPKFSEIKIPGEKEVVEYYEA
                     NKTKFVNPDIARISHVFFSSKDKKRSEVLANAKDIVNQIKSKKITFEEAVRKYSNDEG
                     SKVKNGDLGFLARGDQNAQNVLGLDFVKEVFMLKKGDISQPISSKEGFHIVKVTEMYS
                     QRFLGLQDKISPNVDMTVKDAIKNNMVNIHQQQIVARVQQEIYDKLNKSASIQILDSS
                     LK"
     gene            complement(106688..107881)
                     /locus_tag="BT0_RS00520"
                     /old_locus_tag="BT0109"
     CDS             complement(106688..107881)
                     /locus_tag="BT0_RS00520"
                     /old_locus_tag="BT0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421887.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA acetyltransferase"
                     /protein_id="WP_041178411.1"
                     /db_xref="GI:752506546"
                     /translation="MRKIAIIDGLRSPITKFGGVLKGMNIVDVSSDIVKALLARNNID
                     KVDEVIVGNVISAGLGQNIARQIALKAGLGEIIPAFTVNKVCGSGLKSLELAFNSIAL
                     GNSEIILAGGVEDLSNAPYLLPRGVRFDGLKFGDFKIEDSIYKDALVDTPSSTVMGLT
                     AENLAEMYEITREMQDQFAYNSHMKATAARDSGYFNDEIYPLSVFDKKTKLKSVICSD
                     EEIRDSLSLEKLSSLKPVFKEGGTVTAGNSSSLDDGACFLILASEDFVCKMGLQPLAY
                     VGGFKSVGLNPLHMGFGAFLAIKEIIEKFNLTPSEIDFIETNEAFAAQSLSVLKALRQ
                     KYDVRDSIINVNGGAIALGHPFSVSGSRILLTLARLIKINNKSKGIASLCIGGGQGIA
                     AFLYR"
     gene            108057..109412
                     /locus_tag="BT0_RS00525"
                     /old_locus_tag="BT0110"
     CDS             108057..109412
                     /locus_tag="BT0_RS00525"
                     /old_locus_tag="BT0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772070.1"
                     /db_xref="GI:500096063"
                     /translation="MYLAKLNLKMIIIMLAINSYAYNHLIKYQNDRVDKYHFNNLNDG
                     LGFALCDFFDDLRSGSLIFIHESKYNFMINAEAHMLTFRGNKDSPEQLRTRVDLLEIG
                     FMYYFPFSIKTKTQYFGNIDIGIGIKNLIYGNWGGALIQQAVHFTLRQLRPIPKNYEN
                     YNYRGFLSTAINYSYMKFFNLENYIDLSYFADYFFKTSIAMDFKNESIGIETKLFYQT
                     QSKINSIETYSKTQEAETGIGIQYRLHSKNFFTINNLNLNNFSTKEKFFSVGGFGIIF
                     TEEYDNTLEDNLYLLNQNFSFGFDIMIPFQTRNLIYYIIIPSLKYYFAIATNYDINLA
                     EFNSRTNRFSSGLMYELFTKNRFILYICSGIFVSYNKDKKDIKAIYRPLKIKDTLQAG
                     LEIEPGILIETLKYNKVKYNAKIFTKINYHPIVYNTTNYNLETHKLNFNYLGIGITIN
                     I"
     gene            complement(109514..110899)
                     /locus_tag="BT0_RS00530"
                     /old_locus_tag="BT0111"
     CDS             complement(109514..110899)
                     /locus_tag="BT0_RS00530"
                     /old_locus_tag="BT0111"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="WP_011772071.1"
                     /db_xref="GI:500096064"
                     /translation="MAFTSVSTASTLLFNEGAEKAVISSIFYNPGKVEEALLYLKPDD
                     FYSQNHEMIFKAMISLYEKRENIDPITVFEEVSSLTPKSQLLSNFKALTGLQDYLSFL
                     SGYLPTDKTINVYAKIVKEHRIRRDISKISRELNDLANDSTKKVEQFVEEAQRHILSI
                     ELDCSSKNLNHAKIIAERVHAEIYERSMKKREVNFGIPSGFKKVDSLIGGFRESDFII
                     IGARPSVGKTAFALNIASSIALRNDKKRKVGFFSLEMTSDALIKRIIAAQANIDSFKI
                     QNSILSGHEIKAINDVVNDISNSEFYIEDTANISLLTLATQARKLKRFSDIDILFVDY
                     ISLISLEARNVPRHEQVASISKALKELARELKIPIVALSQLTRDTEGREPSLASLRES
                     GALEQDADIVILLHRDKDLKSGSDDERVISAIDTKIIVAKHRNGPTGRADILFLPHVV
                     KFVNKEHENDY"
     gene            complement(110916..111410)
                     /locus_tag="BT0_RS00535"
                     /old_locus_tag="BT0112"
     CDS             complement(110916..111410)
                     /locus_tag="BT0_RS00535"
                     /old_locus_tag="BT0112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="WP_041178412.1"
                     /db_xref="GI:752506547"
                     /translation="MRVILKEDFINLGKEGDIVDVKDGFARNYLLPKGFAVFSDKHNI
                     DIFNQKRRSILKRQETRKKAALELKEKLDKINLEFVMQSNDSGKLFHSINSLNIADEL
                     LKLGFEIERRKIDIHHGTLKTFGIYDVTIKLYEGINSVIKVEIKREEKKHSLKKSKSV
                     EKEV"
     gene            complement(111420..111713)
                     /locus_tag="BT0_RS00540"
                     /old_locus_tag="BT0113"
     CDS             complement(111420..111713)
                     /locus_tag="BT0_RS00540"
                     /old_locus_tag="BT0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYR2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="WP_011772073.1"
                     /db_xref="GI:500096066"
                     /translation="MYKDIDSHQRDSRTDGHQDGFKKNPNFRFFKKKTCRFCDMDRVP
                     DYKEFDFLKKFVTEQGKILPRRITGTSAKHQRRLALEVKKARYMALLPFVKKY"
     gene            complement(111726..112163)
                     /locus_tag="BT0_RS00545"
                     /old_locus_tag="BT0114"
     CDS             complement(111726..112163)
                     /locus_tag="BT0_RS00545"
                     /old_locus_tag="BT0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772074.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA-binding protein"
                     /protein_id="WP_011772074.1"
                     /db_xref="GI:500096067"
                     /translation="MADINSLVLSGRLTRDSELTYTEAGMAILKFGLANNRRVKKNDE
                     WMDYAQFFDCTLFGKRAESLASFLKKGKQVVISGSLRYESWQDKNTGDKKNRCSVLVD
                     DIQMFGSLITTKGANDVGFESYKKPDSFTDIGFDDGFNEDIPF"
     gene            complement(112175..112576)
                     /locus_tag="BT0_RS00550"
                     /old_locus_tag="BT0115"
     CDS             complement(112175..112576)
                     /locus_tag="BT0_RS00550"
                     /old_locus_tag="BT0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYR4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="WP_011772075.1"
                     /db_xref="GI:500096068"
                     /translation="MIKKYEACFLFKSEELEYKAALEEVKKQLTVFNASDFAENSLGE
                     RALEYPIRKQLRGRYEIIEFKMDSENLKELEIQLKLIKNLLRHMILVKINKKVSVKKV
                     KRRNFREFKDNRDIKEKESSEFNSNVDVKVD"
     gene            complement(112908..114602)
                     /locus_tag="BT0_RS00555"
                     /old_locus_tag="BT0116"
     CDS             complement(112908..114602)
                     /locus_tag="BT0_RS00555"
                     /old_locus_tag="BT0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS mannose transporter subunit IIB"
                     /protein_id="WP_041178413.1"
                     /db_xref="GI:752506548"
                     /translation="MINFLKVFRFANLQKFSSAVRLPISVVTIFCLMLGIGSALLNPS
                     NLFYVDNFVVKLVLGLIKSTSNIIILNIPLLFVIGITVGVARAQKGPAALSGLVGYLI
                     FNITENYFLDVFARLVDPNLMSSVGQVNILGIQTLNTGILGSLSVGLLVGYLHNKFYC
                     IELPGPLNFFSGFRFVPIVVFPFCILLGIIFVLIWPYFNELITSFGFFIAKFNYLNSF
                     LYGFLNRLLIPLGLHSILTFPFNFTSLGGTEVIDGQVVGGIQNIFYAQLADPYLVRFS
                     PSISRFNSGFYLSIMFGLPGAALGVYRGIIHDDKSKIVPLLFSGAFAAFLTGITEPLE
                     FLFVFTAPLLYFIHAIYTGFALLIANVLDIAVGVTFSAGFFDFLMFGVLQGHAKTNWL
                     YLLPLGFAFFALYYFTFKWVYNYFDFQIFGVDEPFFAGSEGEVEGMGIAHLIAQGLGG
                     LDNIQEFNVISTNLMFVVFSPELISEDFLKKTGALNIVTIDNTIKIDYGTNVYYIKQA
                     IKNYSPERLFKASAIVASDNVKHGIKAYIEMKEDDKLERQGSTGKVYKLNKDDEDN"
     gene            114845..115531
                     /locus_tag="BT0_RS00560"
                     /old_locus_tag="BT0117"
     CDS             114845..115531
                     /locus_tag="BT0_RS00560"
                     /old_locus_tag="BT0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772077.1"
                     /note="hemolysin III-like protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772077.1"
                     /db_xref="GI:500096070"
                     /translation="MFEKNKKYTSYNEPIPKNELFSSISHLFGIILSIIGTTILITLS
                     THSKKYLHAVLFLIYGSSMTLLYTMSTLYHIFTKGSKIKQLFRKFDHISIFILIAGTY
                     TPPCLILMPNAYGKIILITVWGFAILGIIFKSIYVNSPGWLNGCIFILMGWSIIFGIR
                     LIYNILPIQGFLWLALGGILYTLGGIIYSASKKLNPIANMRMHDFFHILILFASFAHF
                     WFMFKYVLPY"
     gene            complement(115576..116856)
                     /locus_tag="BT0_RS00565"
                     /old_locus_tag="BT0118"
     CDS             complement(115576..116856)
                     /locus_tag="BT0_RS00565"
                     /old_locus_tag="BT0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc metalloprotease"
                     /protein_id="WP_041178414.1"
                     /db_xref="GI:752506549"
                     /translation="MYIFLSILAFTFIIFIHELGHLFFAKLFKVKVEVFSIGIGPSLF
                     KFKIKDTEYRFSPIFLGGYCKLKGAEHLENELRLNRQLEADKDSIFGISNFKKILIYF
                     AGPLFNLIFALIVFIAIEMIGIVYPDYFNKIVVINNSVLSKFRDGDVILSVNNSGIRY
                     FSDLNKVVPLKDSRVTFIVLRDSKTISFEDYTSFDKLLKEIGPWINLIISKVKTNSSA
                     EVAGLKPNDKIISINDVILNNNVELNNLIEKLDSNVVDIKYERNGEILTSRLVFQDTN
                     KSLGVYLLPGLERVVKSDNLGIAIKNSFNKVLNILGHILYSIVALFTNFKNNAKNVTG
                     PVGMINIFIDSFSAGILSWFNTIAIFNLLIAGMNLFFVVIPMLDGGQILISLIEILRG
                     KRFRAKVIYYFYIFGILLMLSLFILGFFNDLRNL"
     gene            complement(116873..117736)
                     /locus_tag="BT0_RS00570"
                     /old_locus_tag="BT0119"
     CDS             complement(116873..117736)
                     /locus_tag="BT0_RS00570"
                     /old_locus_tag="BT0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_041178554.1"
                     /db_xref="GI:752506689"
                     /translation="MGDKSLFNLRSKKLAFVARLGTFLFFVPLVLFLIFLEFNNYLFI
                     NILIFMFSGVAAKEVNDLLRVKSSSISSTLSFFLGIAPPILTYVHCNVFDLGINIIFY
                     LVITLVFSNWIVNLVFIKENEIVNFLSQATSIIFILIYPGVLMSFVVAITTLPRAPIL
                     LLILFSMVSGNDTFAYLVGYFFGKNSYRPTIISPNKTIMGFLGGILFSVIVAIVVVCL
                     GLINLTYGEAMIFGVLIGFFTIIGDLFESGLKRSAGVKDSGNIIPGRGGALDSIDSYL
                     LTGPIFYLYLS"
     gene            complement(117726..118418)
                     /locus_tag="BT0_RS00575"
                     /old_locus_tag="BT0120"
     CDS             complement(117726..118418)
                     /locus_tag="BT0_RS00575"
                     /old_locus_tag="BT0120"
                     /EC_number="2.5.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP pyrophosphate synthase"
                     /protein_id="WP_011772080.1"
                     /db_xref="GI:500096073"
                     /translation="MNNNSLPMHVGIIMDGNRRWALKRGLSLFEGHKEGLKRAKEIVK
                     YSLKLGIKYLSLYVFSTENWNRTKSEIKHLMFVIADYLSSEFEFYSTNNIKILVSGEI
                     EALSKEVRKSIIDAIDFTKNFDGLVLNLAINYGGRNEIVRATKKILGSGLQCETLDEI
                     VFSKFLDNPELCDLDLLIRTGGDMRISNFLLWRIAYCEFVFSSVLWPEYSVSHYDKDL
                     ECFKNRKRNFGR"
     gene            complement(118423..118977)
                     /locus_tag="BT0_RS00580"
                     /old_locus_tag="BT0121"
     CDS             complement(118423..118977)
                     /locus_tag="BT0_RS00580"
                     /old_locus_tag="BT0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2RZI6.1"
                     /note="RRF; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome recycling factor"
                     /protein_id="WP_011772081.1"
                     /db_xref="GI:500096074"
                     /translation="MEEYKALLDEKMSKVLLSLESEYKSLRTGRINSSLFDKVLVDYY
                     GEKTPLTRVANVSIPEARLIVIQPWDKSLLSKIEQAILSSDLSMNPSSDGAVLRIKVP
                     VLTVERRKEIVKQAKKIAEEYKVAARNVRQELNSKAKKQEKDSQITEDDLRRILDDIQ
                     RDTNSYIKKIDEIFDLKTKEIMEV"
     gene            complement(119014..119850)
                     /locus_tag="BT0_RS00585"
                     /old_locus_tag="BT0122"
     CDS             complement(119014..119850)
                     /locus_tag="BT0_RS00585"
                     /old_locus_tag="BT0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2RZI7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Ts"
                     /protein_id="WP_011772082.1"
                     /db_xref="GI:500096075"
                     /translation="MSISPQEVKKLRDVTGAGFGDCKKALDAVGGDFELAKKKLREMG
                     IASADKRSGRDAKEGRVFSYVNKERVGLLLISCETDFVAMNSDFVTFGNSLIKQLVES
                     GKDSLDKQQELEIKNLAATIKENIHVSKIYISNIASNELVKNYLHGEQSKIGVFIKLK
                     VDDVLKMEDESLNNLAMDLALHVAAFAPLYLSVGDICSNYIKEQEEMFTKQMEASGKS
                     EAVIKGIVSGKLKKHLGEIALLEQGFVKDDKLTVKEKIEEISKSILTKIEIVDFKYLS
                     VG"
     gene            complement(119868..120632)
                     /locus_tag="BT0_RS00590"
                     /old_locus_tag="BT0123"
     CDS             complement(119868..120632)
                     /locus_tag="BT0_RS00590"
                     /old_locus_tag="BT0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYS2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S2"
                     /protein_id="WP_011772083.1"
                     /db_xref="GI:500096076"
                     /translation="MAVITMKSLLEAGVHFGHQVKRLDPRMKRFIFSERNEIHILDLQ
                     KTLQGIKDSYELVQSVIKSGKKVLFVGTKKQASEIIEQEARRSDMPYVNNRWLGGMLS
                     NFNTIKKSVQKLKKLEKMEIDGTFEMISKKEVSQLNREKLKLSKNLTGIKDMEELPGA
                     VFIIDPKREQIVINEARKLGIPIISVVDTNCNPDVIDCPIPGNDDAIRSVALFTKIIS
                     DAILESDKEVGIQIVENLNEEDLMSEIAVKDEKKEL"
     gene            complement(120668..121267)
                     /locus_tag="BT0_RS00595"
                     /old_locus_tag="BT0123A"
     CDS             complement(120668..121267)
                     /locus_tag="BT0_RS00595"
                     /old_locus_tag="BT0123A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="septum formation protein Maf"
                     /protein_id="WP_011772084.1"
                     /db_xref="GI:500096077"
                     /translation="MIYKENFEIALVSNSFARAEFLEALKIKFLSLSVDIDEGSIMKS
                     GEIGVTKRIAVLKLTNAIEKYGKDKCLITVDTLLKNDSIYVGKLSDEKEAFSKIMGYS
                     HKLIEVETSFCVFIPGKEKIIKACEVSFIKFRELTPDIVYHYIALGHWKDKAGGISLK
                     NGVADILIEYINGSYSNIIGLPIGLFYDILIRENVISTI"
     gene            complement(121257..121535)
                     /locus_tag="BT0_RS00600"
                     /old_locus_tag="BT0124"
     CDS             complement(121257..121535)
                     /locus_tag="BT0_RS00600"
                     /old_locus_tag="BT0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421903.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772085.1"
                     /db_xref="GI:500096078"
                     /translation="MVTFFFHLILTNIIISFVVSFFVVFFGILRFGFLLVYLISFLGS
                     VLFLFFIPLFYSDYYNRQVDVLFYLFPVIGSIVLISLLGFSERSKNDL"
     gene            complement(121550..122248)
                     /locus_tag="BT0_RS00605"
                     /old_locus_tag="BT0125"
     CDS             complement(121550..122248)
                     /locus_tag="BT0_RS00605"
                     /old_locus_tag="BT0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178555.1"
                     /db_xref="GI:752506690"
                     /translation="MVIVDSPLVIDSRASRDTLAFALPSWYFGNNHNSRVRGFDIYYK
                     FYPEGSNYHFRGFAESVQKDFNALKSVFNNVNEFNRRGFYKINLDGDRFSGKPTLKLD
                     KSWIQGNFPLYFELNFENLRKSTPGSVFINIRKGNSSSAPLIRSIKTVYRSYVVNDLY
                     REFSEALKKSKVTNSTNRPFDLKHISDSFFTKDVSPKYNLVIFVMAVGNAIEDDLYSV
                     IVNLGSLHGFELSS"
     gene            complement(122345..122947)
                     /locus_tag="BT0_RS00610"
                     /old_locus_tag="BT0126"
     CDS             complement(122345..122947)
                     /locus_tag="BT0_RS00610"
                     /old_locus_tag="BT0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178415.1"
                     /db_xref="GI:752506550"
                     /translation="MFKNKFFIGIFAVIVFVGIVVYFYSSMDVDYVKAGGEVVENLER
                     DLNLYLRAKNIEEKLELESKIEESINKRDDVAYEFLSRFYLARSTYFQSKGLYKEALE
                     DLDIVIGSKWIERELAYLNKAVIYEKMGQVDNALIIYDNLIKQTKLDFIKIRALLGKA
                     VLIETRDKKLAIDIYSEIANFSYENNLYVNLAKNKLLQLR"
     gene            complement(122940..124601)
                     /locus_tag="BT0_RS00615"
                     /old_locus_tag="BT0127"
     CDS             complement(122940..124601)
                     /locus_tag="BT0_RS00615"
                     /old_locus_tag="BT0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421906.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S1"
                     /protein_id="WP_041178416.1"
                     /db_xref="GI:752506551"
                     /translation="MENQEDLQENYLKVLEKVELGSSVSGVVINVMKDYVLVDIGYKS
                     EGFIKIDEFETIPSIGDKLDAIVTKVGGELGLVLSVAKLDSLNLQDKIDEYISNRKVL
                     KGKILAELSSGYKVQINENVIGFMPSYLSSKFRDEKLKRGLVVEFYVVQADKTDGLRL
                     ILDRRTLERERELVKKKELVSSYNEGDIVDGVVERITDYSAIIKVKNLVLGVLHKRNI
                     AFNRVENIEDFIRVGDKLRLKIIKLNVNAVKMELSLKALKTNPWDSVEAKYKVESIVK
                     GKVVKILPFGAVVELDSEISGFIHISNFSWVRVIKSPQELVKVGQIVEVKILEIDKEN
                     QKISLGIKQVNENPWNNLAQRCAVGKVVQGVVKNITKTGAFVSIEEGIDAYISKFDIS
                     WIDEVNPEEYFKLGSSISGKVIELDAKKQNIKLGIKQLEENPWDDFSKSYKKGDTLEV
                     EIVEKKSKGVQVRVYGKIMGFISKIQLGDTKESSLETFENLNIGDKLKVIITNIDFKN
                     KLVLLSYRAYKEQKSSEEISSYLFKEDDEESYKPFANLLKRNADV"
     gene            complement(124604..125272)
                     /gene="cmk"
                     /locus_tag="BT0_RS00620"
                     /old_locus_tag="BT0128"
     CDS             complement(124604..125272)
                     /gene="cmk"
                     /locus_tag="BT0_RS00620"
                     /old_locus_tag="BT0128"
                     /EC_number="2.7.4.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYS8.1"
                     /note="Catalyzes the formation of (d)CDP from ATP and
                     (d)CMP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidylate kinase"
                     /protein_id="WP_011772089.1"
                     /db_xref="GI:500096082"
                     /translation="MVIAIDGPSASGKSSIAKALGMRLGFKFISSGYFYRIITLIAQR
                     FSLNEYDLLSESKILELVSQNDIKFNGFDFLLNGTNVISHILNERIDFQVSLYSSYIG
                     VRNIVNKKLREIVKLKDDNYIIEGRDITTVVFPEAEVKIYLDASVKVRALRRYNQRSD
                     NVTLNELEQALERRDEIDQNKEYGKLKLDKEVFYIDTSYKCLDDVCNIIIKTFNLKKK
                     VIER"
     gene            complement(125256..126016)
                     /locus_tag="BT0_RS00625"
                     /old_locus_tag="BT0129"
                     /note="pseudouridine synthase; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(125988..126761)
                     /locus_tag="BT0_RS00630"
                     /old_locus_tag="BT0130"
     CDS             complement(125988..126761)
                     /locus_tag="BT0_RS00630"
                     /old_locus_tag="BT0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178556.1"
                     /db_xref="GI:752506691"
                     /translation="MTNLDDYLIVCNDFKGGIEIFFDYIRNKREILKTFNLNKIIEDF
                     LVFSESIEIDVKELIKFYSFSTSLLYLKTQILYPVKLKDKKLVEREMVKKLINFSEKY
                     VKSKSSTRNLKDEKCLNVSKSSFLRENSIFFESVDNVQNYMVGINKVKSKVSRISKKQ
                     DDILRNIKFRSNVILGIYDAKIFDKKTKIIALLTKEDNFIFEFLLNFDDKFYFFERFC
                     YFLIVLEYKMSNIIDLVYLNDKLVLRKGKSIDEYKQQRA"
     gene            complement(126763..127854)
                     /locus_tag="BT0_RS00635"
                     /old_locus_tag="BT0131"
     CDS             complement(126763..127854)
                     /locus_tag="BT0_RS00635"
                     /old_locus_tag="BT0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYT1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecA"
                     /protein_id="WP_011772092.1"
                     /db_xref="GI:500096085"
                     /translation="MSKLKDKIDDSLNDRLNREKAIELARIQIEKDFGKGSLIKMGES
                     PVGKGIESISSGSILLDEAIGVGGYPRGRIIEIFGPESSGKTTLTLQAISEVQKNGGI
                     AAFIDAEHALDPVYAKALGVNIDELWLSQPDTGEQALEIAEYLIRSGGVDLIVVDSVA
                     ALTPQAEIDGEMGDCQIGLQARLMSKALRKITGILSKSKTCIMFINQLRMKIGVMFGN
                     PETTTGGNALKFYSSLRLEVRKIEQVTGSSADDVVGNKVRVKVVKNKVAPPFRKIELV
                     IYFGKGISREASILDASIKYKLIQKIGSWYSIGDDKLGQGRESAIIYLIKEKELTNEL
                     EIKLRKIIFEGLSPDSIEIGPPNVKKDKE"
     gene            complement(127865..130567)
                     /locus_tag="BT0_RS00640"
                     /old_locus_tag="BT0132"
     CDS             complement(127865..130567)
                     /locus_tag="BT0_RS00640"
                     /old_locus_tag="BT0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421911.1"
                     /note="contains N-terminal domain of unknown function
                     fused to transcription elongation factor; GreA is
                     necessary for efficient RNA polymerization through
                     arresting sites; cleaves the nascent transcript and allows
                     resumption of transcription elongation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcript cleavage factor"
                     /protein_id="WP_011772093.1"
                     /db_xref="GI:500096086"
                     /translation="MSNITIERLDNILQEDKWTRIVVNNYSLAKIRELDELIDSIISE
                     NLTEEALDICGKHLKDVKKSIAGLYISGMLIYSRRPLNDMSLLTVVDLFSQNLKWSLV
                     EHICHKMLLTSENKHALYTLAKIYSQNNENDKLPGIWMRIVEADVDDTVCVRQLATHY
                     ENIDLQKSIYFFRKAIYRFIDKKQMSGIREVWSKLIRYVSDDFDSFLLILQKVEKELG
                     FKKVVVLYEDLYEHYSVSENIDETIEILKGILKLDNKNQKARENLVIFLREKYKDVKN
                     IEEYLEKSDLENLDKNFIDVYSDFEKYLFFAKGNFVYHQTWFVGIVKDVNEQGIVVDF
                     VSKRRHFISFDMAMSALSPLKKEDIRVLKAIKPKEELVENLKRDVEWALRIIIKSYKS
                     IDLKGIKRELVPSLMTQSAWNAWSVKAKQILKDNPHFVMASGKADCYIYNERASNFNE
                     KIYDKFKVEKDFYKRYEIFMHYCTAGGVVKDLHVEEEMLNYFLIYVNNFAKVDHYVIS
                     SYVILKSLKNSERGGAFKINIEKDINLDVLLKEYSKNIVDLFDSILNAEIKKELVSLI
                     KDELVDWVVYYKQLFPCYVNKKLIDSLYKEDIKETAHLFNYIIKNYKVYKDAYIWLLK
                     HYTSYSLDLDYSDSELLINLIKILTDSVVKINNKNNSVANKRIYKMVMNLLIKDKYLS
                     IVLNNVMDEELAKRIYMTCFYIRDFPPKDLLHIKTAIRSVFIDLEFEDEKMQSSGDKV
                     EIGFLTILSSLSKKQKELQYLKDVEIPENSKEIGKARELGDLKENAEYHSAKERQQFL
                     TKRLNSLMSEIDFAKVIDTKELQSSVVGFGTKVTMINKDTKREESYLIFGPWESNPDE
                     GIISYKSPFGENLLDAKEGDNLDFVINDTHFQYYVKKIEPAKIN"
     gene            complement(130604..131548)
                     /locus_tag="BT0_RS00645"
                     /old_locus_tag="BT0133"
     CDS             complement(130604..131548)
                     /locus_tag="BT0_RS00645"
                     /old_locus_tag="BT0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772094.1"
                     /db_xref="GI:500096087"
                     /translation="MSSEKIAELIKDIYLSFRKGDFKTALMKSEEAHSLDFDNIEILT
                     ALKSSVYWNGQVESLDRIDKDYEKAEFLIREWNNFARRYLKKMNFDFIQGRNSIKYFV
                     FQLCLEIYKNIYKLQPENLDILIKIAKSYKGMGNYERAITVFLQILGDTKDNADVVAE
                     LADSYALIDEIKEAKVLFREAFFINPQKIDIDALESEMILKLIEAIKSDRNISDTLVK
                     EWIPVYGALNGVFNIKRELRPIELGHLKQSVYSLRNELKEKSYRSINESILLPRLINK
                     YFWLIDHYVRIKEDRVRIDEILSYIKEIDIGIYQQYVN"
     gene            131735..132874
                     /locus_tag="BT0_RS00650"
                     /old_locus_tag="BT0134"
     CDS             131735..132874
                     /locus_tag="BT0_RS00650"
                     /old_locus_tag="BT0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178557.1"
                     /db_xref="GI:752506692"
                     /translation="MEPNKLINKSISYYNSQKYSDVVKLLEKEIFLYKNYYFYHYILG
                     MSYLRMGNLGTAQTYLKKAYTLNPTEPDVKQSIAILLAAQGKEDKAIQIWLKMIEENQ
                     EIQRSEFSLETIRKNPIQGALFLNKNKIYAKLFPEIKVETGQNLSKLIRILLIIASLA
                     FLLIAIFLLIHSKETIKLSLSNSKIKEKKAINNIAAYIDDIKINDKEKIENHEGQFVF
                     ILTETEIKNSFQKIKTHLKQGKDNFARIEINKILNSNASESIKLKAKNLASFISRPNF
                     ITFDDYLVLKEIKKNPLIYSNVYVKWEGIANNIEKKDNITYFDFYVGYNKNALEGIIT
                     TKTTFDIDINFKDYVEILGQIDYDYNTNILTLNAITIRKIEKQKN"
     gene            complement(132920..134290)
                     /locus_tag="BT0_RS00655"
                     /old_locus_tag="BT0135"
     CDS             complement(132920..134290)
                     /locus_tag="BT0_RS00655"
                     /old_locus_tag="BT0135"
                     /EC_number="6.1.1.21"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421914.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidyl-tRNA synthetase"
                     /protein_id="WP_011772096.1"
                     /db_xref="GI:500096089"
                     /translation="MDVRTLKGFRDYLPKEALIRTHIIKQIYSVLVSYNFDLIDTPIL
                     EYSEFLLRKSGDEVEKQTYRFKDNGDRDVSMRFDLTVPFARFMASNRSKLKFPFRRSQ
                     IGKVFRGENTQRGRYREFMQFDFDIVGEDTFRSDAEILSIVYCGLEEIFLNFIEGINR
                     KFVIHFSHIGILNAYIDKLGLKDKATFILRNIDKLDKMGIESVRENLLVQINEEHVDL
                     ILEFINLEGAFWDKLETLKGVLENNDAVKRIEDVFVHLSALGIQDAFNFNLKIVRGLD
                     YYTGIVFEAEMIGINMGSICSGGRYDNLLSLFSSSLQKVSGVGGSFGIDRIQDIIEIE
                     KFNYIKLFVVKASSRVLIVNIDDSLQDYYYKLADKFRRHDYSKINNIACEVYPKSKEG
                     KNIKVQIEYALNKAIRFLIFVGQDEYREDKLKVRDLTKKEELLLSFDEAIKFIKGNDK
                     FLCTPF"
     gene            134433..136310
                     /locus_tag="BT0_RS00660"
                     /old_locus_tag="BT0136"
     CDS             134433..136310
                     /locus_tag="BT0_RS00660"
                     /old_locus_tag="BT0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_011772097.1"
                     /db_xref="GI:500096090"
                     /translation="MHKKFASSLRLNIILIIFLIITLLTIYKYFVLMSSKDIQYFSQN
                     INHISRRGNIYDRNGKIIAFSSKSHSVGTDPNKIKNIVNTSETLGAILKIDPQILKKK
                     LSLKKGFIYIKRKITREESELIKRIQSEGRLKDIILYPDYTRIYPFKELTSNITGFVG
                     TDNIGLTGIELSLNTILNEDLTKQKSINEKLSTNNIYLTIDIDLQKSINQIAQKHFKE
                     NKPENMIAIVMNAKNGEILSMLQFPQYDANYYAKYPKEIWNNFATSLTYEPGSINKIF
                     TVAILLDSGLLKSNEKFLDNGIYQKKFKSGEVVTIKTLNPPYGYIDPSGILIYSSNVG
                     IAHITDKVSNEYFHNKLIDFGFGKRVGFPLPGETKGLLTHHSKWSGRSKATIGFGQEI
                     GVSAIQILQAASALSNEGIMLKPKIIKRISNEMENTIQEFQKEEIKKVISKHTAKEVL
                     KMMREVVNKGGIPKLKMKNLSISAKSGTSQVIDKNTGKYSDEDYTSSILVIYPTEDPQ
                     YIIYIVYRYPKKIIYGTRIAAPMAKEIIELIEHRNNKNEYNEIKISSKISIPKPIIKY
                     EKTETLPNLTGISKRDLMKILKNYTNIKIKIKGNGFVYKQSKPPNTKLKHIDELEIIL
                     K"
     gene            complement(136312..138204)
                     /locus_tag="BT0_RS00665"
                     /old_locus_tag="BT0137"
     CDS             complement(136312..138204)
                     /locus_tag="BT0_RS00665"
                     /old_locus_tag="BT0137"
                     /EC_number="6.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772098.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_011772098.1"
                     /db_xref="GI:500096091"
                     /translation="MSIVKNFFEIAKKRGNGVAQIYRSNKDYFNVTYEDLKNNVLKFA
                     AFLKKMGLGYQDKVFICSENRIEWSVIDFAILALGAVDVPKGADVTLFEAEVIINNVL
                     PNIIIVENLNLLDSVVQINFKVDPIIVIIDDLDEKDKIQFGNFKIYTYKECISIGDKS
                     RRDEEIIEILSNINPDDMATIIYTSGTTGNPKGVMLSHANFLYQVSSFSRMINTSEGQ
                     IFMCILPIWHSFQRSFSYNIFLKGMTCLFSSIVPRNMLDDMKNVNPHYIAAVPRLWIA
                     IKQNIFKEVAKKPFFSKLLFKIFVKSACLNDICYRIILGLYPDNGFDLLFPMKKLLGI
                     LGLIFFFPLRVLGDLIVFKKIKKVLGNNFVVGITGGGSMSLSVVRFFNSIGIELANAY
                     GLTEASPGVASNEHEKIMIGTCGRILPETVAEIRDENGNKLKTPGKGILFIKGPQVMI
                     GYYQDEDATRQVIGSDGFLNTGDIVKLSKDNVVQIIGREKDTIVLNNGENIEPAPIEI
                     KLEESLLIEKAVVVGQDQKFLGALILPNFEEINKYLESMGQKILDAHNRRQIIANNIV
                     LKAINDEIKKLINRANGFKPFEQILRFVLLEKPFEVGKEMSIKMDVKRNYILSFYKNE
                     IKNLFS"
     gene            complement(138360..138653)
                     /locus_tag="BT0_RS00670"
                     /old_locus_tag="BT0139"
     CDS             complement(138360..138653)
                     /locus_tag="BT0_RS00670"
                     /old_locus_tag="BT0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178558.1"
                     /db_xref="GI:752506693"
                     /translation="MYRAEIISNLSLELDLHEHMHRIEKDLGECIYYSKIYNVQGKGR
                     TGEKQGNEIWPEENFILVVYTDNLFIIEKLRNAVEMLDQEYPTEGIRFFVIGN"
     gene            complement(138759..141932)
                     /locus_tag="BT0_RS00675"
                     /old_locus_tag="BT0140"
     CDS             complement(138759..141932)
                     /locus_tag="BT0_RS00675"
                     /old_locus_tag="BT0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="WP_041178417.1"
                     /db_xref="GI:752506552"
                     /translation="MLVKKIVGKPITMLILFSLLMMLSIYTFSRLKIDLLPNIGDSYI
                     TISTQYSGSSAKEVEEKVTSLLEGNLSLVKNIKTITSSSFKGHSSINLQFYHGTNLDL
                     ALNEIRDALEISKRILPKEASLPRIYRGSLGSSPIISFVMYADRPVLELKRYADNILK
                     PRLERLNGVGRVQVIGGGGKHILIEVLQNRLEAYGLTLSEIVPFISSQNVEFSVGNML
                     DNDLEYQVQVSGKFNSIKDLENVVIAYRKPSIYSLGDNSFVQVRLRDIASVKSVAQDV
                     EDYAYYNDKPSIVISIQKQSDANSVFVSDAVNAEVEKIKLALPKDIFLDISYDDAEHI
                     KKAISSVANSAYSGAVLALCIIFFFLRSFRATIIIGITIPLAIVLTFCLMYFANISLN
                     VMSLSGLALSVGMLVDCSIVVIENIYKYRQKGAKLISSAILGTQEMILPIMTATLTSI
                     CVFAPMLIFKAELGVIGDFVRDFAFTIVISLVASLFVAVFLVPVLSSYYVGLYTTSQK
                     PIKNKLIKRIDDFLYGIYFVGERFYVKLLNYVLTWKLACSLIILFIFILSLVLFPLLN
                     VSFLPYERSSLIRFDFKFPHKTSLKIAKFYSDKILEIVKNEIKVYKSIVSEINSNGFI
                     FNVTLPLKEEADGEFVEDEEDIRYRVYKRVEKLYPDFNSNASSRGGFFGASPIEIKII
                     ASDFGYAREYGEFLVSLLKKKFPSLVNPRLNIREEMQIDIEIDREKAYFYGINMETLS
                     REIRANIGGISAGNYIEDGVSYDILLRLDRDNIASFKDLDKISILSASGVQVPFSSIV
                     RLKKTKGIGEISREDQSLVVKLTAGIAPGENLALITANVVDFVTNKVPQRDGVLVKFE
                     GEYSEFTSSMQQFGVIMFMAVLLVFGVMAAQFESFLKPFVILFTIPLTLIGVVPFYFI
                     SGEKVSVFTAIGMLMLIGVVVNTGIVLVDYINLLLKRGFNLKDAVLEAGRSRFRPILM
                     SALTSIIGLFPLAFSSSSESNLVKPIAFTFIGGMVASTFLTLLFIPMIFEIFYKLSIN
                     AFISFKSRGPVDKIDLQGGSRGFSDKI"
     gene            complement(141948..142925)
                     /locus_tag="BT0_RS00680"
                     /old_locus_tag="BT0141"
     CDS             complement(141948..142925)
                     /locus_tag="BT0_RS00680"
                     /old_locus_tag="BT0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772101.1"
                     /db_xref="GI:500096094"
                     /translation="MNSIFNMRGCFKYYLLLLVLLFVLSCNEGTESEVQGDINTNNTT
                     SDFTNEPYRFPVVAMRVRQGALSNYISLNGDVDTKVKVEVFPNITGEIVSLNMKLGAY
                     VKKGQIIATLDPSKPGFLYLKSPVRAPISGYVLAINYKIGETVGTQTSIALIGRMDLI
                     QIKTYVSEKYILDIKVGNDAIIELESYPNEKFKAKISEVSPVLDFKSRSVAIYLEPIG
                     DNARKMIIGMFAKIKLITKHLENVIKIPSHAFVEREGKLCVFRLNPDTKTVERVFPVI
                     DFEIDNIMSIRDGINEGDLVVIEGISSLSDGAYVDIVDIRDGLDVEDNV"
     gene            complement(142938..144182)
                     /locus_tag="BT0_RS00685"
                     /old_locus_tag="BT0142"
     CDS             complement(142938..144182)
                     /locus_tag="BT0_RS00685"
                     /old_locus_tag="BT0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="WP_041178559.1"
                     /db_xref="GI:752506694"
                     /translation="MLSFSSYAEVIKISVEDAIRMALENSLESRDAEYREKIKKLYKD
                     NSWNLLIPNLGFSSNFSRQNSFMPNVEGRGEWNLNFGVAADLSVSPSIVNNIRLTVFN
                     YEAAKIDREKVIKNIRLNVLKMYNELLAFKSILEVLESQFENSKLKFEQVKISYHNGL
                     ISEIDYLDAKLKHIKFQPSLDEQIIKFEETKERFKLLLGLDVLQDFETTGELSDEILD
                     ISLFDEVINIDGYLEVRELNNLTKIMQTTLESLWLDAFLPRFSFSVSYNPGSISFSDG
                     LSGSFKQGLHFSLGLTYSFTEVLPFSKSFTEIWERDYRLKFLENQIENKIREFKSNII
                     QKRKSVRLYKSILDNSKINLEMSKKNYQVAFDSFNVGTIDLIKLNDIEASYKQSDLQF
                     IQDKLNYANAILEYKDLINKLD"
     gene            complement(144427..144660)
                     /locus_tag="BT0_RS00690"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(144614..145510)
                     /locus_tag="BT0_RS00695"
                     /old_locus_tag="BT0144"
     CDS             complement(144614..145510)
                     /locus_tag="BT0_RS00695"
                     /old_locus_tag="BT0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_011772104.1"
                     /db_xref="GI:500096097"
                     /translation="MKGLLISVFISFILILFSCDKNDNSKDNGFKSVRSVKIAYVNWI
                     GETVATNIMKVVFEKIGYNVEILPVTTSIMYQYLASGQVDGMVSAWVPTADKFYYEKF
                     KDKFVDLGANYEGTLQGFVVPSYVTISSISELKGRGAEFKNKMIGIDAGAGTQLSVEE
                     TLKRYGLDKEYELISSSESVMLASLESAIKKHEWILVPLWKPHWAFTKYNIKFLDDPL
                     LSMGGPESIHSLVRIGLEDADPDAYYLFDNFYWGDDLLLPLIEKNYKEPGHEYGNAVE
                     FVDLHKEYVKNWVPDKYKDLFN"
     gene            complement(145547..146446)
                     /locus_tag="BT0_RS00700"
                     /old_locus_tag="BT0145"
     CDS             complement(145547..146446)
                     /locus_tag="BT0_RS00700"
                     /old_locus_tag="BT0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421923.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter permease"
                     /protein_id="WP_011772105.1"
                     /db_xref="GI:500096098"
                     /translation="MNRDFIVANIDKAFNFLVDNFSDSNGIGFAKIVIFFYDNLKKLF
                     LLINPVFFIILICVLSFLFLKKRLALLIMLGFCFILYFNLWEVSMDTISIIFVSVFFS
                     VIWGILIGILGGYYSKFYVFLKPLLDLMQAMPPFIYLIPAIPFFGMGTSSAIFATIIF
                     AMPPVIRYTRLGIIQVPGEVIEAAKSFGSSNIRILFQIQLPLALQSIIEGINQSIMMA
                     ISMIVIAAMVGSSGLGRSVIYSVERLHFGEGLISGLAVVVIAIILDRIMQAIFIKFSY
                     LNTDNYGVKKENKFKRFLEMYNK"
     gene            complement(146453..147571)
                     /locus_tag="BT0_RS00705"
                     /old_locus_tag="BT0146"
     CDS             complement(146453..147571)
                     /locus_tag="BT0_RS00705"
                     /old_locus_tag="BT0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter ATP-binding
                     protein"
                     /protein_id="WP_011772106.1"
                     /db_xref="GI:500096099"
                     /translation="MSKASVKVRNLYKTFSYNKNKKQIVKAIKSYESGKDRSDIYKES
                     SVFIANANISLDVYENEILVIMGMSGCGKSTFVRCLNGIHKIDSGSILVDNIEMNDIN
                     QKALSALRKDKFAMVFQNFGLFPHMNVLRNVTYGLEVKNVPKKIRIQRALDILKLVGL
                     EDSEYKYINELSGGMKQRVGIARALVVNPDILLMDEAFSALDPLIRGEMQCELLRLVD
                     KLKKTVVFITHDLIEAFKLGNRIAFMKDGEIVQVGRPLEILRDPKTDFIANFIKNLPV
                     LNILKIKDIIKMDFTLNGDTDKCNVILEKENNNFNLYDLSVNKKCNNLVSLNLGLDDE
                     IKSVVKYLNKLDYLIIKGEQDDIIGYIDLGEIAGLLAR"
     gene            complement(147701..148705)
                     /locus_tag="BT0_RS00710"
                     /old_locus_tag="BT0147"
     CDS             complement(147701..148705)
                     /locus_tag="BT0_RS00710"
                     /old_locus_tag="BT0147"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772107.1"
                     /note="structural flagella protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin"
                     /protein_id="WP_011772107.1"
                     /db_xref="GI:500096100"
                     /translation="MIINHNTSAINASRNNSINAANLSKTQEKLSSGHRINRASDDAA
                     GMGVAGKINAQIRGLSQASRNTSKAINFIQTTEGNLNEVEKVLVRMKELAVQSGNGTY
                     SDADRGSIQIEIEQLTDEINRIADQAQYNQMHMLSNKSAAQNIKTAEELGMQPAKINT
                     PASLAGSQASWTLRVHVGANQDEAIAVNIYAANVANLFAGEGAQVSPAQEGAQQEGVQ
                     AAPAPAAAPAQGGVNSPVNVTTTIDANMSLSKIENAIRMVSDQRANLGAFQNRLESIK
                     ASTEYAIENLKSSYAQIQDATMTDEIVASTTNSILTQSAMAMIAQANQVPQYVLSLLR
                     "
     gene            complement(148827..150827)
                     /gene="fliD"
                     /locus_tag="BT0_RS00715"
                     /old_locus_tag="BT0149"
     CDS             complement(148827..150827)
                     /gene="fliD"
                     /locus_tag="BT0_RS00715"
                     /old_locus_tag="BT0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772108.1"
                     /note="involved in flagellin assembly; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FliD"
                     /protein_id="WP_011772108.1"
                     /db_xref="GI:500096101"
                     /translation="MSSGFFVPGVDNKYNTKEIRESMLKPDKAKIDSSVKKLENLEQE
                     KRAWQMINKKISTLNSLARQITSLNSPFNYMSGNSSNNDVLSLSARYGAKNETYKIDV
                     NQIASSDIFLSANFKQKEISIPSGDYIFLVGNKEIKIRNNGDIESLVKDINNRGKGFL
                     SAKVVRSDSAGNSRLILRSLKEGENNKLVMKGEALNLAKQIGILSELTTNFSPNLTEI
                     INSQQSSSNKIFLDKDDIVLEPLSEISISIPENIEVSSRSKIKFEIKYYDSDDKGILN
                     EIVFNPGEATFEDAKVEGEDSIINLESDHKLPLKERKYIQMNMIKIHSGTNSLELPPI
                     NVASDFEKVEVEIGSLLDLKEINIENKVNNKVFVIRNIEIFDPKNRDGFLPINAKSFA
                     ENAKVKFDGVDVERDSNTVNDLIPNVTLNLKQASDDTIVVRVEPDYEGIKKLLLDFLV
                     AYNQVLAEINIVSSNESNLEGQKSDVLEEWSYFSDEEREEAYKNLGILRTEFALKNLR
                     SRLELIMFNSYRTNDPNFSIINQIGVFTNSMSSSGGLSRYLGLDEKKFNEIIQSNINS
                     VKELFAVDFNDDRIYDDGLAKMLGDYLSPLISSGGFIYNKIRNYDLKIPNQKNVVEDY
                     KKKYEEREQKVEGELNTLDFTVKRMKEQEEILKSLNLQRQNR"
     gene            151003..152208
                     /locus_tag="BT0_RS00720"
                     /old_locus_tag="BT0151"
     CDS             151003..152208
                     /locus_tag="BT0_RS00720"
                     /old_locus_tag="BT0151"
                     /EC_number="3.5.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-6-phosphate deacetylase"
                     /protein_id="WP_011772109.1"
                     /db_xref="GI:500096102"
                     /translation="MPNFCLFNSKSVLTGNDKIDNSAVLIKDSKIFDIVTADRLEKID
                     LQNYEMIDVKGNYITPGLYDNHIHGFHGYGTDQCSTNSIIKMSQYLAEYGVVGFLPTL
                     YPRPTEEMIETIKACTAAIGKEKGAKILGLHLEGPFFSPEKKGAHPTSYLQQPSIEVM
                     KKFIDAAGGTFTDSFGRKRTNIATMTVAPELKGMRELAMFCMENNITLQAGHTNAKYE
                     NMIEGFQVGILHTTHFFNAMSKLDHRNPNAIGATLIHGDVSCEIIADGHHIHPKLVLM
                     LRKLKDISKLVLVTDGLTPTLQPSGKLIANGEEVYLNDDGLFHIVESDTIAGSALTMI
                     QGIKNLVEFGYSLSDAIQASSYNPIRIINLEKKGLICHGYDANINVLDKDLDLKLTMI
                     ESKIIFNKL"
     gene            152241..153044
                     /gene="nagB"
                     /locus_tag="BT0_RS00725"
                     /old_locus_tag="BT0152"
     CDS             152241..153044
                     /gene="nagB"
                     /locus_tag="BT0_RS00725"
                     /old_locus_tag="BT0152"
                     /EC_number="3.5.99.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772110.1"
                     /note="catalyzes the reversible formation of fructose
                     6-phosphate from glucosamine 6-phosphate; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosamine-6-phosphate deaminase"
                     /protein_id="WP_041178418.1"
                     /db_xref="GI:752506553"
                     /translation="MRLIIRSNYNDISKWAANHVAMRIKKFSPTKEKPFILGLPTGSS
                     PIGMYKHLIEMNKLGKISFENVVTFNMDEYIKLDKNHPESYHSFMWSNFFSHIDIKKE
                     NIHMLNGNATNLINECEEYENKIKSYGGIMLFVGGIGPDGHIAFNEPGSSLSSRTRIK
                     TLTQDTIIANSRFFENDINKVPKSALTVGVGTIMDSKEIMIIVNGHNKARALKHAIEK
                     GVNHMWTISALQLHKNAIIVSDEAATYELKVGTVKYFNDIERDNFNNDI"
     gene            complement(153137..153748)
                     /locus_tag="BT0_RS00730"
                     /old_locus_tag="BT0153"
     CDS             complement(153137..153748)
                     /locus_tag="BT0_RS00730"
                     /old_locus_tag="BT0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772111.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="WP_041178560.1"
                     /db_xref="GI:752506695"
                     /translation="MFKLPELGYAYDVLEPYIDAKTMEIHHSKHHNAYTVNLNSVLEK
                     TEINYSQDIESILKNIQRFPKEFQAAIRNNAGGYSNHTLYFRILRPGNKDNILENFEE
                     HVNATFGSLDNLKMALRDSAINVFGSGWAWLVLHASKELQIISRPNQDSPLMEDYKPI
                     LGIDVWEHAYYLKYQNRRVEYIDAFFKVLNWEEVSRVYNEIVE"
     gene            complement(153762..156458)
                     /gene="secA"
                     /locus_tag="BT0_RS00735"
                     /old_locus_tag="BT0154"
                     /gene_synonym="azi; div"
     CDS             complement(153762..156458)
                     /gene="secA"
                     /locus_tag="BT0_RS00735"
                     /old_locus_tag="BT0154"
                     /gene_synonym="azi; div"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772112.1"
                     /note="functions in protein export; can interact with
                     acidic membrane phospholipids and the SecYEG protein
                     complex; binds to preproteins; binds to ATP and undergoes
                     a conformational change to promote membrane insertion of
                     SecA/bound preprotein; ATP hydrolysis appears to drive
                     release of the preprotein from SecA and deinsertion of
                     SecA from the membrane; additional proteins SecD/F/YajC
                     aid SecA recycling; exists in an equilibrium between
                     monomers and dimers; may possibly form higher order
                     oligomers; proteins in this cluster correspond SecA1;
                     SecA2 is not essential and seems to play a role in
                     secretion of a subset of proteins; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecA"
                     /protein_id="WP_041178419.1"
                     /db_xref="GI:752506554"
                     /translation="MLRAIFEATIGSKSKRDLKSYFPVLRTINKLESWALSLSDEDFA
                     METEKFRDELKEGKTLEDILERAFALSREAARRRLKERPYDVQLIAGLALHQGKIIEM
                     KTGEGKTLSSVQAAYLNSLTGDGVIIVTVNDYLAERDSNWMKPVFELLGVSVGVVLSN
                     MDSARRKVEYDKDITYVTNNELGFDYLRDNMCFDLSQKSLRNFNYCIIDEIDSILIDE
                     ARTPLIISGSTEGDTSAYLEVNSLVSLLKECSKDPKTGDYPLEIDELDGDYTIDEKGK
                     RVSFTANGLNNLEQILVSKGIIKGSMYVDSNFNYVHYMTQALKAHLLFLKDREYIVGD
                     SGVEIVDEFTGRILKGRRYSDGLHQAIEAKEGVKVASENKTMATITFQNLFRMFKKIS
                     GMTGTADTEAKEFHRIYNLDVIVVPTNKLVARIDEDDIIYYTEEFKFKAITDEVYEAY
                     KKGQPVLVGTVSIEKSEILSNMFKNKGIKHEVLNAKNHFREALIIAEAGAKHSVTIAT
                     NMAGRGTDIKLGGNLEHRVRKKFGTGMSLEEFQKAMQSEREQYLEDYEEVKALGGLYV
                     IGSERHESRRIDNQLRGRGGRQGDPGRSRFYVSLEDDLMRLFAGDNLRALMGKLGMAT
                     GEPIAHSLLTKSLVNAQKRVEDRNFEIRKHLLEYDDVITKHREFIYSQRNLILVDNNI
                     KERVLLSLREYLDFLFDQVKGEVVTSSVLNEINSIFAYMMESVGSIETMNIVDLKNKL
                     MEIARANLDAKEELIGVEFFNEFLKHEYLRNIDSKFQDHLANLDSLRESVYLRSYANK
                     NPITEYKEEGFAIFSELVKDIKVETLRRTLQVRVDVDSSGYKNKKPKNVRATHKEFSG
                     IASADKGNTVGVQIIRSTPKIGRNEPCYCGSEKKYKNCHGKS"
     gene            156522..157655
                     /locus_tag="BT0_RS00740"
                     /old_locus_tag="BT0155"
     CDS             156522..157655
                     /locus_tag="BT0_RS00740"
                     /old_locus_tag="BT0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772113.1"
                     /db_xref="GI:500096106"
                     /translation="MKKFYKIHLNLLFMIISCNIKTLNELGEQQFKIPFGTLPGEITP
                     LVNKFTNSSFDIKTYNGLVYIVEAKANKLMIFNSYGKLIQTYQNDIFKTNSDLKIKKV
                     DFENIKAIYPSKDFIVVSDKLNNKKSKFDEKENIAYSTRIFILNKDSSVEVLGQEGRN
                     GTLFPQVYDINIDDKNNIAIITISNEGYIIYSYDKELSPLYKIYVNTNILQIPEEEKK
                     KYNISIDKVFFEVNKKIIYVKTTHYENIRTNENINDLGVRIKNQYFYTMLLNKNKEFE
                     IKNKITLPQNLLDDQQESFINIIGIQKDKIIASTNMRNLSNTLIWKLDNKGKIKEQMV
                     LIEPPNLKFLAESLSKDGILSILYGEKSGVSVYWWNLNTLLKL"
     gene            157678..158103
                     /locus_tag="BT0_RS00745"
                     /old_locus_tag="BT0156"
     CDS             157678..158103
                     /locus_tag="BT0_RS00745"
                     /old_locus_tag="BT0156"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772114.1"
                     /db_xref="GI:500096107"
                     /translation="MRNKNCKSKIQNNHKQRLKKNLTLGIIFVIMLIIIKIVFIPKLQ
                     KLESKYRPTITIEHKIKNENLYIKINIKSQNIKNLGKANIEVYLDNKLIENNMIYIDK
                     INYTLYTNVAYRKEGLLNIVLINQKGDKAYFSKRLDLGG"
     gene            158107..158523
                     /locus_tag="BT0_RS00750"
                     /old_locus_tag="BT0157"
     CDS             158107..158523
                     /locus_tag="BT0_RS00750"
                     /old_locus_tag="BT0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772115.1"
                     /db_xref="GI:500096108"
                     /translation="MLQIYFISVLLNILGGIVLAFPILGERFKCLIIFEEFINLINNN
                     KNVRSIFGTTFLIASIFEIIIPYDLPIIGNLFPAISLFFIGFILFLSQKIPTSLQNNK
                     EYGKFKSLIESNKKVIGILALIIGIIHFFAPRVPFL"
     gene            158669..159769
                     /locus_tag="BT0_RS00755"
                     /old_locus_tag="BT0160"
     CDS             158669..159769
                     /locus_tag="BT0_RS00755"
                     /old_locus_tag="BT0160"
                     /EC_number="5.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="WP_011772116.1"
                     /db_xref="GI:500096109"
                     /translation="MIKNKEIIINLKNLEYNLTAIKNHIQKRELVATLKADAYGHGLI
                     QTFKFLKEKGINYFGIFWIDEALKIKKIDKRANVLLYINTDKSAIKNLVKFDITPFVA
                     DSQYLSLIEQECRKQNKKIKVHLKVDVGMNRYGIKIENALNLAMQIQNSKLVEFEGVC
                     THLPTTENRKITQAQIEKFVHFINELKTKNIKPKFIHASNSEHITNYPISEKFNMVRP
                     GLILYGYHPNSNSLNNNLQLKPVLSLYSKIIFLKKIKKDEQISYSGLFTAKEDMQIGL
                     LPVGYFDGIPQNTSNNFYCIIRDKKCFIRGKICMNISIIEIPKDLKINIGEKVEITSE
                     RLSLDILSKESGMSKYEILCSIGKHEKKKYLY"
     gene            complement(159761..161356)
                     /locus_tag="BT0_RS00760"
                     /old_locus_tag="BT0161"
     CDS             complement(159761..161356)
                     /locus_tag="BT0_RS00760"
                     /old_locus_tag="BT0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178420.1"
                     /db_xref="GI:752506555"
                     /translation="MFLVMFFVSCVLFSEEIYYRFADYDVNYRIIGKYEISKENAEEE
                     CGYKFTYDDGRLVFIDYVGKLSILIPSFFGANQIKIEYSDDIERRLFLNGGFAAKNLK
                     DVYVEQVEYFPNGRPKSIFNYNKSNEIIRDKYGIAYYHFIYNDDSSFYVYRFSEVGFQ
                     IKDLNNVYYTKIIYDDSDRRKTVLYYDDNNYNIKAKNGIYGFRLTYDSSHNIIREEYL
                     DPVASLYANPFSVAIKTYRYDFDGKLIEILNYDIKNNLTPDENNVAIYRYEYNLKEKD
                     YFYKEYNYDANNNLTVSQNGYAMRKTIFYMQNNEKRVINHSNRINKNYNSDIPASYEE
                     KYEIMNNFKGIAVYSYKYDNKFYLIENLFFDKNFNLISDSNGVMIYKYAYNDDGLLKS
                     QEHYGDFDNPIDDFAGVFRYKFAYDVNGNLILKSNYSKSGVLVADRSAIFEYAYEYDK
                     QNRLISQKNFGNLGQLQDDVHGVSVYKYEYNKFGKISKKTNHGPDLRLRDDIGGISVY
                     KWIYDSKGNLVDFQKFDSLGNLI"
     gene            complement(161602..163350)
                     /locus_tag="BT0_RS00765"
                     /old_locus_tag="BT0163"
     CDS             complement(161602..163350)
                     /locus_tag="BT0_RS00765"
                     /old_locus_tag="BT0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772119.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772119.1"
                     /db_xref="GI:500096112"
                     /translation="MKKLPEIFYLNDKEVDILISQIGISSDTQKMILRIILEHKHNII
                     DYANFIEDYSVKIRALKGELDFLFRKLYEVKRGIIINQSTSNGEMVPYKIIITDENSY
                     DFYYYAIEDLFLKHYVGIELFSTLLTIKNIDKNLLVFEKEFVILSNSDINLKYFQENS
                     SSKKIFVLDSLIIPSGKALYFIEFMKRILFGIASNRIVKDVFMRAKNVKLSEYDRMLD
                     EGINGVGVAYNLLLGILENKEEILNKKGVNISKHYFTFLEVLNIYITNEKNLEELKNL
                     ESIKIDETLKSIEKTIEFKPRFINIEEFKNILQEHAEVLSDSEYFLKTANEYFFESSI
                     KGSLPKIFSIKSGMYLYKPCAYSMFLKEFDQILVDIRDKLRNDFVKVFNSGKNSSTIL
                     TEEGLEKTLIEFIANYDINDYCLKNKVAFLDFIVSHYKRVSKTQNIQTHLKDIIKTEA
                     AKYFKNSNTFLPLYKIYKVDLSNLLDSAYRDLPLLKRLVLFLTGRQQSYKEALSRLNS
                     KIVVKDHAELFDPNERVKRQLDKRRKQREELREQIRSSYVRKGKTPKEATFNRAYTKS
                     EQDEAWLKFEDKLNKK"
     gene            complement(163422..164399)
                     /locus_tag="BT0_RS00770"
                     /old_locus_tag="BT0164"
     CDS             complement(163422..164399)
                     /locus_tag="BT0_RS00770"
                     /old_locus_tag="BT0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton exchanger"
                     /protein_id="WP_041178561.1"
                     /db_xref="GI:752506696"
                     /translation="MAHIHLFCVIFGIFLLYLGGNYLLNSSVNIATYFQVPNLLIGVV
                     IVSLSTSSPELFTSLIASLKGKNEIIVSNIIGSNIINMLLALPLTGVFLRIKTDFKRL
                     KFSFIILFLLMFLLLLFSFDFGTLSFFKVPYHRTSSLVILILFLSYLFLFYKEEKKYN
                     SVPKNLENFNCNYGFNFLFLNTLLLLLSIYFLYFGSKLLIDSSIYIAHNVFNISEKVI
                     GIIFVAFGTSIPEIVVSLFAVIKKESDIALGNIIGSNIFNIGFILSSSSFVNPVLMSD
                     IYLADFSIMFVVSLMLLFIVRFRGAFSRGPAILFLCLYILYNSFLFGVF"
     gene            complement(164422..166272)
                     /locus_tag="BT0_RS00775"
                     /old_locus_tag="BT0165"
     CDS             complement(164422..166272)
                     /locus_tag="BT0_RS00775"
                     /old_locus_tag="BT0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772121.1"
                     /db_xref="GI:500096114"
                     /translation="MKLNTCIMLLYIICLLFSYFFLCFHLHSLDETKYFKNSDLFFIN
                     KGALYKKHNDVIFKVEPKGLETRWIYPFARPVSKRITSIYEDFYSSNSLLTTNDSVYV
                     SHNYFKSFIKLVDNEKFNKNSYITSSALSRGEYKRIAVGTSNSGIYLSVNDNLDFKSL
                     NSLISKTYLGAGYYDMVSAIEFSRNNANELYFSCGIYGDIILINTTLGVVRKLDFPFK
                     KQIVRIIDLSDAKIEKLLVRTYDNHFYSYVDGKWTFDGQFSVYGENSIEKLERMHLAS
                     NKGSIYLTAYTLRSKTAIDERFEFIKRLGMNAVIIDFKDDSGILTYASKLALPNKIKA
                     VKNLIDVPYILNKARELGIYVIARVVVFKDAKLYFYNNYEYALWNKKTNQPWANLVKV
                     EHGDSFKFVQKEHWVDLFLQGTWDYNLSIAKEIQSLGVDEIQFDYIRFPTDGPVSLIT
                     SRFNKYKMRAIDALESFLIMARKNISIPISIDIYGNNGWFITNSIGQNISMIADYVDV
                     ISPMFYPSHYTNDFLKNELYYTTRAYKIYKEGSNRAAVFSSGKVIIRPYVQAFLLGSE
                     RRVSKEVYLKYFFHQLRGVKESLGNGFSLWNASNIYYMVKSDLSEFLNFS"
     gene            complement(166360..167841)
                     /locus_tag="BT0_RS00780"
                     /old_locus_tag="BT0166"
     CDS             complement(166360..167841)
                     /locus_tag="BT0_RS00780"
                     /old_locus_tag="BT0166"
                     /EC_number="2.4.1.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421940.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-alpha-glucanotransferase"
                     /protein_id="WP_011772122.1"
                     /db_xref="GI:500096115"
                     /translation="MKRKSGILLNISSLPSKYGIGDLGRGAYKFIDFLADSSQGYWQI
                     LPYSPPSFLEFPYSSYSAFAGNINYIDLNAIDRFIDIDLGTFECLEDRYVDYDKLKAK
                     EVILRNAALNFLHRATIDEIHAFEKFKKSAAYWLLDFSSFVAFKEYYSKFQSSQAFNL
                     LFSREILKRDAKALAKLRETLEVEINIQQVLQYFFFSQFKALKKYANNAGIKIVSDIP
                     IFVSYDSADVWAHQKYFKLRFDASKDKVTGVPPDCLFSKKYLWGNAAYNWKALRKDDY
                     VWWINRIDFLRKYVDIVRIDYFRGFVSTWEVSAEESLLFGGQWVKCPGKDFFKQILNE
                     INDLEIWVEDLVKDRGDTFRLRDYFGFPGTKMMQCAFDFDSANIYLPHNYIRNCVVYT
                     GTHESNTIRGFINSVDNEHKKYIFDYFNTSENAIVWDMIRGAMASVANSVIIPMKDYL
                     DLVADFSMNISDAMLNNFRILSGDLSDDLSKKISDITKLYGRT"
     gene            168002..169159
                     /locus_tag="BT0_RS00785"
                     /old_locus_tag="BT0167"
     CDS             168002..169159
                     /locus_tag="BT0_RS00785"
                     /old_locus_tag="BT0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421941.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772123.1"
                     /db_xref="GI:500096116"
                     /translation="MNIKIVILLFLANTLAFSSEILEFKYTKGAKFRIETTDNQEIYL
                     NGRFNSKTKTNIQVSSEVKDVKNNFADIKSYFRVLKRDNESDVYLLKEEFEGNFSINK
                     QGEYKINNAQKRPSVRGIPRFPKTPIKVNETWTYPAEEYIQASEISQEIKDFVTKFDV
                     NYVYKGKEKIDGKYYDIILSNYKSKYNVKNILFSQKVNQIIYFDSKLGNIYKYNDTYE
                     FQMQNDNNNIKMTGNSFGKIISIELPNDNIIEHEVKEYISTKQIDSINIEKNENGIKL
                     SLDIEFYPDSFQIIKKEYNKLKHIANLLEKFKDNNILIEGHTAKFGTEQEMQELSEKR
                     AHSIGNYLLKMKVKNKNQIFFKGWGAKKPKYANSSPLASKNRRVEITILNN"
     gene            complement(169163..169546)
                     /locus_tag="BT0_RS00790"
                     /old_locus_tag="BT0168"
     CDS             complement(169163..169546)
                     /locus_tag="BT0_RS00790"
                     /old_locus_tag="BT0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_011772124.1"
                     /db_xref="GI:500096117"
                     /translation="MQKSNFEHEFVEKMRNFLLESKKEILNSIRSVEDSKREIINNDM
                     HLKDIIDIAFDNMDGNNLEALSSVEKKKLHLINQALYRISQNTYGNCLACDKSITRER
                     LVAIPYAFLCISCQTKKEKKGKRSI"
     gene            169714..169935
                     /gene="infA"
                     /locus_tag="BT0_RS00795"
                     /old_locus_tag="BT0169"
     CDS             169714..169935
                     /gene="infA"
                     /locus_tag="BT0_RS00795"
                     /old_locus_tag="BT0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421943.1"
                     /note="stimulates the activities of the other two
                     initiation factors, IF-2 and IF-3; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_011772125.1"
                     /db_xref="GI:500096118"
                     /translation="MNTKEEAIETEGIVKESLPNTMFRVELKNGHLVLAHLSGKMRKH
                     FIKIVPGDRVKVELSPYDLTKGRIVYREK"
     gene            complement(169983..171983)
                     /locus_tag="BT0_RS00800"
                     /old_locus_tag="BT0170"
     CDS             complement(169983..171983)
                     /locus_tag="BT0_RS00800"
                     /old_locus_tag="BT0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178421.1"
                     /db_xref="GI:752506556"
                     /translation="MVISLVLFFINFEIYSLSGTDYLVSTKVLQGSKVVHVIRLNLSQ
                     DIDESSLKFEISKDIKDNTEIASISKVPDGNNIVTEIKIEYGFDKLGFVKIPSLKIVY
                     LGEVYLSSEFEVVVLKEDESQFFGLPVRLYWDFDKEEIYEYQSIGFVLRVNWLVNNNL
                     KSIASSFNAVKDAMIDRTPIFENIKYRTFNSKEILDVPLYNFILTPLRGSKGIVIPSV
                     SFNIGENVARMSPGISLKIKPIPDEVKSLAVGTFKIDYEFPNSTLINQDTFTVLIKIT
                     GQGNLPHIRFPEIETYNSKVIYNKKNYNFEPSKDGYKGSISKIYTLKPDNKGNLFLNI
                     GDFTYLNPDDGKVYKLDGKRLKYEYYGEFKNNNDSGQELLSDFSLLSYHDILKHRNKT
                     FLFFVPVYYLILIPGILFSLAVFIRYKKFFIASGCGLVILILTLAVSLNAMNDGSLSE
                     DNINDLIEDYKSKNYDNALNRVDNILKKNPSYSGLWLNRALILNKMDRYFDAIYSAYK
                     AFFTSPSNDTFYKVIDFIEAKNGVNENIRNNSFVWSNIFFIISLILINSLIVIISYKF
                     YAKNLKRIILFLLLSVTCFTLFQTYYFYVDQQSEIGIIKGDLVSLYKVPDNFSRSWRF
                     LNGNISVYVLNRKDDFVLIQTSHGLQGWIYKNFIVSVKDSLI"
     gene            complement(171977..172564)
                     /locus_tag="BT0_RS00805"
                     /old_locus_tag="BT0171"
     CDS             complement(171977..172564)
                     /locus_tag="BT0_RS00805"
                     /old_locus_tag="BT0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421945.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772127.1"
                     /db_xref="GI:500096120"
                     /translation="MGRNFLICFLMSLMFASFLSCSNIRAMSLMAIGNYEYIRGDYQG
                     AISTYYDLVDDKQGTSWGYYNLGIVYYSLGEYESSLRMFSYAKRDNDSFLNFNINYNE
                     GIIYYNQGLYRKAEVAFKEALRINPASYNAKYNLELAIIKKRSIPDDLDSLSVKRSQN
                     FIENNENFLRYIENLERVLWVTRSEEQTVFLREDW"
     gene            complement(172546..173535)
                     /locus_tag="BT0_RS00810"
                     /old_locus_tag="BT0172"
     CDS             complement(172546..173535)
                     /locus_tag="BT0_RS00810"
                     /old_locus_tag="BT0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="WP_011772128.1"
                     /db_xref="GI:500096121"
                     /translation="MSIGNYYAFYLFIILFLVLFLYIYNFRKALPLFKTLSLMYVNNA
                     YIKNYYIKKILMMFFFVLSLGSLIVSILDISWGQKATEDKRSNLRISFVVDISRSMLT
                     FDEEKSINRLESAKNFISLILNNFENVEYSLTIFKGKSLLVLPFSKDKASLHKILNYI
                     EPNLISSPGSFLGEGVFSAIQGIKDDSYYNFLIILTDGDEWGENNYYTFPKLIDALNV
                     TSFVVGIGSDKPSPLIDNNLSVKDKDGNVVKAVLDEDNLYLLTSSLKGSYYNLYLKGT
                     NYVINEIRNDIMKKSSSDILLIGILRYKLFLAISFLFIVLYLFVKVIKWDETF"
     gene            complement(173532..174533)
                     /locus_tag="BT0_RS00815"
                     /old_locus_tag="BT0173"
     CDS             complement(173532..174533)
                     /locus_tag="BT0_RS00815"
                     /old_locus_tag="BT0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178422.1"
                     /db_xref="GI:752506557"
                     /translation="MLTFNEPLYLFLLIILPFIIYFGHFFKRRGGKVKFPISIYGNLG
                     SIKLRDYGLNLLYFITYAFFYLAMTVMILTLAGPSISKKKTTYLSSGADIVIVLDISP
                     SMGAIEFSSKNRLEFAKELIKYFVYQRENDNIGLVAFAKEASLIVPLTIDRDFFSKKL
                     DDIYIMDLGNGSALGLGISIALSHLKHSEAPKRSVIVLTDGVVNSDEVYKDQVINLAQ
                     GLNVKIYSIGIGSSEELSVGFKLRSGRFYQGTLREIYDPSMLFEISGKTGGLFYSVGD
                     DFSFKLAIQDFSKKENVERKVKIAVDNDDIYNEFLLVIFFLLILYFILSKVFLKEVL"
     gene            complement(174520..175419)
                     /locus_tag="BT0_RS00820"
                     /old_locus_tag="BT0174"
     CDS             complement(174520..175419)
                     /locus_tag="BT0_RS00820"
                     /old_locus_tag="BT0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772130.1"
                     /db_xref="GI:500096123"
                     /translation="MKNIIVFIMSFLSFYLFSYEIKNEIFIPTRYYVGDTVELKFSLI
                     LGENEKFIPAEFEEIKNEFVEVNSLLYRPESGEVIIYFVSFYVGSNTLPRIYVGDIIS
                     NDKSFKLILNNVKINTSKLIADDDVLKIQDIEGVLFLPGTSTYLVIFILALVVVPYFF
                     IKFLKLVKHLLVFLIMKHNLRKPYKVFQKQMIILSNYIKSDEEHVVFYNLLNSSLRVY
                     LSKKTGFDFNAITTTEISEILQNFNVPYEIRSTFVNMLRLSDFSKFSGMNLSGGNLSL
                     VLDDLREAAFNFEEFNRGDNVNI"
     gene            complement(175416..176297)
                     /locus_tag="BT0_RS00825"
                     /old_locus_tag="BT0175"
     CDS             complement(175416..176297)
                     /locus_tag="BT0_RS00825"
                     /old_locus_tag="BT0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772131.1"
                     /db_xref="GI:500096124"
                     /translation="MQYDNESNASTKNKIKALKFFSRKMLLELNFGGYRSIFKGLGLE
                     FHEFRPYEETDDARLIDWNVSSKTDSIFSKVFREDKGMNLHLLVDNSLSMSLGSLTSK
                     KEIQDLLVSIFAHMAFFNNDKIGITFFSSETDKFISSRKGHSHLGRILNETINRRIKR
                     GSNLTYVFKNTAEYYKKRSLIIIISDFKASDYFKSLTVLSKRHNIIAIRLTDFFDENL
                     PQYGVLTYEDIETCEDFLTSGFSKTILNSYKNYWTLDKIKWRKECIKRGINFIEISTK
                     DDVFRKLKALLKKENDI"
     gene            complement(176313..177305)
                     /locus_tag="BT0_RS00830"
                     /old_locus_tag="BT0176"
     CDS             complement(176313..177305)
                     /locus_tag="BT0_RS00830"
                     /old_locus_tag="BT0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_011772132.1"
                     /db_xref="GI:500096125"
                     /translation="MKSSFQIDSEVENALGLINKFRREVASRILGQREMIDAILMGIL
                     TEGHVLLEGVPGLAKTLTIQTVSDVLDLGFKRVQFTPDLLPSDLTGNMVYKSTTGTFK
                     VRKGPVFSNIILADEINRAPAKVQSALLEAMSERQVTLGDETHKLPDPFFVLATQNPI
                     EQEGTYNLPEAQLDRFLLKVNVKYPSIQDEIKLLKIFSVDGGLENIKVAKIMNAYSLA
                     DLKRTIGKVKVDDKIMLYIVTLIAASRENDKKTYPFTKYIEFGASPRASLSLLKCARV
                     NALYEGRLFVLPEDVKAVAYNVLRHRITPSYEAEVEEMNTDDIIKILLSAVALP"
     gene            complement(177376..177999)
                     /locus_tag="BT0_RS00835"
                     /old_locus_tag="BT0177"
     CDS             complement(177376..177999)
                     /locus_tag="BT0_RS00835"
                     /old_locus_tag="BT0177"
                     /EC_number="2.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYX2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011772133.1"
                     /db_xref="GI:500096126"
                     /translation="MMNDFELSLKSLGVSFTSKSIDKLRFYIEKVLLFGTRFNLVSNN
                     DRNFDAVLLHVLDSVAGLPIIKDKNPRQVLDVGSGAGFPGIVLALFDNFRKYILLERS
                     NKKATFLRMISLELGLDNIEVLERDVDKEQNKYEFITIRAFRDIREYARILKLILKDG
                     GLIVAYKGKLNKIKFEVSHIESLFNKIEIKSSTMNDGKERNFLLLYK"
     gene            complement(177996..179858)
                     /locus_tag="BT0_RS00840"
                     /old_locus_tag="BT0178"
     CDS             complement(177996..179858)
                     /locus_tag="BT0_RS00840"
                     /old_locus_tag="BT0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA uridine 5-carboxymethylaminomethyl
                     modification protein"
                     /protein_id="WP_041178562.1"
                     /db_xref="GI:752506697"
                     /translation="MDFDAIVIGGGHAGIEASLALSRLNFKTLLITQNLDTIGKLSCN
                     PAIGGLAKGNMVREIDALGGEMGCLVDFSMIQFRILNKSRGPAVQAPRAQADKLVYQV
                     KAKETLERQINLDLFQDTVSDFLLNSMRNRIEGVVTERGNKFTSRVVVLTTGTFLRGK
                     IFIGEYRACMGRISEPAAYGLEKILLELGFEMGRLKTGTPARVHRKSINFAKTEIQFG
                     DSDIIPFSFSNTKIDKVQLSCYITYTNKKTHAIISDNMHLSPLYSGEIIGNGPRYCPS
                     IEDKIVKFKDKDKHQIFIEPEGLSTEEMYLNGLSSSLPEDVQKRLINSIDGLENAVIT
                     RPGYAVEYDYINPIELYASLETKRVKGLFVAGQTNGSSGYEEAAAQGLMAGINAALKL
                     QGKDPMILPRTSSYIGVLIDDLVTKGTKEPYRMFTSRAEHRLNLRHDTSDKRLIKWGY
                     EVGLVSEEKYSRYFFKEKQVEEIKELLRQRRLKEREASTLQLKKHISKDFYHIIKDPY
                     INLSDLIDIDPKLNASKVILEQVELDIKYEGYINRQKDLIRKMNNLELIKLPLDFDYE
                     IDGLSREAREKFVKIQPANLAQASRISGVRNTDIQVLLIYFSSPKNKVVLNLAL"
     gene            complement(179867..181261)
                     /locus_tag="BT0_RS00845"
                     /old_locus_tag="BT0179"
     CDS             complement(179867..181261)
                     /locus_tag="BT0_RS00845"
                     /old_locus_tag="BT0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYX4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA modification GTPase TrmE"
                     /protein_id="WP_011772135.1"
                     /db_xref="GI:500096128"
                     /translation="MSNLFQREDDIVALATPLLSSALCVIRSSGISSIEKFSKMFSDP
                     KRLLEASGHTIHYGYLIDKEICEKLDEVVVCIYRAPKSFTGQNSIEVMAHGSPIGIKR
                     IIGCFLKVGFRMAEPGEFTLRAFLAGKLDLTKAEAVNELISAKTNKTHSLAVNKLSGS
                     LFAKIDLIKKDILNFLSALSVHLDYETSEYEVAIPFEIISKSRDELKRLVDSYNTARK
                     LDYGIALVLAGSVNVGKSSLFNLLLKEDRAIVSSYAGTTRDYIQASFEFDGILFNVFD
                     TAGLRETTDFVEQLGIVKSNSLIKEASLVLYVIDLSARLTNDDLKFIDSYKGHSKVIF
                     VLNKMDLEPNRQTVEFFNSGNINSSNLVKISTKTLFGIDSLYDKIRSLTCFDYIDIDA
                     YDVIVSSSRQAELLKKAYTLIIELLNKIEKDISYDMLAFDVYEVLNFLGEITGEVTSE
                     DVLNNMFKNFCLGK"
     gene            181397..181891
                     /locus_tag="BT0_RS00850"
                     /old_locus_tag="BT0180"
     CDS             181397..181891
                     /locus_tag="BT0_RS00850"
                     /old_locus_tag="BT0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlbF"
                     /protein_id="WP_011772136.1"
                     /db_xref="GI:500096129"
                     /translation="MKTKLETELKNTLQEEVLLVEDIYNMYLNIKRYLDEKNEKMFKE
                     AINKTNIYLHKFKDIEHKRDELWKNFTDLEKFESTYMAIEKLCLVYKKEIYNYFHRLR
                     IGILNIQNLNYLISSYTETSLGILDLIFKDAQESVDNITYKNPYGPKSGSLNETSVLI
                     NKKL"
     gene            181910..183793
                     /locus_tag="BT0_RS00855"
                     /old_locus_tag="BT0181"
     CDS             181910..183793
                     /locus_tag="BT0_RS00855"
                     /old_locus_tag="BT0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgK"
                     /protein_id="WP_011772137.1"
                     /db_xref="GI:500096130"
                     /translation="MDSTFSGIEIGKKSLFAHKDAMNTIGHNLTNTSKPGYSRQRVIM
                     KTEIPIYAPQLNRANKVGQLGQGIMVQSIERVRDDLLDIKIAEESHRLGYWSSKDKFI
                     SLLENVYNEPEEQSIRKRLNDFWDSWQDLSKQPQGLAERNIILERGQSFAEVVSNRFH
                     SLKRIYTMANDEVKITTEEINNYLRNISDLNRQIAKAIAMKDQPNDLMDERDLIVDKL
                     SNLISISIENKRDPNEFLIYVEGKHLIQGAIANEFILEAANGPTGTKWNVLWNNGEPA
                     NINTGKLGALINVRDNEIKNEINEIDNMAINITELVNEVHVSGHGLDQKNGRIFFDQE
                     YKLTDERGRYDSNGDGQFDSVHIFKINSTNEIFPEENLGFSGILKFQAINKNDFIEIP
                     YNTTDTVQDVINKINNSNSQVTARINAEGKFEIKAIKEEENDSAIFRIRYIEDSGLFL
                     TTYTGILNASGTEGAYNYQDVNTTNQLINTVSYSIAPLKNPAAWLKVSREIAEDPSKI
                     ASGIKTPTNNAPIGDNKAALRIASFVNSQIMIGKNATLNDYFANTASNIAIKGQTAEI
                     TKNSQEQILKNLTDLRLSISGVNKDEELANMIEFQQSFIAASKFITVSAELIDTIINK
                     MGV"
     gene            183797..185071
                     /locus_tag="BT0_RS00860"
                     /old_locus_tag="BT0182"
     CDS             183797..185071
                     /locus_tag="BT0_RS00860"
                     /old_locus_tag="BT0182"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772138.1"
                     /note="With FlgK acts as a hook filament junction protein
                     to join the flagellar filament to the hook; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgL"
                     /protein_id="WP_011772138.1"
                     /db_xref="GI:500096131"
                     /translation="MINRVSHPLTYDNLKTSSTDKEVKITKLLGSLYQGGKRITNLRD
                     DPTGVTHAIRLDSDIFKLNTYVKNINSAKGKLRYMEGYLQSLANILTRAKEITVQGAS
                     GTYKTDDKKIIAKEINAILEDVLAIANVKGADGYSIFAGTKIDNEAFKVIRENRINKL
                     TQDKAETQIVRIDYNGNQAEQTTEIYNGIYIPTNYPGSEIFFSHNHYITSSKNVNGFI
                     VKENTKIYIDNIEIALTAGDTAADIIAKINESSAPVEATLDRILNSMVIQTTIPHQIW
                     ITEEEGSTVLKELGILTQNNETKEPPYNIANNTEVRNRTIFDSLIELRDNLEENREEI
                     IGSRGLAEIDASLNKIFATLADLGTKENRLDRSYERISKEIMDMKDDMVKYTDLDVTK
                     AITELNMTSLAYQVSLGVSARIMQTTLLDFLK"
     gene            185073..185465
                     /locus_tag="BT0_RS00865"
                     /old_locus_tag="BT0183"
     CDS             185073..185465
                     /locus_tag="BT0_RS00865"
                     /old_locus_tag="BT0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYX8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein FliW"
                     /protein_id="WP_011772139.1"
                     /db_xref="GI:500096132"
                     /translation="MKNEISIKFNFPEGILGFEEIKEFIIKDSEHKPFSIMQSINGEI
                     NFLVTSPFNFLEKYLPNIEEEDWLDIQTENEDEKVILCIINMHVKNYKEITANLKAPI
                     ILNKKKLIGKQAISTNEEHYLRYRVFKE"
     gene            185468..185704
                     /locus_tag="BT0_RS00870"
                     /old_locus_tag="BT0184"
     CDS             185468..185704
                     /locus_tag="BT0_RS00870"
                     /old_locus_tag="BT0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYX9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator"
                     /protein_id="WP_011772140.1"
                     /db_xref="GI:500096133"
                     /translation="MLVLSRKANESIKIDSNIEISILEIKKDSVKIAIKAPANIKILR
                     SEIYDIIKEENKKSILQDKNNIHKIKNLFDYLSK"
     gene            complement(185689..186351)
                     /locus_tag="BT0_RS00875"
                     /old_locus_tag="BT0185"
     CDS             complement(185689..186351)
                     /locus_tag="BT0_RS00875"
                     /old_locus_tag="BT0185"
                     /EC_number="3.4.24.57"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoprotease"
                     /protein_id="WP_011772141.1"
                     /db_xref="GI:500096134"
                     /translation="MNTLAIEYSHKTLLIHFEINGEVFSIIKSKDNINYTLSIPKLFN
                     DFVLEYGIDLKKLDLLINSSGPGSFTGLRISLSFIKGLSLGLSIPFVNVPTFDVFAKL
                     VNTSADTLTLSFTAGKYFLGCYKNSKFCGKIFCFSESELFEYLDSLDLKFVIVGNGIE
                     FIYEKLKNKFEIIIDMDSFGSVLTELGKFKYVENRQGDDILSGPFYVRLSDAEIKSYL
                     LR"
     gene            complement(186332..186760)
                     /locus_tag="BT0_RS00880"
                     /old_locus_tag="BT0186"
     CDS             complement(186332..186760)
                     /locus_tag="BT0_RS00880"
                     /old_locus_tag="BT0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011772142.1"
                     /db_xref="GI:500096135"
                     /translation="MTLSFETEKEMINFSKSFFNPLPIGKIFGLCGDMGTGKTTFLKG
                     LALNLGISYFTSPTYNIVNFYEFVDFKFYHIDLYRLNILDEFQLIGGMELLLDMSAII
                     AIEWPEIIIDVLPKNRLMFLTFKIKNTSRILEFSDEYPCN"
     gene            complement(186757..187017)
                     /locus_tag="BT0_RS00885"
                     /old_locus_tag="BT0187"
     CDS             complement(186757..187017)
                     /locus_tag="BT0_RS00885"
                     /old_locus_tag="BT0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178423.1"
                     /db_xref="GI:752506558"
                     /translation="MKFISLDNISKQDSHIYYRRVYFADAFYEYKGSSETKQVKFTIE
                     VTPLGEKHITIDFVDPLNYPVLSLMVAIKRHVIDLDIKGELP"
     gene            complement(187221..187568)
                     /locus_tag="BT0_RS00890"
                     /old_locus_tag="BT0188"
     CDS             complement(187221..187568)
                     /locus_tag="BT0_RS00890"
                     /old_locus_tag="BT0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L20"
                     /protein_id="WP_011772144.1"
                     /db_xref="GI:500096137"
                     /translation="MARVKNGIVHVARRKKILKKTKGFWGTKKSNYKKAKDTLRKGMM
                     YATRDRKTRKRDFRSLWIVRISAALTGMGINYSKFFESLKKSNIKLNRKILSNLAIED
                     IETFKKIVYEIKN"
     gene            complement(187590..187787)
                     /locus_tag="BT0_RS00895"
                     /old_locus_tag="BT0189"
     CDS             complement(187590..187787)
                     /locus_tag="BT0_RS00895"
                     /old_locus_tag="BT0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYY4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L35"
                     /protein_id="WP_011772145.1"
                     /db_xref="GI:500096138"
                     /translation="MSKMKTCKSAKKRYAFTSKGKIKYKKQNLRHILTKKSSKRRRKL
                     GKSGLVSSFEVKRIKTLLPYA"
     gene            complement(187804..188364)
                     /locus_tag="BT0_RS00900"
                     /old_locus_tag="BT0190"
     CDS             complement(187804..188364)
                     /locus_tag="BT0_RS00900"
                     /old_locus_tag="BT0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYY5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-3"
                     /protein_id="WP_011772146.1"
                     /db_xref="GI:500096139"
                     /translation="MINRSSGKDRDRSRSGDKELRINHKIKAREVRVIFDNGTQSVLP
                     IEDAIKCARDAELDLVEISPNSVPPVCKIIDYGKYKFHQEKRQKEQKRNQKIIKLKEV
                     RMQPKIDTHDLDFKYRNILGFLKEGNKVKVTIRFRGRELAHTHLGYGILESILERVGE
                     SNYVLESPAKMEGKTMFLIIAPKSKK"
     gene            188542..189204
                     /locus_tag="BT0_RS00905"
                     /old_locus_tag="BT0192"
     CDS             188542..189204
                     /locus_tag="BT0_RS00905"
                     /old_locus_tag="BT0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772147.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772147.1"
                     /db_xref="GI:500096140"
                     /translation="MNIFLLISLPLVFKIYMIINHPQLKLIKQNYIHATSILFAMTIF
                     SLLYLIEEFILYKSLLINYQTKFSLAYSIFIKEQIYYYVFPLFIFTFFFTFNPNSLLK
                     KNPIFLIYFAFGLILSKNLALIITNSKVFGTYEYIKIPLLHILELIFTAIICEKGIRL
                     HITQNINGYQLIFVPILILEAIITFLKVLILTNAQIYALITLIILLGITIVNKKAIGT
                     VK"
     gene            189204..189950
                     /locus_tag="BT0_RS00910"
                     /old_locus_tag="BT0193"
     CDS             189204..189950
                     /locus_tag="BT0_RS00910"
                     /old_locus_tag="BT0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772148.1"
                     /db_xref="GI:500096141"
                     /translation="MIHTIKTFIITIILILCFSCKNNKITDKNFSYIIIFSDTTEYFF
                     KIKNSPFIQDKTLFINEKDIEIIKDKLNNVKKILLTHKSNNEIFNINKIKKKTFYLSK
                     VKFSLKKAIDFIFSDPSIDLTTSLIMKDNTLNQTDSEHLEKSAKEQNINITTINDKNI
                     LYLKNLITPKITKVILFSMRNNHVFLKKLSESSFFKKIEFILIGSNKKNLKEINTKYI
                     ISMNELDLIEITKKINKDFQYEFNIYEKTI"
     gene            complement(190041..190838)
                     /locus_tag="BT0_RS00915"
                     /old_locus_tag="BT0194"
     CDS             complement(190041..190838)
                     /locus_tag="BT0_RS00915"
                     /old_locus_tag="BT0194"
                     /EC_number="3.1.21.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011772149.1"
                     /db_xref="GI:500096142"
                     /translation="MNLNFERSIFLKKLIDTHVHFNELKKNSIDIHYLINECLKNGFS
                     YFLDIGLHPSDFYERKQLLDTYPNISLTVGIHPLNKALRDDFELIESILENENVVAVG
                     EIGLDYLKGDNKSEQIEALNIQLDLASKYKKPVILHVREAYDDIYNIIKSSNFISRGI
                     LHCYSGNYEYAKKFIDFGFKISFAGNLTFKNSEPLRGVLKKLNIEDILIETDSPFLAP
                     VPLRGKINAPCFLGYTCLEIAKIKNCDVDSVIIALYDNFKDLFNDLI"
     gene            complement(190835..191977)
                     /locus_tag="BT0_RS00920"
                     /old_locus_tag="BT0195"
     CDS             complement(190835..191977)
                     /locus_tag="BT0_RS00920"
                     /old_locus_tag="BT0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772150.1"
                     /db_xref="GI:500096143"
                     /translation="MLDKKLLGEFGDISQISDNELLDVTEKSKRGYQLIKEERLPEAE
                     ALFNDILQKDYDNNYALVGLGDIERKKRNFDKAIIYYQKCLAKHSNNNYALFGLGDCY
                     RSLGDYKKATDVWEEYLKYDPENITVLTRVASSYRKLKNFQKSRQSYLRVLEFVPDND
                     YALVGIGHLYYDFKEYKEALKYWLRMYEINQVKIDVRVLTSIGNCYRKLKEFSKGIYF
                     FKRALEISPNNFYAIFGLADCYRGSKEYHEALKYWLTIIDKDPKNNLVLTRVGDTYRY
                     LKEYENSQIYYKKALDVDFDMFAILGLALLQKEQGQYEEALSAIKNLIKTNPKNSILY
                     VNAAECYEALGQIESAVDILSSFLQLGMKNVTIIDYINNLKKKMDA"
     gene            192275..193348
                     /locus_tag="BT0_RS00925"
                     /old_locus_tag="BT0196"
     CDS             192275..193348
                     /locus_tag="BT0_RS00925"
                     /old_locus_tag="BT0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QYZ0.1"
                     /note="RF-1; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide chain release factor 1"
                     /protein_id="WP_011772151.1"
                     /db_xref="GI:500096144"
                     /translation="MFLERLSPIESKIKILEEKLQDTNLIKNQKEYAKVIKEYNYLEK
                     IKEKKDEYENIISQIDENQKILSEEENLEMKELIKQELTHLNLKKDEIEHTIKILLLH
                     QDENDNKNIIIEIRAGTGGEEAALFAHNLYEMYTKYSEKKKWKTELINFNETELGGFK
                     EVSFEIKGKEVFKKLKHESGVHRVQRVPITESNGRLQTSAATVAVLPEVEETDIEINE
                     KDLRIDVYRSSGAGGQHVNTTDSAVRITHLPTGIVVQCQNERSQHKNKDQAMKILRAR
                     LYKFEDLKKQEQRSNDRKQQVGSGDRSERIRTYNFPQNRVTEHRANISLYKLEEIMQG
                     ELDLLLDTLALKLQEQALKDNPI"
     gene            193358..194191
                     /locus_tag="BT0_RS00930"
                     /old_locus_tag="BT0197"
     CDS             193358..194191
                     /locus_tag="BT0_RS00930"
                     /old_locus_tag="BT0197"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N5-glutamine S-adenosyl-L-methionine-dependent
                     methyltransferase"
                     /protein_id="WP_011772152.1"
                     /db_xref="GI:500096145"
                     /translation="MTINEAIKKSKQHNLNTLEILLLLEKILKSRKELILANINKNLT
                     KQEEHKLSCQINRIRSGTPINYILKTKEFMGIEFYINKHVLIPREDTECLVEEALIQI
                     KKHNLNKILDLCCGSGCIGLTIAHYLKCKVTLSDISNKALKVSLKNTQKLKLENYIEI
                     QYSDLLKYINKEFELIITNPPYLNKDELKIKEKLIKEPRIALLGFGKDGLEIPKKIIR
                     QAKHKLAKNGLLIIEMAPWQTKSLKDFAIQEGFDYLKTIYDIESRERALVLRIKNDTS
                     L"
     gene            194175..196178
                     /locus_tag="BT0_RS00935"
                     /old_locus_tag="BT0198"
     CDS             194175..196178
                     /locus_tag="BT0_RS00935"
                     /old_locus_tag="BT0198"
                     /EC_number="3.1.7.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538726.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="guanosine-3',5'-bis(diphosphate)
                     3'-pyrophosphohydrolase"
                     /protein_id="WP_011772153.1"
                     /db_xref="GI:500096146"
                     /translation="MIQVYEIAYLLKINDIDKLKNIFRKTVNNIYQDDIQKKLIFKAL
                     EISEQLHYGQYRESKEPYVIHPIMVSLFLIKFQLDFKTIIAGLLHDVLEDTSVKKEEI
                     IKEFDQEILSLIDGVTKIHDLHNKTRAIKEANTISKMFFAMTHDIRIIIIKLADKLHN
                     MATLSHLPKNRRERIARDCLATYVPIAERLGISSLKIYLEDLSLKYLYPKEYKEIKNF
                     LSATKIEREKKLYKGKLIIEKELKKIGIDVTITVRSKHFYSIFRKMKTRNNNISQIFD
                     TLGIRIICKQQKECYEILEIVHKVWKPIPGRLKDYIAIPKENKYQSLHTTVRIPEDNQ
                     LIEIQIRTEEMDKIAKYGVAAHWLYKEQVELKADDISFINRIKKWQQESVNKNQYSMH
                     DIHKELLNTFIYVYTPEGEIVELPFGSNSIDFAYTIHTDIGDQALYAKINGKISSLTK
                     PLKNEQIVEIFTSPEAKPDVIWLNSVRTKKARSKIRSWLNKNDNTIFVDNNIIAYLIG
                     ENKEQKRLFSLFKSLTKSKIKSITIAPDCNPLTGEDIIGIIQKDTIVVHKEHCREIAH
                     QKKSHLVEVEWEATPTRKVYHIIIFLKNLKGLFNYLDNLFTTFDVRLISEKIEDCGNG
                     HGIINIIISSNAKNVSMIFTSLKENPNVLQIMQVEEDIKNYDN"
     gene            196168..198411
                     /locus_tag="BT0_RS00940"
                     /old_locus_tag="BT0199"
     CDS             196168..198411
                     /locus_tag="BT0_RS00940"
                     /old_locus_tag="BT0199"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772154.1"
                     /db_xref="GI:500096147"
                     /translation="MIIKTLLLILIQTLISHKIIKADEIEQCGKQIRKHITKINELNR
                     SLEKIKRIENTYDYIKKYFLENKIQHKEHSLQEIGFIGYSQKTIHVKIKGTEKTNYNI
                     IVPIEAQHDLKNNLAIAIVITLINNFKNKEIKNNLNIYFIEDDSHKQISTISSRLLLN
                     NNALDKNINTIYLMLNEDKENNLIEFKNQSNIINSKTSLGFLENFIKTFENHKVNFNV
                     SKINDKHINGIYNLYLKEEIPILIISNNKECSLLKHVKNNNLCDIYKSIEETVKAKKN
                     NQSENELHYIIINMPFKKWIINENTLIIIIYAICNFIILVFITKFKKTSIILRKTKEN
                     YHKIIKLFFILFLSTYISTLITNKMLTAYENFIDYKIINPIYLVNFFLTLFNFNIISY
                     FTYNFKIHLSLKELKYLAISISIIELIIMLYIKIEFILIIILKNILILIIPNKTKILK
                     KIVIMLIWITNLMLITSIQTTLMTTRPIALSYFISISLFSAILTNIVEHLKHKTETIR
                     QEFTKFEKIESIILFLIIAITIISHDIEKISTIKIDQIISFPEKTNKIRVEYLQDNRN
                     TIQISTKDFNLSLEKNKKYAEKEIQTQENLIDLFFQKIDVAERTIYDIKITTKKITKQ
                     INLFLKNASELIIYQSNTPYKIASNNVIFTINNIKSNTTNITFTVKSQEKIQYDIFAY
                     SDINTNYVKIYDQKTKKEVKNINIDYSYAIKYSGILPKSAKYNQNPFFKLQNDKEIEN
                     LKNLKLN"
     gene            complement(198408..199502)
                     /locus_tag="BT0_RS00945"
                     /old_locus_tag="BT0200"
     CDS             complement(198408..199502)
                     /locus_tag="BT0_RS00945"
                     /old_locus_tag="BT0200"
                     /EC_number="6.3.2.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2RZR0.1"
                     /note="D-alanine--D-alanine ligase; DdlA; DdlB;
                     cytoplasmic; catalyzes the formation of D-alanyl-D-alanine
                     from two D-alanines in peptidoglycan synthesis; there are
                     two forms of this enzyme in Escherichia coli; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-alanine synthetase A"
                     /protein_id="WP_041178424.1"
                     /db_xref="GI:752506559"
                     /translation="MKKNLMLIFGGVSFEHEISLRSACGIYSALMKLDKYNVFSSFID
                     KITGVWYLLDSVPDDPKLIKKDSSAIISLIPGYGIFVNNKDLKIDVVFPIVHGRTGED
                     GAIQGFLKIMDIPCVGSGILGSAISINKYFCKLLLKSFNIPLVPFIGFKKYDYLLDKE
                     GIKKDIKQSLDYPVIVKPAMLGSSIGISIAYNETQIEKCIEEAFAYDLTVVIEKFMRA
                     REIECAVIGNEQIKIFTPGEIVIQDFVFYDYDAKYSTAPGNSVVFNIPAHLDTKHLLD
                     IKEYAFFTYKCLELRGMARIDFLIEKDTDLVYINEINTIPGFTDISMFSKMCEHDGLD
                     YGSLVDKLIALAFQSYAKRKERIDFHRLEN"
     gene            complement(199507..201021)
                     /locus_tag="BT0_RS00950"
                     /old_locus_tag="BT0201"
     CDS             complement(199507..201021)
                     /locus_tag="BT0_RS00950"
                     /old_locus_tag="BT0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramyl peptide synthase"
                     /protein_id="WP_041178425.1"
                     /db_xref="GI:752506560"
                     /translation="MNKKMLNNVLSKLDKNFVKEIKGSCEVEILGLTYDSRCVLSHFV
                     FFALPGLHFDGQEFINSAIEQGSNVIVHTNDINFYDPNVTYIKIDSCNIKKFMSNFAH
                     IFYNEPSKNLKIIGVTGTDGKSSVCFYIYTLLKSMGVKVGFISTVFFEDGSGTLVKNP
                     YRQSTPESTEIHLVLSKMVENNVEYAIVESTSHGLDIRTSRLIDIAYFVAVLTNVSHE
                     HLEFHGTMQHYLNAKLNLFSSADANGGFGIINMDDKNFSTFLNTINRAYTYSLENKNA
                     DFFVSKINEQMGFTEFEFYHKNVKYDARVNLTGSFNVENVMAALIVVSQVMNVDVSEL
                     IDKLVNIEGLFGRMQGVDFGQDFSLIIDYAHTPGAFLKIFPIFKRLSKNRLISVFGSA
                     GERDVLKRKLQGEIADRYSDIIILCDEDPRGEDSMQIIRDIAEGISGKTLNRDLFFIP
                     DRKSAIEKAINIAHTDDLVVTLGKGHENSIIYKDRSIFWDEQAVVKDIISRNRS"
     gene            201169..201241
                     /locus_tag="BT0_RS00955"
                     /old_locus_tag="BTT0002"
     tRNA            201169..201241
                     /locus_tag="BT0_RS00955"
                     /old_locus_tag="BTT0002"
                     /product="tRNA-Cys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:201202..201204,aa:Cys,seq:gca)
     gene            201335..202576
                     /locus_tag="BT0_RS00960"
                     /old_locus_tag="BT0202"
     CDS             201335..202576
                     /locus_tag="BT0_RS00960"
                     /old_locus_tag="BT0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin"
                     /protein_id="WP_011772157.1"
                     /db_xref="GI:500096150"
                     /translation="MLELTIILIFIILSAIFSASETAYTSLSLIQLQDIKKKGKLGTV
                     VYNLAQNPSKLVTTILIGNNIANITASALTTKFVLDKYGNNALALSTGIITIIVLICS
                     EIFPKQIAILNNESIVLSTSILLKILTIIFTPAIYVINGIVKILLSLCKIKASQKMTK
                     DSIKNMLFLAEKLGILENDDRIFMQKMLNIGEVRASEVMTHRTEVFSLSSTSQLKDKI
                     KLIKKEGYSRIPVYKGQNREQIIGILITKDLIEISKKKLEQNIIKFVKPAVFVQQNKR
                     IKDILDIMRQKQKIMAIVIDEYGGFAGILTIEDIVEKIFGAIFDEYDFEEQKQLITKK
                     DENIYLISGETTFDEIEETVGIKIQHKDYINTIGGYIMDLLDKIPTGGEQVSTEHGEY
                     LIEEIQNHKIKKITFTKLDKE"
     gene            202602..203534
                     /locus_tag="BT0_RS00965"
                     /old_locus_tag="BT0203"
     CDS             202602..203534
                     /locus_tag="BT0_RS00965"
                     /old_locus_tag="BT0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696087.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protease HflK"
                     /protein_id="WP_011772158.1"
                     /db_xref="GI:500096151"
                     /translation="MLNDILKFFNKTYEYMIILIVLVIILLITIANIFVVGPSDEAIV
                     LRLGKLNRILEPGIHIKIPLIEEKLIVPVKIVQEVKFGFNTNNNTGPNLNEDDGIIIT
                     GDLNIIKVEWLVQYKISDPYSFMFKVEDPAKTITDIAKSSMNRLIGDNTIFEIINDNR
                     VGVTEGVKASMNEIIKTYDLGIDIVQVQIRNAMPPKGKVYEAFEDVNIAIQDKNKFIN
                     EGRKKFNQIIPKIRGEALKLIEEAKGYKENRINTALAETAIFNAILNAYIKDPEITRE
                     RIYNEAMKEILESKDNIEIIDKNLNNFLPFKEVK"
     gene            203536..204507
                     /locus_tag="BT0_RS00970"
                     /old_locus_tag="BT0204"
     CDS             203536..204507
                     /locus_tag="BT0_RS00970"
                     /old_locus_tag="BT0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421977.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membane protease HflC"
                     /protein_id="WP_011772159.1"
                     /db_xref="GI:500096152"
                     /translation="MKYILKFLFSIAKILAFTLIFGLISLAIMQPLYILKENEISITT
                     RLGKIERTENTAGLKYKIPFIENVQIFPKNILRWDGEPQRIPTGGEEKQLIWIDTTAR
                     WKIVDINQFYTAIKTMNRASTIINAAIEPAVRGVIAKYPLLEIIRSSNDPIQRLSDGV
                     LTPQEITDNTTYKITKGRKIIENEIIEVSNKNTKDIGIEIVDVLIRKIGYDPSLIDSV
                     HNRMISERQQIAEEQRSTGIAEQTEILGSIEKEKLKLLSEAKAEAAKIKAEGDHEAAK
                     IYANAYGKNVEFYKFWQALESYKTTLKDKRKIFSTNMDFFRYLHNKK"
     gene            204839..204911
                     /locus_tag="BT0_RS00975"
                     /old_locus_tag="BTT0003"
     tRNA            204839..204911
                     /locus_tag="BT0_RS00975"
                     /old_locus_tag="BTT0003"
                     /product="tRNA-Phe"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:204872..204874,aa:Phe,seq:gaa)
     gene            205117..206661
                     /locus_tag="BT0_RS00980"
                     /old_locus_tag="BT0205"
     CDS             205117..206661
                     /locus_tag="BT0_RS00980"
                     /old_locus_tag="BT0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178426.1"
                     /db_xref="GI:752506561"
                     /translation="MIFKEIKKVEDLTEKDIIFSNIGNMAKLSTRVNEKIITFLNKGN
                     VLHIPVINNYENIPHDKLINTINEEILNNEINSLKEELIEALKDIYKPFSEKDKMFTI
                     SGRKTLINLNTLMEKEPDPIYLKEIIEGSFKILPKHKIISIQKILLKIYDYFDFQKII
                     DKDNLNNTKTIKKLYLHSIRRDYEFCREQVKTEGDSILIHAIDTTIYFLTTIAQLNKE
                     RAAKDAPRSTSKFFIDKSHYTEFTEFFYDNDIILQAALGVLLHPIGLMHITILQKLRE
                     KISLKNKDTKEKYMSKIEILEKSINISKNLFRMREDISAITKMIINGQKSYLNIKNRA
                     ETATKKFTHELIRIFCIIDTYDEMVNPIIIKEPVNPLEAIKFLTENSEQYYWTKDNPE
                     EYLKNKKFDVEMLKNFLKVLAPFDHGTIVDVYIKDCNEPLFKAVVLKYTIGILPIMSI
                     IKHKDKSYKIGDILLNLESREIIIKGQNGEIKTSPFKNTDQFELRHNIEELKSDEFQL
                     LTSMQD"
     gene            complement(206667..207212)
                     /locus_tag="BT0_RS00985"
                     /old_locus_tag="BT0206"
     CDS             complement(206667..207212)
                     /locus_tag="BT0_RS00985"
                     /old_locus_tag="BT0206"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_011772161.1"
                     /db_xref="GI:500096154"
                     /translation="MHVSAGKYKGWKVAFPKIGGVRPVMAIVREAFFSIFLNQILGSN
                     FLDVFAGTGIMSLEALSRGANLAHLVDCNKFSKNVLIKNFEVVSEPYKFFFRKAELFL
                     KKSDLFYDFIYLDPPFGYSFKENLLRIISENESLNKDAKIIIHYPSRENLDNNILRLS
                     KYDFRKYGGSKLDFFKVKSYV"
     gene            207298..208128
                     /locus_tag="BT0_RS00990"
                     /old_locus_tag="BT0207"
     CDS             207298..208128
                     /locus_tag="BT0_RS00990"
                     /old_locus_tag="BT0207"
                     /EC_number="2.7.7.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="WP_011772162.1"
                     /db_xref="GI:500096155"
                     /translation="MKGIILAAGYGTRFLPITKTIPKEMLPILNKPSIDYIIEEFTSS
                     GIKEILIITSRRKGVLDNYFDREIELETVFTKECKKDLLEKIKLKDINISFIRQNEMM
                     GTGHALLHAKPWIGTDNVIVAYPDDLHVGSPSLTTQLIELHKKTGKNILSVIENPKDI
                     NRYGVIKLNKDNIHVKDIVEKPEVGKEPSNKASIGRFLYTHEFFKFLEEGFKIHQKGE
                     YHHIYALKKLMSENKVLYKEIEGERLDIGDIGGYLEAIIKIAKRDDKLLQIIKDSLRN
                     "
     gene            208129..209814
                     /locus_tag="BT0_RS00995"
                     /old_locus_tag="BT0208"
     CDS             208129..209814
                     /locus_tag="BT0_RS00995"
                     /old_locus_tag="BT0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772163.1"
                     /db_xref="GI:500096156"
                     /translation="MKIAPKYQEFYNSLSILKKYININIEEKILRYSILSKLYKLNEE
                     EIQNLIKISQDYELKKNKINITLEEYYYEKIQDKKIKNWILEIIREKNSLQIKKETNL
                     ISKRSGITYKLHSTNFLKIIEIQNNSKYTQEKKELYKQLILNFSSNLKIENLEPTIDI
                     LIAVKHRNKEKIKRILKYNQSFQRLFKSSLGKKQSRVIKLKKLLILTYWPVGCLSKSL
                     FNKILTKNYRYIIDEVLTLKYDEILKYLKTIKTFSLNEIFYKGSNKNSNFNYFFSEFM
                     KYTPNDFQNTLKTYLFSLEKTAIKQYLEWFFKDKVPNEWEDFIFAIEYLETHKLLNLS
                     SNIKDIIIAKFKAEEFFVSFEKMNFNPYKSSKIFQNKNIKRIFLQNVINYIKDNSTKI
                     DTYGWIAFYIYADKNDKAKFSKDIKNFFENKNLEIQNQIFVYFLSFYPNIDKKHFEFI
                     SEIMIHLDKDKISIPQEIIKMQEISPYRLNYRKSYIFVKSLILRTRVFKILHKNIKLE
                     LLFKIEEFKTETLLPAICYITCYSKPNALKEEQTMSSEKKEEIMKFVTFLTKE"
     gene            209891..211579
                     /locus_tag="BT0_RS01000"
                     /old_locus_tag="BT0209"
     CDS             209891..211579
                     /locus_tag="BT0_RS01000"
                     /old_locus_tag="BT0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696093.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mucin 2 precursor"
                     /protein_id="WP_011772164.1"
                     /db_xref="GI:500096157"
                     /translation="MNKCLLLLKNLIVLLILLLNSNLAYSQRLIRIGQEEIKNKNYSQ
                     AIKILSEAIQKYPKVQNGYYFLAIAYRENNQLTEAEGALLDGIAIGGDIDYKLYFELG
                     NIMFKRGEGYYNLAIKYYSNSVKNMPNYDKALLNRANSYVEQGKINFKEKNYKNAWDS
                     YTMAIHDYSQFITLRYESEKKNAILHMIALLRNKKAALEELDKSLKNRSEYIATEHQK
                     DKENTQEHMNKKDNKNTQENMSKKDNKNTQEHMSKKDKENTQEHMNKKDKENTQENMS
                     KKDNTKTQEHMNKKDKENTQEHMSKKDKENTQEHMSKKDNKNTQEHMSKKDKENTQEH
                     MNKKDKENTQEHMSKKDKENTQEHMSKKDNKNTQENMNKKDKENTQENMSKKDNTKTQ
                     EHMNKKDKENTQEHMNKKDKENTQEHMSKKDNTNTQENMSKKDNKNTQEHMNKKDNKN
                     TQEHMSKKDNKNTQEHMNKKDKENTQEHMNKKDNKNTQEHMSKKDNKNTQEHMNKKDK
                     ENTQKHMSKKDNKNTQEHEKKKTMLKDKFEDNLKTDSLIELDKINWQEELNIDE"
     gene            211572..213929
                     /locus_tag="BT0_RS01005"
                     /old_locus_tag="BT0210"
     CDS             211572..213929
                     /locus_tag="BT0_RS01005"
                     /old_locus_tag="BT0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="surface-located membrane protein 1"
                     /protein_id="WP_011772165.1"
                     /db_xref="GI:500096158"
                     /translation="MNKRKNLPTLIILIILLIASFGGLGYYVYKERLNKNNQAIMLNE
                     VKNSVMDRNYKKAHSITKMLKDKYPQNTDIAMLENTLSELANNSPFESKDLQRDTANQ
                     ILDKIQGKQQSIPINNENSEIAFNNRYIKDTTKIENYADRKDDTGIENEDILEFNQNT
                     IPENLRKNINKIAKQQESTPNNDKSIENKKNLFNLKKLKENLNKELNQTKTTQFNTIK
                     QVIKTHEQNEDKLIKKNTDDSRENKTKQIDKVIEISPSLKPKTKKETPNTKDAHKNQI
                     IEKIERPYSYVIKKVLYEILDNINTGNPSLAKERLNELIKKGLSNKFNKINDLIDKLQ
                     TQEAANLLIRLIKQDIEPNSISIEKAPFKKELLKQKKPKEKNFPTKDQLTNNQIKMQE
                     KPKTHANHLSQTSIDLQSLKMLASINEEQKDFKKAEAIYEKIANITNEAEDHYKVGIM
                     KFKLKKYEESIKAFDKTISLNPKHKKAYTNKGTSLILSHKPKQAIEAFKKAITIDQNY
                     DTAYYKKGIAEEQNNDKQNAFLSFKKAYEITKNPHYALKTGIIANYIGDFKNSEKYLD
                     KASTSIKEKNDIMFYNLAIAKFENDNLNESLISINKALDINPEKSEYLYLKASIYLTK
                     ENYNEAIPLYNSVILKNPENITAHINLARAYEKSGNEPKAIEILEKISNKNHLLALNN
                     LGILYKNQGNYQKAIEIFQKAEAHSSLEAKYNLATALIAIKDNKRAMEKLKEYIKINP
                     NNPEALHALGIIEYNDNGNDKILKEVINKFPNYKQNKTIIKIIGK"
     gene            213926..215764
                     /locus_tag="BT0_RS01010"
                     /old_locus_tag="BT0211"
     CDS             213926..215764
                     /locus_tag="BT0_RS01010"
                     /old_locus_tag="BT0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutL"
                     /protein_id="WP_011772166.1"
                     /db_xref="GI:500096159"
                     /translation="MNKIKFLDRSLVQKIAAGEAIDRPCSILRELLDNSIDSGADKIE
                     VFLEEGGIRRILITDNGSGISKEDLKICYLPHTTSKINEEKDLEKIQTLGFRGEALSS
                     IAICSNLTITSSTTGEDSYQIEVENGTEKYFKKQSAINGTIVDVTNLFHNFPARKRFL
                     KKDSIETKMCLKVFEEKAVTHPGIDFKLSLNNELRKVYFKESLINRVQSVYGEIIENN
                     KFGKIETEYENVQMKIFFAPPNFSRKDRRNIKIFLNRRPVEEHNLSEAIIDGHSRILT
                     NRNFPICYLFLEIDPRYVDFNIHPQKKEVRFFNLPFLPKQVSSNINEFFDRERKEILQ
                     DYHNIIIKRQITNDAHLLHPEDDPTNSDFQTYEIIQNESLILDKPQNNKITNIIEDKV
                     KFESQNPIQKDKPSFKSYIQNILLETSTIANDFQKPIAKHEFKYRGQLFSEFLIVEKD
                     NEVFFIDQHALHEKIIYQTLINSEKITQKLLIPIEFQVDCEDTDKILASELEEYKKLD
                     IIVTKIKEQTYQLESIPNICNKYENVIIQFFKTRKSKTIDSLETDLYATIACRQAVKC
                     NDTISSEFSQFLINEFFNLKLKYCPHGRKIYHKISKFELEKSVNRK"
     gene            215785..216825
                     /locus_tag="BT0_RS01015"
                     /old_locus_tag="BT0212"
     CDS             215785..216825
                     /locus_tag="BT0_RS01015"
                     /old_locus_tag="BT0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772167.1"
                     /db_xref="GI:500096160"
                     /translation="MIKDIKSKIQELSPQRDKKLVELGKALKNSNVIELKKLKSYTSL
                     KLIEKEISQLKASLNKIEDNESKLKELYKKIKDYKESKKHILKAYEKKLKKITEITIN
                     KYPNNLSTILEYKMNFIKSTLEKHKYKTTEIIKLNEKINFFKRLIINIKLMLKDIINK
                     INIEKMSKEFEKKILKEHLFSDNLENLIDEFVENKDLSKAIVEEYRLMNEIQTEIVKI
                     NNEIKHKSIKDNINSKNKIECAINAVQTNRELILKKIAEEFVEMSKTEKGLNKTGTIN
                     SLLETIKNLNQQISKLNADLIKAIKIDEIVKVKSKMQQLIKNKESIEVKLNELNSKIE
                     IIQNEINELDNQ"
     gene            216924..216997
                     /locus_tag="BT0_RS01020"
                     /old_locus_tag="BTT0004"
     tRNA            216924..216997
                     /locus_tag="BT0_RS01020"
                     /old_locus_tag="BTT0004"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:216958..216960,aa:Met,seq:cat)
     gene            complement(217000..217656)
                     /locus_tag="BT0_RS01025"
                     /old_locus_tag="BT0213"
     CDS             complement(217000..217656)
                     /locus_tag="BT0_RS01025"
                     /old_locus_tag="BT0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772168.1"
                     /db_xref="GI:500096161"
                     /translation="MLRELKSNILLLFFIFFCSCEMSYPDIREVDYVINYYFAKDKFD
                     YFMTFDFAVKVLNSNDVIKFFVENIDSKEFIEVAKDKYTSSFINSVLGKNVLYCKDLR
                     FNLFDKTFENFMAQVHLIDSGMRVYSREIVINLSLSEEELTLIHYYIYNSKDKLKLNE
                     ISGNNLYLIKTPKDEIDFFYSIVKIEDLMNIQLDDDNLDVYLGFYYVGKHSNLFFRLN
                     "
     gene            complement(217634..218212)
                     /locus_tag="BT0_RS01030"
                     /old_locus_tag="BT0214"
     CDS             complement(217634..218212)
                     /locus_tag="BT0_RS01030"
                     /old_locus_tag="BT0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2RZS4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="WP_011772169.1"
                     /db_xref="GI:500096162"
                     /translation="MGTIKSGDIEKGTFLLFKGMPHIVLEREFSKMGRGGSIVRLKLK
                     NLKNKSVVKETLKGADTVEEIEVLEVASQYLYRENENLIFMDLETYDQFDVNLREISN
                     IEDKVMFLQEAGIYSLVKWDNEVIDLRLPPKVAFEVVDAEIAVKGDTVTNAMKNVTLH
                     TGLVVKAPLFINVGDKILVNSETKEYAERVKE"
     gene            218297..219184
                     /locus_tag="BT0_RS01035"
                     /old_locus_tag="BT0215"
     CDS             218297..219184
                     /locus_tag="BT0_RS01035"
                     /old_locus_tag="BT0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_041178427.1"
                     /db_xref="GI:752506562"
                     /translation="MILYIVVKGVNLMQAIKVLFTISIAFLFSNCTNKDKENVIAIGG
                     STSTTSIMDEMILRYQKINNQLKVTYDAQGSSVGIKGLFDGIYKMAISSRDATEEEIA
                     QGAKITIIAYDALIFITSPDVKITNITEEDLVKILNGNIRNWQQVGGHDAKINFINRD
                     SSSGSHSSIKELVLDKILKNPEEAQFRQDSIMVKSNGEVIEKISLTPHSIGYISFGYA
                     RGAIEKGLHTLSINSIYPTKETITKDKYNIKRRLIAITNSISEDQNILDFINFMLSPN
                     GQDIVEEQGFIKVHTTENI"
     gene            219268..220176
                     /locus_tag="BT0_RS01040"
                     /old_locus_tag="BT0216"
     CDS             219268..220176
                     /locus_tag="BT0_RS01040"
                     /old_locus_tag="BT0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421989.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_011772171.1"
                     /db_xref="GI:500096164"
                     /translation="MKLTLKTKRNIVRLAFNCFIFTSAIISTLTILLLVLFIIKNGLA
                     PLLNNKIKIFNFLFSTNWDPTNKLQKSYGILSFIINSALTTFFSVLIALPIGLGFAIY
                     LSEKTKGIYQKTLQTIIELLAGIPSVVYGFFGSTFIATLIKNTFSREDNLGYNLITSV
                     IVLSIMILPTIISVSYTSLKAVPKSYKLASLALAATDWQTIYKVMIPSAGKGILAGVI
                     LAIGRAIGETIAVLMVGGGSPLFIQNIFSPIRTLTVNIAIDMGYASGTHKEALFSTAL
                     VLLLLVIIINSIKHFILSSSKRLKIK"
     gene            220173..221714
                     /locus_tag="BT0_RS01045"
                     /old_locus_tag="BT0217"
     CDS             220173..221714
                     /locus_tag="BT0_RS01045"
                     /old_locus_tag="BT0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter permease"
                     /protein_id="WP_011772172.1"
                     /db_xref="GI:500096165"
                     /translation="MNTIQTNKLFNKISFCIIRFIAYFLITLLFFLISYIVYNSLFFT
                     SKKQTLFLDETKHFLPFTLKNKIIKIAFIINKSIKAEEITTQDIYNIYNNKISHWGSI
                     SDQSIDIVPIASSQSNLASTVVLQTFTKDNKFNNRYIKLVESNEKIIETVNKTTGAIG
                     YLTKEELEKLDFKKFSEIKSLKIKSMSILVGKKTLQKSENEIINILSLNQIKKLLIEK
                     TNWNNLISKNIKLNIIKYSDYDQNAIKTVEEHEGTIAVVPWHSFYKSDAPFLKLYYMK
                     KDMPLNLNFILSTPRNSGKYGGISYLIFNTFYVILLTAIISISIGIGTGIMLAEYTSN
                     KIFYKTVSMSVDILSSIPAIIFGLFGLIFFVPIFGMGILSGAITSSLMILPMIIKTTE
                     EALKSIPKSYKYASVALGANKTETIIKILLPASSPGILTGIVLAIGRALGETAVLLFT
                     MGTNLGLASSLNEPSRSLTVHLLLLFQEGYLDKGFATASILIIMILLINLTSKFLINK
                     LYRIK"
     gene            221715..222479
                     /gene="pstB"
                     /locus_tag="BT0_RS01050"
                     /old_locus_tag="BT0218"
     CDS             221715..222479
                     /gene="pstB"
                     /locus_tag="BT0_RS01050"
                     /old_locus_tag="BT0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012421991.1"
                     /note="ATP-binding protein; PstABCS is an ATP dependent
                     phosphate uptake system which is responsible for inorganic
                     phosphate uptake during phosphate starvation; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter ATP-binding protein"
                     /protein_id="WP_011772173.1"
                     /db_xref="GI:500096166"
                     /translation="MSQDKAIIKTENLNLFYTDFKALNNINISILRNSITALIGPSGC
                     GKSTFLRTLNRMNDLVEGVKIEGKVMYEGKSIYSNNFDVLELRRKIGMVFQTPNPFLM
                     SVYDNISYGPKIHGIKDKKKLDEIVEKSLIKSALWNEVKDKLNRNALSLSGGQQQRLC
                     IARTLAIEPNVILMDEPTSALDPISTGKIEELIINLKESYTIIIVTHNMQQAGRISDR
                     TAFFLNGYIEEESQTDELFFNPKNIKTEEYITGKFG"
     gene            complement(222480..223301)
                     /locus_tag="BT0_RS01055"
                     /old_locus_tag="BT0219"
     CDS             complement(222480..223301)
                     /locus_tag="BT0_RS01055"
                     /old_locus_tag="BT0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012537985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotate dehydrogenase"
                     /protein_id="WP_011772174.1"
                     /db_xref="GI:500096167"
                     /translation="MFKHLGDYLLTLHPIFLGFLGSTFTWFTTAFGAAAVFCFRKVNN
                     KIMDAMLGFSAGIMIAASFFSLIKPAIEMAEELGYIAWMPAVFGFLLGAFFIYIVDVF
                     VPDLDKLAFIDEDLTRHGKKDFLLFTAVTLHNFPEGLAVGVAFGALASSPDIHTLVGA
                     MILTLGIGIQNMPEGAAISLPLRRGNVPLWKCFNYGQMSGLVEIVGGFLGSYAVYTFT
                     RILPFALSFSAGAMIYVSIEQLIPEAKRKDIDNKIPTIFGVIGFALMMFLDVSLG"
     gene            complement(223318..225099)
                     /locus_tag="BT0_RS01060"
                     /old_locus_tag="BT0220"
     CDS             complement(223318..225099)
                     /locus_tag="BT0_RS01060"
                     /old_locus_tag="BT0220"
                     /EC_number="6.1.1.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2RZT0.1"
                     /note="catalyzes a two-step reaction, first charging an
                     alanine molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alanyl-tRNA synthetase"
                     /protein_id="WP_011772175.1"
                     /db_xref="GI:500096168"
                     /translation="MKLDELRKKYIEFFKSKGHCEIAGKSLIPDNDSTVLFNTAGMQP
                     LVPYLLGEIHPSGDMLVDVQKCLRTGDIDEVGDLSHLTFFEMLGNWSLGAYFKELSVK
                     YSFEFLTSPDYLNISKDRLYVSVFEGDENIPRDTKTASVWESLGIPKDRIFYLSREHN
                     FWGPVGNVGPCGPDTEIFVDTGKEKCSNECDITCSCGKYFEIWNNVFMQYKRDENGNY
                     EELNRKCVDTGMGIERTITFLQGKSSVYDTDAFKPIIDKIEKISGKIYGQNLEDDKSI
                     RIIADHIKASCFILADNFAVLPSNVGQGYVLRRIIRRAIRYAKKLGMESHVLADLVDP
                     VEEIYKSFYKELTENKDFIKAELNTEEKKFFKTLRHGEQEFIKLIQHLSSKLIPGEIA
                     FKLYDTYGFPYEITEELATEYGFSIDKTGFEEHFRKHRKVSKKGGDKVFKGGLADCTY
                     ETTKLHTATHLLHKALQLVLGDHVRQKGSNITAERLRFDFSHPYKMTDDEIKRVEDMV
                     NLQIKNKLSVNRTVMSLDDALAKGAMALFGEKYEEIVSVYEIDGFSIEVCGGPHVKNT
                     SELGIFKIQKEQASSSGVRRIKGILID"
     gene            complement(225099..226310)
                     /locus_tag="BT0_RS01065"
                     /old_locus_tag="BT0221"
     CDS             complement(225099..226310)
                     /locus_tag="BT0_RS01065"
                     /old_locus_tag="BT0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="WP_041178428.1"
                     /db_xref="GI:752506563"
                     /translation="MQDPRISKYQDAKNWGVKTFKESEKKELHNDLPEIQGSLLKSWV
                     NLIKRGKREDFSNSSSLSKGVGKPGFIRKESKVSKIAKYFLAIGLEKSSKIMAELDDA
                     DIIAITREITKIKYITPDDKKRIIQEFEDLVKSERKYLKIDDKFTYELLNKSLSKAKA
                     KEIYIKVTGIDPFLPFDYLSGVEDEQLWALIKDENIQTLLIIYNYLTKEQKKYVFSML
                     EKDIKKQFVKELAKPRQLNMDMIEIISDRLKSRFAMQGKLKTEKLDGSKILVDILSYM
                     DSEDEKNLLSNIDMKVLNPVKDNEIKERIFDINVILRITDNDMHNILREFTDNDIAII
                     IKDKSDEIRDKILFNVSRRRKTLILEEESFLKEVKKRDIKAMTTSFVNYIKELTLKGE
                     LMIYRKNEEFI"
     gene            complement(226297..226998)
                     /locus_tag="BT0_RS01070"
                     /old_locus_tag="BT0222"
     CDS             complement(226297..226998)
                     /locus_tag="BT0_RS01070"
                     /old_locus_tag="BT0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconolactonase"
                     /protein_id="WP_041178563.1"
                     /db_xref="GI:752506698"
                     /translation="MEFLCSNKESDLKGRFFDFFLKNISRDDFTSIGVCGGRNIISFL
                     NVFDEQNYPIKKSHFFLVDERCVDLNSEYSNFRLLSEGFFSKMMKKNLICGSNFHPFI
                     YSEFDETSSIYNYNVEFNSRFTRLDLSILSVGEDGHVASLFPSRKLLFSEMEGYQYEY
                     DAPKFPSKRMSLTPKSLLLSKASVLLFIGHEKKGALENFLSSEISLRECPAKIFKDHA
                     RLLVLTNIEGVYAGS"
     gene            complement(227019..227711)
                     /locus_tag="BT0_RS01075"
                     /old_locus_tag="BT0223"
     CDS             complement(227019..227711)
                     /locus_tag="BT0_RS01075"
                     /old_locus_tag="BT0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178429.1"
                     /db_xref="GI:752506564"
                     /translation="MFAKKLLFLLSSLVFLIASVIMSIGIKNIGIKNGNYITVKGLSE
                     KEVLSTSSSWNLRYELGGNTIDEINKLNNANFLAIRDFFVSYGFHEDEISMKNMDFHI
                     ANYSDALYKYNAYISLGIYTKDIDKMEQVSKNIIKLYNKGVLFTGNGGPSYYFDKIND
                     VKPAMLADSIKNALDAALEFSRNSGAVLGKIKTANQGYFEFLPVDRSSENHERYSKKI
                     LRVVTTVSYYLD"
     gene            227792..228799
                     /locus_tag="BT0_RS01080"
                     /old_locus_tag="BT0225"
     CDS             227792..228799
                     /locus_tag="BT0_RS01080"
                     /old_locus_tag="BT0225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="WP_011772179.1"
                     /db_xref="GI:500096172"
                     /translation="MLINRKIAIAPMVAITDEHFRYIIRLLSKKVTLYTPMISAKSII
                     MGKLNTIVKQTPTDSPIAIQIATDCENDAAKAIEILENKFNFDEYNLNVGCPSSRVQD
                     ANYGACLMQTPTQVGKILQAMKKNTNKPVSIKHRIGIRHNKREYHETNYRELKQFVEK
                     IIEYEIKNFTIHARVAILNGYSPKDNQNIPKLRHELVYQLKQDHKNIFIEINGGIISS
                     NHIKTHLSYVDSVMIGRAAAKDPYFIAKISREFLEEKEKIPTREEVLLKMVEYIKEYN
                     EHLSINTILKHIMRIVFAKDNARKFRQILSAPFPKNLKNHEILLSAIEHLREDTLKSN
                     F"
     gene            complement(228789..230063)
                     /locus_tag="BT0_RS01085"
                     /old_locus_tag="BT0226"
     CDS             complement(228789..230063)
                     /locus_tag="BT0_RS01085"
                     /old_locus_tag="BT0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="seryl-tRNA synthetase"
                     /protein_id="WP_041178430.1"
                     /db_xref="GI:752506565"
                     /translation="MLDLKFIRDNLELIQKNIKDRGLELDIDLLISLDDERKKLVTKI
                     GELNAIRNENANAMKGKIDDSRRHSFIETGKVLKSEIAILEEKLSHITSKLLIEHKRI
                     PNISAPDVPVGEGEDGNIVLKVSGSIPNFDFKPKDHLEIGIDLDLFDFERAREVSGNK
                     FYYLKNEAVFLELALINFALNKLKPKGFDLFITPDIAREFIVDGIGFNPRGTESNIYK
                     IEDTDKYLIGTAEITLGGYYYNTILDLKSPLKMAGLSHCFRKEAGAAGQFSKGLYRVH
                     QFSKVEMFCLCKSEDSDRIHNEFLALEEEIFTELEIPYRVLNVCSFDLGASAYKKYDI
                     EAWMPGRGDKGEYGEVTSTSNCTDYQSRRLKIRYKDDGQSKFVHMINGTALASTRTII
                     AILENFQDARGGVRIPKNLVKYTGFDYISPKN"
     gene            230211..230927
                     /locus_tag="BT0_RS01090"
                     /old_locus_tag="BT0227"
     CDS             230211..230927
                     /locus_tag="BT0_RS01090"
                     /old_locus_tag="BT0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772181.1"
                     /db_xref="GI:500096174"
                     /translation="MIKVSTAQKLFILTSLLMIFIGCTKKTKKINFNEIDTLYNEKDE
                     IIIQSILAEEENEFFEYKIRIPKVIDARTKNNKIKTFNDEVENYSNEIVNNLESAAQN
                     IKQESKKPSLNIDYEIYHGYGIYTIIVSATQTINDTSITNHRSYYISDNGDYIYNIDE
                     IINVEEAFPYFTQRIKEKIEQTYPNKLLFDLQQAVIYFENKKIIIKFPFYVFNLDDIK
                     DTENIFEFNEEEAQKYIKQG"
     gene            230940..233858
                     /locus_tag="BT0_RS01095"
                     /old_locus_tag="BT0228"
     CDS             230940..233858
                     /locus_tag="BT0_RS01095"
                     /old_locus_tag="BT0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772182.1"
                     /db_xref="GI:500096175"
                     /translation="MKRKKIFNLISKTYLEEYDTEGCYFKHESGLEIFELKNTTFKEN
                     AFGIAFKTIPLNNTGVAHILEHTIFCGSNKYRIKDPFLYLMKGSLNTFLNAMTFPDKT
                     LYPAASTIQKDYFNLFKIYADAVFNPLLKKEAFMQEGYNINPNNFKLSGIVLNEMKGN
                     YSNKNSLINEIATNSLFSEGTYQYDSGGNPINIIDLTYEEFIEFYRKHYTLENCKIFL
                     FGNIDTNKNLNFIEKYIIRPYTKEKLNINYNIKKTTRWNKGKTLNFDIPKETENTLGV
                     YAINWLCTDIKNIKENIGLEILSEILLDSSCQFTINMLKSNIGDVIADVSGINTDIKE
                     CVFSFGLQNVVPGKMEEFKNMVFNELKNLVKVKISEELIQGILFGYEFALKEEKGQGW
                     PISLMIKSFKGWLHGMHPTETLKINCHLDEIKNKLEKGEPYFENLIEKYLLNNNHYTL
                     IQFNPSDTVLKEMEEKIEKKLMDREIDIKKNPEKFAEFTKDYNQFKDYQKKEDLKSDI
                     TKLPMLKIEDLPKEVEKSLILNETPELKTHTFELKKNNNIFNVHLFFKLNFLQKEDFM
                     HLSLLKRAIQDLSTQNYSYVDLNNKIQNTLGQLNIHESYEEDIQGNMINLFNINFKSF
                     NNKIQESFILIKEILININFHDYDRLKEIVLSLKNDFKSILIPKGHIFATIRSESKLS
                     QSKYLKELQVGLTGREYWQKVKTDIESLRELASNLERLRDKIIFKDNLSSLLIGSTND
                     VIKRLESELFTLRESLSKKTYINNPITIQPSGNILTEIIIIPSKISFNSISFASYKIT
                     DENYPKINFLTHILKSGILWEKIRVMGGAYGAFASITNGIFSFASYRDPNFVKTYQAF
                     ETSLEELANNEIKNEELYTYLVGVIGLSTNVKTKSIEILESHKRKMLNISDQLRQDIR
                     NSYFKITSTDIKNISEQVLNQLKQKNSITSLVNHATYEDEKEKLEAFIGTNYKVKKIY
                     "
     gene            complement(233875..234123)
                     /locus_tag="BT0_RS01100"
                     /old_locus_tag="BT0229"
     CDS             complement(233875..234123)
                     /locus_tag="BT0_RS01100"
                     /old_locus_tag="BT0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422001.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L31 type B"
                     /protein_id="WP_025375264.1"
                     /db_xref="GI:644921308"
                     /translation="MKKDIHPVSNLVIFKDSSNGTMFLTRSTLTSKETIKYSDNKEYP
                     LITVEITSKSHPFYTGQQKFVDAAGRIDKFNKKYKKLK"
     gene            complement(234181..235725)
                     /locus_tag="BT0_RS01105"
                     /old_locus_tag="BT0230"
     CDS             complement(234181..235725)
                     /locus_tag="BT0_RS01105"
                     /old_locus_tag="BT0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination factor Rho"
                     /protein_id="WP_011772184.1"
                     /db_xref="GI:500096177"
                     /translation="MDKKCAEFDLEDEMKRLNSSKELKIEDNSKKKIVKVVTKKESVA
                     SGLKNSNIDKLRESNGVSSGFDYDISDPDLENSIKTLEQSNIINFLGGKDFIVIDSLY
                     DKPITEIRKVVEGLGTNHTIAVTMKKTELIFLLVKILTEHNINVLFTGVLDVLSDGYG
                     FLRTASNSYLSGGNDVYVSPSQIRLFNLRTGDILYGQIRSPRDGERFFAMIKIKSIND
                     QDPTFAQNRIPFDNLTPLYPSSKLDLEYENCNISTRLINLFSPIGKGQRALIVSPPKA
                     GKTTLLQKIANAITTNYPDIVLMILLIDERPEEVTDMIRGVKGEVIASNFDEQASRHV
                     QVAEMVIEKAKRLVENKKDVVILLDSITRLARAYNQTMPTSGKILSGGVDSNALHKPK
                     RFFGSARNIEEGGSLTIIATALVDTGSKMDEVIFEEFKSTGNMELILDRSLADRRLFP
                     AINIKKSGTRKEELLLSEEERSKILLIRKILGGVDDYEGVEALVEKMKKSKNNEIFLK
                     TMSNGD"
     gene            complement(235814..236221)
                     /locus_tag="BT0_RS01110"
                     /old_locus_tag="BT0231"
     CDS             complement(235814..236221)
                     /locus_tag="BT0_RS01110"
                     /old_locus_tag="BT0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772185.1"
                     /db_xref="GI:500096178"
                     /translation="MPVNIKDSYKWDCKLDSSLIFRGKLKFEGALYLDSSFEGEIFSK
                     SGILFIGKNSKVITDVVICDTLIIEGILKGNINASNKVYLNSGCKIYGDVKTKKIFIN
                     DNIVFDGKCEMIKSNESIDLFSFTVSQLKDTFQ"
     gene            complement(236225..236551)
                     /locus_tag="BT0_RS01115"
                     /old_locus_tag="BT0232"
     CDS             complement(236225..236551)
                     /locus_tag="BT0_RS01115"
                     /old_locus_tag="BT0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integration host factor"
                     /protein_id="WP_011772186.1"
                     /db_xref="GI:500096179"
                     /translation="MSFSRRPKVTKSDIVNQISLNIKNSNEKLEKKYIRLVVDAFFEE
                     LKNSLCLNNVIEFRSFGTFELRKRKGRQNARNPQTGEYVNVDDHHVAYFRPGKDLKER
                     VWGIKG"
     gene            complement(236563..236820)
                     /locus_tag="BT0_RS01120"
                     /old_locus_tag="BT0233"
     CDS             complement(236563..236820)
                     /locus_tag="BT0_RS01120"
                     /old_locus_tag="BT0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZ26.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S20"
                     /protein_id="WP_011772187.1"
                     /db_xref="GI:500096180"
                     /translation="MGNNPSALKRARQNLKRNLRNVSVKSELKTIEKRCMNLIREGKK
                     EEALEFFKFVSKKLDTAARKRIIHRNKAARKKSNLSILLLR"
     gene            complement(236894..237715)
                     /locus_tag="BT0_RS01125"
                     /old_locus_tag="BT0234"
     CDS             complement(236894..237715)
                     /locus_tag="BT0_RS01125"
                     /old_locus_tag="BT0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772188.1"
                     /db_xref="GI:500096181"
                     /translation="MNEFFFYKIRLIFIFLLNLSFSVFYMLLYKNIFGIFVLFLILIN
                     LFLIIFYLRYFYELDCKGDKIFYKKFYPKVNFTFNDILWFEKRLSGSILILGLNNKRK
                     IKICFLRKKYLSNFFRKLKIMRSDLFIAKNEELPIRYYISGLYLLMFLCRILINMSVC
                     YIAFGSIIVFFFIFLIGIKVLIDDILVIKDLVIFYEFRKDSVYEKKIFSHKEYFYKFF
                     NSIFVHVSELSRDGYLSFVYNHRGTLKKVYINNEGMSYSMQKVFAYIDKYCRQCV"
     gene            complement(237733..238839)
                     /locus_tag="BT0_RS01130"
                     /old_locus_tag="BT0235"
     CDS             complement(237733..238839)
                     /locus_tag="BT0_RS01130"
                     /old_locus_tag="BT0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003323777.1"
                     /note="probable translation factor; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP-binding protein YchF"
                     /protein_id="WP_011772189.1"
                     /db_xref="GI:500096182"
                     /translation="MALNVGIVGLPNVGKSTLFSSLTASKSEIANYPFCTIDPNIGIV
                     EIPDERLSRIASLVVSKKTVPAVIEFVDIAGLVKGASRGEGLGNKFLANIREVSIIVH
                     VVRCFEDREVIHVDGDVNPQRDISTINTELCLADLDTVQKSILKNEKNVKSVDKKISE
                     NAKKIVSMLKSLEKHLMDVRPVIEFEFDEFGYDFIKSLNLLTIKKVIYVCNVDENSLC
                     GNKYTDTVKNIALGEGNDYLILCAKVEAELIEIKDLRERREMLESMGINDSGLSNLIR
                     TTYYALGLRTYFTAGEQEVKAWTFMDGMKAPEAAGIIHSDFQRGFIKAEVYSFNDLIE
                     YQSVQGVKEKGRFRLEGKDYLVRDGDIIFFKFNV"
     gene            complement(238865..240928)
                     /locus_tag="BT0_RS01135"
                     /old_locus_tag="BT0236"
     CDS             complement(238865..240928)
                     /locus_tag="BT0_RS01135"
                     /old_locus_tag="BT0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772190.1"
                     /db_xref="GI:500096183"
                     /translation="MFCITISNLYSICLSIKRMILIFNLFVLFFLSTFVLNSQGIVTN
                     KDAQEEFKLALNSYNNGLYDDALLSFKRVLSFDPSNLDYRFWIGNVYYRLGYVEEALR
                     EWRNLQSQGYKAAYLRQLISIIEQRRGISLSNELDVERFIQVAFLNNSIYRRPNGYQI
                     TSLKADQYGGYYAVNFVGNEILHFDANNNVSVLIKDGITSLKSPYDVIELGDLLYVTL
                     CSNDEIGIYDKTFGIKRGSIGKKGTDPGELLAPQYMTVDERGYIYVSEWGNKRVSKFD
                     AKGNFILHFGVKTVGYMGLLGPTGVTYLNGNIYVADTSKNSIEVFDTSGNHLYSIATS
                     LEGIEGLSSDFTGNNIIISSKYGVYKYSVLRKTFVKLLKADKIDSKISSSIIDVNNQV
                     IVSDFDNAQISVYKSDVSVYDSLNVDVRRVIRVGGPKIYVELNVSNRNGLPVIGLKSE
                     NFAIANEEYYIVNPKIAYDINTSNDMNIAIVFDKSFAMKNYESEQIMGVNTLIKSRAN
                     KKFSFINATSVPLVDNIESLLSTIHKTNSLGAYDSNYVKTDVSLKLAGSELMSKSARR
                     AVLYFSNGNLSRSAFNRYSIDTILSYYKNNDIRFYLILFGNNPVDSKLQYLVNETGGA
                     IIPFSSYEGVSRVYDLMMKQKTGTYLLEYDYPGLQEPDGYYNLSVEVNFNQQIGRGEF
                     AYLVN"
     gene            241028..242581
                     /locus_tag="BT0_RS01140"
                     /old_locus_tag="BT0237"
     CDS             241028..242581
                     /locus_tag="BT0_RS01140"
                     /old_locus_tag="BT0237"
                     /EC_number="2.3.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="apolipoprotein N-acyltransferase"
                     /protein_id="WP_011772191.1"
                     /db_xref="GI:500096184"
                     /translation="MKTRYFLLATFSGMLTTLAIPNEIKNMGYSSIGLVAYIPLFIAL
                     IKVKDKKTLIGLTIFYFLVANSLQNFWLAFFHSFGLITFLGAVSGYIPYAFVLGYFLY
                     YALKTFKNKTLTLAILFTFYDYSKSIGFAAYPWGFSAFMVNNFNDLIQVADIFGVFFV
                     CFIVYFFNAGIANFLIRQNKINTLNVLFSVLLVSTSFAYGIMKKIELNPILNKEIDTL
                     NIAAIQLNIDPWLPGNHKKGIQTSIKLTKQALRKHPDTELVLWSEGALALPFNSYKDY
                     IYYDEELIELYDSVNELISNSKAHFVIGSPSKPDKRSLTHQNSVYAIKPNLKIENIYS
                     KIFLVPFSEKIPFYEYKFVRKFFRQNFNITGQINGNKLEIFKLKKFNLGLLICYDDAF
                     PDLARNYKKQNANLLLNFSNDSWSHTDSSEWQHFVVAKFRSIENGIKTVRATNSGITA
                     IINEYGENVKSLATFKKGYLISRIKLPPRFTTIYEHIGDLFIYVLAIVIVIMTLRFYF
                     IEKSTHLSS"
     gene            complement(242545..243309)
                     /locus_tag="BT0_RS01145"
                     /old_locus_tag="BT0238"
     CDS             complement(242545..243309)
                     /locus_tag="BT0_RS01145"
                     /old_locus_tag="BT0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178431.1"
                     /db_xref="GI:752506566"
                     /translation="MKKLVLLFFSFAFISLFAKNGSVVDEQQKELAIFYYEVGQRYID
                     VGKVRKGKIFQKKALEIYPRLKEEVNLKVAVEEIDSKIKLEGETNFLAFDDVKLDDIP
                     GIIHSKIEISEITNAPKIEYIANREREKYKEQAVKFQFSKFVRALLLQDLNLLDSVVA
                     DEVKVLGRIEPKTDFISSLELVSNDISKDDVSYLAVDDFYDLKSLNIIKNTDVSYSVR
                     VKAKKNDVTKNIPFWRDVQTLCFENQDDKWVLFSIK"
     gene            complement(243379..243981)
                     /locus_tag="BT0_RS01150"
                     /old_locus_tag="BT0239"
     CDS             complement(243379..243981)
                     /locus_tag="BT0_RS01150"
                     /old_locus_tag="BT0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyguanosine kinase"
                     /protein_id="WP_041178432.1"
                     /db_xref="GI:752506567"
                     /translation="MIVIEGLIGVGKTTLGHVLSKEFNIPFYSELNNEFTLSMLDKFY
                     KDKSRWAFLVQINFLNERFKLIKSIFKTKGGILDRSIYGDRVFASLLNDSGYISNDEY
                     KIYLDLLDNMLEHSQKPVLMIYLDCSVDEAERRIKNRNRSFETGIPREYLEGLNEKYL
                     SWYDSYDLSPKLSFDYNSINIFDDKHKSKLIAFIKDKLVI"
     gene            244234..244650
                     /locus_tag="BT0_RS01155"
                     /old_locus_tag="BT0239A"
     CDS             244234..244650
                     /locus_tag="BT0_RS01155"
                     /old_locus_tag="BT0239A"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772194.1"
                     /db_xref="GI:500096187"
                     /translation="MNSKYNLNSQITLFKAIIKKSIKERCKKFFISKRFTNKIKELIK
                     SFNLYSTNHIILNDQKGNGHNWHKFITHNLIPLITKNLLMNKNLCYKNKYKEHINGLI
                     SSFTNSKIMNIEISNEKRAISQHKKTSLKFSYLAII"
     gene            244795..245556
                     /locus_tag="BT0_RS01160"
                     /old_locus_tag="BT0240"
     CDS             244795..245556
                     /locus_tag="BT0_RS01160"
                     /old_locus_tag="BT0240"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol uptake facilitator protein"
                     /protein_id="WP_011772195.1"
                     /db_xref="GI:500096188"
                     /translation="MIYIRFKEFIAEFLGTFILLALGTGSVAMTTLFPSNPSVTGEII
                     KGGYTNIVLGWGLGVTFGVYTAARISGAHLNPAISIGLATIGRFPTAKLFHYISAQIL
                     GAFSGALMTLIVFYPKWIEIDPAFENTQGIMSTFPAVPGFWPGFIDQIFGTFLLMFLV
                     LVVGKFIKGDTQNPFFPFIIGSIVLAIGISFGGMNGYAINPARDLGPRILLLLAGFKN
                     HGFDEMNVFIIPILGPIIGTILGAIVYEFTLEDKE"
     gene            245618..247111
                     /gene="glpK"
                     /locus_tag="BT0_RS01165"
                     /old_locus_tag="BT0241"
     CDS             245618..247111
                     /gene="glpK"
                     /locus_tag="BT0_RS01165"
                     /old_locus_tag="BT0241"
                     /EC_number="2.7.1.30"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772196.1"
                     /note="Converts glycerol and ADP to glycerol-3-phosphate
                     and ADP; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol kinase"
                     /protein_id="WP_041178564.1"
                     /db_xref="GI:752506699"
                     /translation="MKYILSIDQGTTSSRAIIFDKKANIKGFAQKEFKQIYPYPSWVE
                     HNPNEIWSSILGVMAEALANARTFPNEIEAIGITNQRETTIIWDRQTGHPIYNAIVWQ
                     DRRTAQLCDELKARGQDKNFLKKTGLVLDAYFSGTKIKWILDNVAGARKRAEKGELCF
                     GTIDTWIVWNLTKGKIHITDYSNASRTLLLNIKSLEWDEELLQILNIPKSILPELKQS
                     SEVYGKTDSSILGTEITISGIAGDQFAATFGQACLQKGMAKNTYGTGCFVTVNIGKNP
                     IINEQQTLLTSIAWGRKNSITYVLEGSVFIGGAVIQWLKDNLELFRKNSDAEALAASV
                     NNNGGVYFVPAFVGLGTPHWDSYARGTIIGLTRSSTKEHITRAALESIALQSFDVLTE
                     MQNSIQGFAIKELRVDGKASQNNLLMQFQADILQCNVVRPKITETTALGSAYLAGLAV
                     GYWESTEEITSLWKSDKIFEPSMENSKREDLIYNWHKAIKRAKDWIQ"
     gene            247216..248580
                     /gene="glpT"
                     /locus_tag="BT0_RS01170"
                     /old_locus_tag="BT0241A"
     CDS             247216..248580
                     /gene="glpT"
                     /locus_tag="BT0_RS01170"
                     /old_locus_tag="BT0241A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772197.1"
                     /note="catalyzes the uptake of glycerol-3-phosphate into
                     the cell with the simultaneous export of inorganic
                     phosphate from the cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate transporter"
                     /protein_id="WP_011772197.1"
                     /db_xref="GI:500096190"
                     /translation="MKKLFDFLKPAPHIKRVHKEIEDSLYKKLRLQIFISIFIGYAGF
                     YLTRKIFSFAIPELEKEGFNKGQLGIALSGVSIAYGFSKFIMGNISDRSNPRYFLALG
                     LLLTAIITLLFGLFSWQLLDPTTAIMLMFILMFANGWVQGMGWPACGRTMVHWWAKKE
                     RGITVATWNLAHNIGGGAAGIISAWALIHFKEWQAIFYVPAILVLGIAIFILITLRDT
                     PQSVGLPPIEEYKNDYPDDYTEEAEKELNAKDIFIKYVLNNKLLWYIATANAFIYFVR
                     YGVLDWAPSYLSQVKNFSIKNSGWAYSLYEFSAIPGTIICGWISDKIFKGRRSETGII
                     FMTAALITIIIYWQLPENNPTLTTILLAIIGFLIYGPVMLIGLHALDLAPKKAAGTAA
                     GFTGLFGYIGGSVTASAITGLVLQHFNWNVYFYLLITACIFSILFISLTLKQEKKINN
                     TNKQ"
     gene            248663..249670
                     /locus_tag="BT0_RS01175"
                     /old_locus_tag="BT0241B"
     CDS             248663..249670
                     /locus_tag="BT0_RS01175"
                     /old_locus_tag="BT0241B"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="WP_041178565.1"
                     /db_xref="GI:752506700"
                     /translation="MKTKLLMLTMNIFLIIACQNEKMSMTNKKPPLIIAHRGASGYLP
                     EHTLEAKAFAYALGADYLEQDIVLTKDNVPIIMHDPELDTTTNVAKLFPERARENGRY
                     YSVDFTLDELKSLSLSERFDLETRKPIYPNRFPLNEYNFKIPTLEEEIQFIQGLNKST
                     GRNVGIYPEIKKPLWHKQQGKDISKIVIEILNKYGYKSKEDKIYLQTFDFDELKRIRE
                     ELGYQGKLIMLVGENDWDEAPTDYEYIKSQEGMTEVAKYADGIGPWIPQIIIDGKITD
                     LTSLAHKYNMEVHAYTFRIDSLPSYVKDANELLDLLFNKAKIDGLFTDFTDTVVKFVK
                     Q"
     gene            249712..251274
                     /locus_tag="BT0_RS01180"
                     /old_locus_tag="BT0243"
     CDS             249712..251274
                     /locus_tag="BT0_RS01180"
                     /old_locus_tag="BT0243"
                     /EC_number="1.1.5.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_011772199.1"
                     /db_xref="GI:500096192"
                     /translation="MGKNKKKELRDIDNQDFDLIIVGGGATGLGIGIDSITRGYKTLL
                     IEKFDYAKGTSSRSTKLIHGGVRYLAQLNVPLVKEALYEKALLETNAPHLVSKCEFVT
                     PIYNILNIPYYYFGLSWYHNLLGKHKKSQYKTKLLSKSKTIEKMPNIKTKGLKCSVLY
                     YDASFDDARMAISMLRTFTEKGGIAFNYTEPTNFIKKNGKISGAIIKDRMTKEQVIIN
                     SKCIINATGIFADEIRKLDDTNAANIIKPSQGTHLVINKDKLHTEYAMLMPKTSDKRI
                     LFAVPWYDVIVCGTTDIAINKIEEEPKRLESEIEFIIKNINNYLDIKITKNDILSVYS
                     GIRPLIVAPKEKKNTSKISRNDKIFVSDSNLITIAGGKYTTYRKMAEKVLKRAIEENL
                     IPDSKSITENLKLHGYIEREEALKIPEYFRAYGSDFEHLSQMKDFNKKIHTDLPLNEA
                     QITFAIEFEQAKTVEDILSRRTRSLLFNAKATIESTPKVAEIMMHKLGKSKEWKTEQI
                     KNFKEVATKYLV"
     gene            complement(251360..251854)
                     /locus_tag="BT0_RS01185"
                     /old_locus_tag="BT0244"
     CDS             complement(251360..251854)
                     /locus_tag="BT0_RS01185"
                     /old_locus_tag="BT0244"
                     /EC_number="1.1.1.158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="WP_011772200.1"
                     /db_xref="GI:500096193"
                     /translation="MKINNLVAGVLNLDSKDYKAAKKKVNVNRANIFSSIFKAELVRE
                     DKHFIVFENGEFNLELIKDMLDKINDVGEKLLSEPSRQNVIFYKKTIGEFLSIVLSFS
                     ISLKEQKGGNNGELKRPKYRIIRIINEKLDRLAYSVLQNQVSQIKLLSSIEEIQGLLI
                     NLLK"
     gene            complement(251851..252393)
                     /locus_tag="BT0_RS01190"
                     /old_locus_tag="BT0245"
     CDS             complement(251851..252393)
                     /locus_tag="BT0_RS01190"
                     /old_locus_tag="BT0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772201.1"
                     /db_xref="GI:500096194"
                     /translation="MLNLLSIKKDKKISSSFIFADVKTIVGKGDFFKGELISNNFIRI
                     DGDFLGTINSTKRVIIGEAGRVKSNINANEVVVSGIVLGNVQASNKIKIFQSGCIIGN
                     ISCKSIEVEEGAIIDGYMNIGIGSLSFSEKDVLIYTGSYKVDEDVLIEVNKEMSREES
                     TKDACIDECDKYLFDDEQDR"
     gene            complement(252394..253419)
                     /locus_tag="BT0_RS01195"
                     /old_locus_tag="BT0246"
     CDS             complement(252394..253419)
                     /locus_tag="BT0_RS01195"
                     /old_locus_tag="BT0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772202.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_041178433.1"
                     /db_xref="GI:752506568"
                     /translation="MRDRKGFRILSFFKKLDKIFFTIFSSFLKLLSNVYSIFRQNISF
                     MIIPHVKGDVKNIKISFLTLFLFFLFFLFIFIGFVLLSINYVTLKSIVKSTEKNYALA
                     ESEIEDFRNTVVEINSVASNFSKVLDELNVSLKIKESNIDLNRSKLDGDLADFLDLQM
                     LEANALKELNDLKNVKNTIEGSISPLKSIVKLLHSQNKLLNDIPSLWPIVKGDGIVSL
                     HFGPAIEPFTRQWYIHKGIDLAGVRIGTAIVAAADGEVIRASYQVTGYGNFVQIKHKY
                     GLSTLYAHMSRLNISKGSYVRKGQVIGFLGQTGYSTGPHLHYEVRIGSQVVNPDMYLN
                     LATGASK"
     gene            253649..254248
                     /locus_tag="BT0_RS01200"
                     /old_locus_tag="BT0247"
     CDS             253649..254248
                     /locus_tag="BT0_RS01200"
                     /old_locus_tag="BT0247"
                     /EC_number="3.6.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772203.1"
                     /note="HAM1-like protein; Rec-dependent growth; RgdB;
                     yggV; it is suspected that this protein functions to
                     remove misincorporated bases such as xanthine or
                     hypoxanthine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribonucleotide triphosphate
                     pyrophosphatase"
                     /protein_id="WP_011772203.1"
                     /db_xref="GI:500096196"
                     /translation="MKTLFFATTNINKINEVKQILDIPNIKIKIPKNFDVKETGKTFK
                     ENSLLKAKTLFESLDKKKPVFSEDSGLCIKALNLEPGIYSKRYDQYKLGKKLGTNEKN
                     HLIIDLMKDKENRTAYFICIVSHISIDGTITNFEGILNGTIALDIDCYKKNGFGYDPI
                     FLTANNKRLSELTLTEKNKISHRGIAFAKFKKFLMQSLN"
     gene            254382..256154
                     /locus_tag="BT0_RS01205"
                     /old_locus_tag="BT0248"
     CDS             254382..256154
                     /locus_tag="BT0_RS01205"
                     /old_locus_tag="BT0248"
                     /EC_number="3.4.24.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oligoendopeptidase F"
                     /protein_id="WP_011772204.1"
                     /db_xref="GI:500096197"
                     /translation="MIERSKINEDDKWDLSSLFKNNEEYKETVEKIKLKLQDFKEYEK
                     LEFNLNIFKQALNDYYEIEEELERTVYYTQIQLETDVSNQTSNELRAININLETYASN
                     STSFFIPKILKTDTNQIREWLQDIELKDKKIAIEKILREKEHVLSKDEERILANYTSL
                     YSSYNDIFSVLTNADMEFGEIDGKPLSNATYSLFLQNENQEIRREAFLKFYQEYKKHE
                     NTLSNLLIADINKNKFLAKTRKFKDTISMKLFQNNIDKKVYMNLIETVNENLSVLHEY
                     YEFRKNILNQEYLNHYDVYVPLTKNIKFKNSFKEACDKILKSLEILGSEYTEVLRKGL
                     LEERWVDKYENKGKRAGAFSAGSYNGKPYILMNYKDESIRDMFTLAHEAGHSMHSYFS
                     IKNNPFPQYQYSIFEAEIASTVNEQILADYLLKNENDIEKIKYIKLNQIDDLLATFFR
                     QTMFAEFEYIIHEMINKDEPVVKETLKQTYLNLLKKYFGPNFKLDENSSLECLRIPHF
                     YSPFYVYQYATGITAALLIYKNIKNNKKDATKNYINFLKIGGSKYPLESLKVTGVDLS
                     LKSTIKNTINIFKERLEDVKKLFE"
     gene            256166..256873
                     /locus_tag="BT0_RS01210"
                     /old_locus_tag="BT0249"
     CDS             256166..256873
                     /locus_tag="BT0_RS01210"
                     /old_locus_tag="BT0249"
                     /EC_number="2.7.8.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidyltransferase"
                     /protein_id="WP_011772205.1"
                     /db_xref="GI:500096198"
                     /translation="MKKLLNLILAWSVHILTASGLIVSLYSIISIINTDYNLLLKLTI
                     LGLLIDGIDGTLARKLKIKEIIPTINGELLDNIVDYINYTFIPTIFFYYGNFISNEYK
                     IITCIGILLASAYQFSRLDAKTSDDYFRGFPSLWNFLIIFNIIFKLDQITNLSIILLC
                     IIFSFVPIKVIYPSKTKEFKYITLPVTVIAALSVILITFAKLPDTYLKIGKTLIIFYC
                     LYLILMSIYLTYKTKKK"
     gene            256883..257491
                     /locus_tag="BT0_RS01215"
                     /old_locus_tag="BT0250"
     CDS             256883..257491
                     /locus_tag="BT0_RS01215"
                     /old_locus_tag="BT0250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772206.1"
                     /db_xref="GI:500096199"
                     /translation="MHIILEFIDLNIAYSPIVFFGLLILAGFNIPISEDAIVIMGGIL
                     SSRKNEYTILIFLGIFWGAYIGDIISFYIGKFLANKFLKQKKQTNKLIDKMNYYYKRY
                     GSLTLLFGRFIPFGFRNAIFISAGMGNMSTSNFLITDFFAAMISITTYFTLSFKIGES
                     FKLIFPKIRIISLIALIIITIIILIIYIIRKKKIKKVDKLFK"
     gene            257510..257593
                     /locus_tag="BT0_RS01220"
                     /old_locus_tag="BTT0005"
     tRNA            257510..257593
                     /locus_tag="BT0_RS01220"
                     /old_locus_tag="BTT0005"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:257544..257546,aa:Leu,seq:gag)
     gene            257736..260264
                     /locus_tag="BT0_RS01225"
                     /old_locus_tag="BT0251"
     CDS             257736..260264
                     /locus_tag="BT0_RS01225"
                     /old_locus_tag="BT0251"
                     /EC_number="6.1.1.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZ46.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="leucyl-tRNA synthetase"
                     /protein_id="WP_011772207.1"
                     /db_xref="GI:500096200"
                     /translation="MSEYNFTKIEKKWQNYWDKHKTYKVNEDPNIPKEKRIYILDMFP
                     YPSANGLHVGHPEGYTATDILTRYKLLNGFNVLHPMGFDSFGLPAENYAIQTGEHPKK
                     ITEKNIEKFKEQIKALGFAYDWDREIRTHDENYYKWTQWIFLKLYKKGLAYIKEMPVW
                     YCPDLGTVLSNEEVIQTPDGPRSERGFHKVQRKPLRQWVLKITEYAERLIKDLEEIDW
                     PESVKEMQKNWIGKSIGAEIEFSIKASKEKIKVFTTRPDTIFGVTYLVLAPEHNIVDK
                     ITKDELKTIIAEYKDKEILKSDLERTSLEKDKTGVFTGAYAINPITEEEIPIWIGSYV
                     LGIYGTGAVMSVPAHDERDFEFAKKYNLPIKQVVSQTGNNEILTKPFTENGISINTPE
                     EFNNLKTEKVKTKVIEWLTKNKKGQKKVNYKLRDWIFSRQRYWGEPIPIIIDDDLNEI
                     PLEEDELPLRLPEIENYKPSDTGESPLSKVQNWVNVKRNGKIYKRETNTMPQWAGSCW
                     YYIRYLDPNNEKEFASKEKINYWMPVDLYIGGAEHSVLHLLYARFWHKVLYDLGYVNT
                     KEPFKKLINQGMITSFAYQDENGILIPNDEVKKRDNKFFSKTNNKELKQIIAKMSKSL
                     KNIINPDDIIKEYGADSMRIYEMFMGPLTDSKPWNTQGLIGIFRFLNKIWAIKNKELT
                     KESAAKEIISGLHKTIKKVTEDIENLNFNTAISSLMIFINELLKHDKNYLEIFKPLTI
                     ILAPFAPHLGEELWEYMGEQPSIFKNAKWPKYDPNLIIDNTREIVLQVNGKIKDKIIL
                     NKGINEDTLKDIALKNHKIMQNIQNKQIIKIITVKDKLINIVTK"
     gene            260275..262560
                     /locus_tag="BT0_RS01230"
                     /old_locus_tag="BT0252"
     CDS             260275..262560
                     /locus_tag="BT0_RS01230"
                     /old_locus_tag="BT0252"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772208.1"
                     /db_xref="GI:500096201"
                     /translation="MDLETLSIKYRVFILIIFTLITIFLGFFLKNIKFDSNILKLIPK
                     NKKTEKIIDIDKSNSLLSTIVMFKDKKSIFNKETFGKINKVANDITKILKVTPNSVTS
                     IFTYFPQFKKDVYTDEDITEIRNKVNSSSFIKNIFLNDDATLIYFIVISTTDDKTNFS
                     RSLKNELEAMEAAIKRYETDDLKLYLTGDLIVREKILNYMADDFKLLGPLATLVVILS
                     LYFIVKNVLGAILPVLIATFALIWTFGIKSIVMSPITVPETTMVVLLISIGCANAVHI
                     INGILKRIKNEPFTEKTIITTIKTLRTPIILTSLTTAFGFLSLISSSIQAYKTMGIFM
                     STGVIIAMLMSLLVLPGILTYIPFKYKNKENKNAKNDFLEKLSLINQTVTQWILNNKY
                     LSSIITLIILLTSIIGLFKIEINFDEKDYFKENTSVKQTLNLMQKEIGGTSIIKIEIN
                     GTTGEFKNEKNMKNLDLITDNLDKFTEKTQSSSINGIIRLMNFKFKKENPKEYRLPEN
                     QAILNKLILLISRSNSIKNMTKMYINDDWSQISIIVRTDQNSTEEIKNFANYASNLIE
                     EYMPGHEYNFSGAYDKILISKTMVVEQVTNIITTLSAITILLMLFFKSIKTGIIIVIP
                     VAWSVFLNFAVMKLFGITLNPATATIASVSMGIGVDYSIHFFNAFILNYQTTKDYKKA
                     LIKSIPNVFNGIFANSISVGIGFLTLIFSTYKIIATLGAIIAFTMLTTSLASLTLLPL
                     LIYLFKPTVKTLKTTNEILTE"
     gene            complement(262619..265039)
                     /locus_tag="BT0_RS01235"
                     /old_locus_tag="BT0253"
     CDS             complement(262619..265039)
                     /locus_tag="BT0_RS01235"
                     /old_locus_tag="BT0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lon protease"
                     /protein_id="WP_041178434.1"
                     /db_xref="GI:752506569"
                     /translation="MEEVKNTVSKGKKRSKNSGGILPHFDKPVRVPLIAVPSHPVFPG
                     MFIPIVIVSDTDMKAVDYVIKGNGIISLFVLRDKFLEKSRTKNDKLIINYKKDIYSVG
                     ITAKIVKKINLPDGGYNIFVSTIDRVKFVKVVLNEDFPIIEVDYLKQIPIKKDDVQSK
                     AIYSSILLRTKEIFSHRKMPEFQLNMVNIEDKGRLCDVVAGMISSSKDAHQEVLETLS
                     VKDRLKKVLELIYEELNLIEIQNKIAKGIQEKLEKQQKEFFLKEQLKAIKAELGVGDE
                     KSNEFLKLKAKIDSLALKGEALEAVERELEKFSFLEKHSSEYIVVRNYLELITNLPWG
                     ESKVNFDKFNLQRAEKILDKTHYGMREVKDRIIEYISVLKLRKSQKGAIMLLVGPPGV
                     GKTSIGTAIAEVLKTKFFRFSVGGMKDESEIKGHRRTYVGALPGKIIQGLRITKTNSP
                     VFLIDEIDKVSASNYGDPFSALLEVLDPEQNINFRDHYLDLPFDISNVFFILTANSLE
                     TIPTPLLNRMEIIQLSGYVDDEKIEIARKYLIPKVLNENGVNKDSLKFQGSALVQIAR
                     EYARDNGLRNFEKYLKQIVRKVARKLIEDKSVKAYQISKENLEEYIGIPVFRKEEFLH
                     KVMSPGMVMGLAWTNYGGSTLVIETVKTESKSPGIKLTGRLGDVMKESANIAFTYVNS
                     ISNELKLNKSFFEKYMIHLHIPEGAIPKDGPSAGITIASAFISLALNKVVRPHLAMTG
                     ELSLTGNVMAIGGLRAKIIAAKRSGLEHIIIPKSNKVDLDDIPINIKNGINFHLVDNM
                     REVIKLLF"
     gene            265134..265820
                     /locus_tag="BT0_RS01240"
                     /old_locus_tag="BT0253A"
     CDS             265134..265820
                     /locus_tag="BT0_RS01240"
                     /old_locus_tag="BT0253A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772210.1"
                     /db_xref="GI:500096203"
                     /translation="MQFNKVNAIITNLYHKKSYSLLNLFHSKGIIHTIIYNSTIKKFK
                     SNINNLVKANFEIVKEKNLCKIIEVNDEEFIMQDLIYEKLIIIYLWIKLINLSFDDGE
                     CFKLFIEATEILNTTSLEKAQLIDLQYKTRFLIIKGFLYLSKLCFQCNKQIDKHYYYD
                     IHINGFNCIKCTNNQNNYINTGSFKYLEYTTQKNIKETLNVNLISKSKELIKIMIKNK
                     INTEFEQTLL"
     gene            265843..267957
                     /locus_tag="BT0_RS01245"
                     /old_locus_tag="BT0254"
     CDS             265843..267957
                     /locus_tag="BT0_RS01245"
                     /old_locus_tag="BT0254"
                     /EC_number="3.1.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="single-stranded DNA exonuclease"
                     /protein_id="WP_011772211.1"
                     /db_xref="GI:500096204"
                     /translation="MKIWEKKEIDIKKENIINIAKKYNISILEATLLLRREIKEEDFL
                     FFIESSVNLMHNPFLLKNINKFIYRMNEAIAEKENVLIFGDKDADGITATIIMYETLK
                     DFGINVTYKIPSNGEFYGLTKEIIDKALEDKISIIITVDCGISNIEEANYARSKNIEV
                     IITDHHLPNKEIDIENIIIDPHLKGDLSPFKEIAGCYVSFKACLALYLSTTNLYNKNM
                     VFLFLERLNNNITLHAIEINNYILKKYITLESNNDLQININKLEEFSQSKYIIVFNKD
                     EQNQLLNEFFNHKIDIETIDISENFVKKYPKFAKKTLKELMQITKYFKYREINIKEKL
                     YYIFYNIIFAINKDLLKNCLKRLKFVAIGTIADNMPIINENRIVVREGLKEIALRENI
                     SINYLLKEANILTKPMITATDIAFKIAPILNSTGRLEKADITIQFLLTEDINQIENKF
                     KEIKNINILRKRKEDISWNTHNENIIFKNDKFIVCYDKHTPKGISSRMATRLSTYYQK
                     VAVFLTRQENIIKGSIRSNNKVNSKELISMIPNHLIINSGGHKAAAGFTLYESVLNEF
                     IKELENALEKIEYKELYEDSILIDAIIPKDFNKKELLKIINLFEPYGHGFREFVFMME
                     NVYIQDLRTIDKNGNSKHISMKIKNNKDYYKAIYFNGTQNIQKLGIKDGQNIDIICTI
                     SEDLYNQNDKILKIIDIKKRQN"
     gene            267957..268895
                     /locus_tag="BT0_RS01250"
                     /old_locus_tag="BT0255"
     CDS             267957..268895
                     /locus_tag="BT0_RS01250"
                     /old_locus_tag="BT0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_011772212.1"
                     /db_xref="GI:500096205"
                     /translation="MINIKSLLFTFITGLLNINAVSNDTIKSYYKKETFQGDNIYFAS
                     NKNFKKLSLLGTNQKPILSASPFKFNAGNREYHIALIGITPMIKEGKRKIKIEFEHKT
                     YIKEIEIKKLKFKKTTVKLNKNKSKLIKSQQSPKEKKQALTLWNIIGNIGDTTIYHYD
                     TLVYPIKDQYKITSPYGDQRIYMQDKKKISSHKMHNGKDYAPLKREKTPIFAAGRGKV
                     VFARDREITGKTVIIQHLPGVFTIYLHLSKFGVKENTIVNTGEYIGHVGNTGISTGPH
                     LHFEVRINGVAVNPDFFLEQMLIDKNQIINNTKRIE"
     gene            268915..269124
                     /locus_tag="BT0_RS01255"
                     /old_locus_tag="BT0256"
     CDS             268915..269124
                     /locus_tag="BT0_RS01255"
                     /old_locus_tag="BT0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RL82.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S21"
                     /protein_id="WP_025375292.1"
                     /db_xref="GI:644921375"
                     /translation="MITVNVDKNEGLEKALKRFKRMIEKEAIIREWKRREYYEKPSTI
                     RVKKEKAFKRKQAKKVRKLKQKIGK"
     gene            complement(269164..271506)
                     /locus_tag="BT0_RS01260"
                     /old_locus_tag="BT0257"
     CDS             complement(269164..271506)
                     /locus_tag="BT0_RS01260"
                     /old_locus_tag="BT0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsK"
                     /protein_id="WP_011772214.1"
                     /db_xref="GI:500096207"
                     /translation="MKNFYHYFHFLFFFMLAVISFSLFVALTPVGNIFIFFVFNLIGH
                     MLLNTFSFLSFYLILYPLVNWYAYRNNIFSKKFVFNWNYTVILFFTLTFWLRINSDLE
                     GSNFINWFLSNFGIMLGNFFVFLILILELVIWIYLNYVLFKDASFVLNTFHFIVFKLK
                     ILFESMFAFLPFLNTLKIKKNIKVYKDCDGNLDAAKTSDKGDNIINDEEYQALWSFKA
                     FLRKPNKPLDVNLDKTIFCQSEVSDDNLSEEQSFQDSQCDLNVTDDSKYKALTEFEDN
                     KLVSSGKIKVGDIRHKGIISNLVKIDYGNLLVGEGSDNYLIDISVFDQREPKSETEDI
                     EYDREIQKQSMILQETFKEFNINAKLIDVIKGPVVTMYAVRPDKGIKLSRITSISDNI
                     ALRLAAVRVRIIAPIPGKEAVGIEIPNKRREFILISEIINSKEFQSDFKVPFALGKEI
                     NGSNVVFDLINAPHLLIAGATGAGKSVCVNSLIASIIFSKSPDDVKLVLIDPKVVELK
                     LFNDIPHLLTPVITDVNRALEALRWCLDEMERRYVLLDNFLVRDINAYNKKILEEGLN
                     EAPLPYLVIIIDEFADLILSARKDLENLISRLAAMARAVGMHLVLATQRPSVDVITGV
                     IKANFPSRISFMVASSMDSRIILGASGAEKLLGKGDMLYVNPTTPFPQRIQGGFLNEK
                     EVYRLVEEVKKFGTPNYIDDEIFIDSIVGADTVVLNPSDEPMFEEALEIIRSTKKASA
                     SYLQRRLKIGYNRAARIIELMEEMGYIGPVNGSKPRDVFI"
     gene            complement(271520..272314)
                     /locus_tag="BT0_RS01265"
                     /old_locus_tag="BT0258"
     CDS             complement(271520..272314)
                     /locus_tag="BT0_RS01265"
                     /old_locus_tag="BT0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP pyrophosphate phosphatase"
                     /protein_id="WP_041178435.1"
                     /db_xref="GI:752506570"
                     /translation="MENVLRVMILGFVQGISEFLPISSSGHLLLLKKFMHIDLPMVFD
                     IYLHFATVLVVVIYYRKRILELVVVLVKFVLRKTTKLDFVKLRLILLISIITLITAFV
                     GIFIENFKELFTLDLVLVNFILTSILLFLLEFKILIFDFKKNILFAGCLIGTMQGIGA
                     MPGISRSGITIFASVLLGFSRSESFEISFLSLIPIVFGSLLLKYKELFESDMLFSVFE
                     INLGAIIAFMVGLFSISLFVKMLKDSKLYYFSVYLIILVSLVYFLF"
     gene            complement(272330..274522)
                     /locus_tag="BT0_RS01270"
                     /old_locus_tag="BT0259"
     CDS             complement(272330..274522)
                     /locus_tag="BT0_RS01270"
                     /old_locus_tag="BT0259"
                     /EC_number="3.2.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transglycosylase"
                     /protein_id="WP_011772216.1"
                     /db_xref="GI:500096209"
                     /translation="MQFMIVLFIKKKKLLNVKTVIMFKQIICLFLLSLFSCSFGKGSL
                     NSNIVKRNVDNFDLSHLNWLWNFDYAGKNFDEYFGIDSNSYVYIAYLFKKIGYDEKFK
                     EYMYKAIKSSNDIASQFAGIKLLEYYNARREYFEAELVGRKLYKRYDNNKFIILGYFK
                     SLYWQKKNDEALLVLNKLEKMNFAQSQENENLLFKAVLYFNASDINSSLIYFSKLFED
                     LPAEYLHVRAHDYLVLEERSNLLSSVFFNLVKFKSLVANGDLKGAISILNDDFKKYYN
                     NFVFLNDVYKAFLGSGYISKALSFFSSLNSVYKDYYLGLINLRLKKDVGFFTIVKYLE
                     NASLENEPYRLEILNEIFGNLIFLQNTRNYFAQNVARFYTDKDRNNLGFIKILDEYIL
                     EAVQLKDYDNLYALYHNGQNIIDGAVLSRLAFINARLIYHKFIASKSRNEYDELLRSS
                     IKYNRISYASFMSKYLLNQSINDFFENDLNIHYDQSDYERFLEGFLKFNLHSYVSAFV
                     ASDFNNGYRFSPNFYRNLYDELVRHEYYYESTLAINYLVKQDNSALSRDDYKRLYPCL
                     YNDLIRYWSKRRKLEPSLVFSLIKAESSFKGNAVSKPGAIGLMQIMPLTSVDVSREIK
                     YYDYDLKQPKDNVIIGTYYLSKRIKMIGEVYKALASYNGGIGNVRKWERDYGHLPKEF
                     FIEAIPFGQTRNYVKKILVYCVLYDALYESKGMDFIIEYIMGEFPKSF"
     gene            complement(274452..275654)
                     /locus_tag="BT0_RS01275"
                     /old_locus_tag="BT0260"
     CDS             complement(274452..275654)
                     /locus_tag="BT0_RS01275"
                     /old_locus_tag="BT0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772217.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178436.1"
                     /db_xref="GI:752506571"
                     /translation="MEFLKGFLAIRLSNDEYFSILSLDDTAVKRVVLGKIADEPNVKL
                     DFYISEHDDFSNSVIIGSFFLDNLRKESANINVYFKIDSMMLYVYGECDGIANKSKFD
                     LSLINLAVDSEEINDLESAKSSDLPVGFSGVEREEEFVKEFGSVAGQYDSLDGDLDNF
                     NDLPNSQNLSADEKLFSNENNFNLLSDSLNSDNGTLVSENLDSDSDLNLENFDFGLTG
                     DGFENNIDEGNDLEEHVLNDKDTVSRDDFDLDNISVDISDSSAASDNSAANAVKLVED
                     KDTDFKSVNVYTLQDSYSDNWDVEDIITDLDNGLGESEFDDVALDFSKEDFATDIEES
                     RLDLDSEEGLIQTSMLYLSLISLFLLIFFSLFLIFSKVLNPRNFAIYDCPFYKEEKIT
                     KCENSNYV"
     gene            275835..277205
                     /locus_tag="BT0_RS01280"
                     /old_locus_tag="BT0261"
     CDS             275835..277205
                     /locus_tag="BT0_RS01280"
                     /old_locus_tag="BT0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772218.1"
                     /db_xref="GI:500096211"
                     /translation="MLPLFIILSSAAISLLIFLFFKIAISNTKIRKKGKHNKTKKLTD
                     KAANILKTNPNEISALQTLNDYYYSNKDFENGIKYAKKLCQLIEENPTNQRIDSFKAF
                     LSYGFYNLERNFNSEALVFLKKAYIMKKTDVDANYYLGIAFLRNAHYKEALHYLTKIY
                     KFDKNNKDALKYIGITLFHMENYTKAVGIFNSISKYIQNDVNALLAYAQSLSQLNQDR
                     LAFSIANKIRNKDGRIYEALLIESEINSKNNNLTKLEDNIREMMKIKPDLPTKTFLKL
                     FYKLGELYIEHENYKKATEAFTRVERIDPHYQKITEKLEFSKRLNENLALRIYLRSPK
                     EKFDNLANAIILKLYKNKFQVRDKKINEITSQFIDINFQLSNNQWEENLIVRFVRTDQ
                     KNFGELFLKDLIAKTKESKLKGLCIAPATFSDKAKQIIEGRLIDLIEGKKLIQILKTL
                     DISKYV"
     gene            complement(277207..278460)
                     /locus_tag="BT0_RS01285"
                     /old_locus_tag="BT0262"
     CDS             complement(277207..278460)
                     /locus_tag="BT0_RS01285"
                     /old_locus_tag="BT0262"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_041178437.1"
                     /db_xref="GI:752506572"
                     /translation="MIIPKKDQNVLKRNRNFLFDRAIKGDFELRDFGNIRNFHRKKRK
                     KFFRFMNIPNKLLDVIKLLFLTLFGRMVIIDNYKYRSSYNKIRLKMINDYDINLTYIF
                     IFRFNAIIFVLVLVFYLNIFSYYGSYIFLSRLSFPKDYFIDTFLYYSDQDLSQINNHL
                     FGVDTNSYEATVRKPFVLKVVKHKINPGETLSHIAARYSITSETLISYNDIKDVRSIR
                     PNFVINVPNMKGVLYTVEKSDSLSSIAKKYKIPKVDILDANNLDNEVLYLGQKLFIPG
                     GKMAKELLRNALGETFLFPTQGVITSGYGYRPDPFTKIISFHNGIDIANVANTPIFAT
                     KEGIVVTAGFSVGGYGKYIIISHNNGFQTLYAHLGSFAVKVGQRVSRGQIIGRMGSTG
                     YSTGNHLHFTIFKDGKTGNPMKYLR"
     gene            278525..279028
                     /locus_tag="BT0_RS01290"
                     /old_locus_tag="BT0263"
     CDS             278525..279028
                     /locus_tag="BT0_RS01290"
                     /old_locus_tag="BT0263"
                     /EC_number="3.4.21.89"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422037.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="WP_011772220.1"
                     /db_xref="GI:500096213"
                     /translation="MIKTHKQVLIPIILALLLMIAIIKISLSFHLVKGSSMSPKILEK
                     HWIINNKLAYGIRLKNSKTYIILWGLPKKNEMVLIKDPITKKISIKKIFAIPGEKFIK
                     LKQNVISIHNLNFNIDKEHLKILENIYIPKDYYLVVGENKKVSLDSREYGFININDII
                     GKIIYCL"
     gene            complement(279074..280582)
                     /locus_tag="BT0_RS01295"
                     /old_locus_tag="BT0264"
     CDS             complement(279074..280582)
                     /locus_tag="BT0_RS01295"
                     /old_locus_tag="BT0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp70"
                     /protein_id="WP_041178438.1"
                     /db_xref="GI:752506573"
                     /translation="MEKWIGIDLGTTNTVASYFDANSRVILNDRGERMTPSIVSFTDS
                     GIIVGSIARHQILVNPDKTFYNFKVDIGTEVSYEVGNNTYRAEDIASYLLLNVKMNAE
                     KFLGTEICDVVITVPAYFSEIQRRGVVEAASLAGLKCRAILNEPTAAALSYAFEKQID
                     GLFLVYDLGGGTFDVTLLEKQNDTYTVLAIKGENKLGGNNFNEVIERHVLTSFEEEYP
                     DIDLDDIVILEQIRDKIEEAKKSLSIMDEVSIVLPFLDGKHLNYKLKRNDFNSMIKEF
                     IEKTISLTNECIADSGVDLERISKIILSGGSTRIPLVKERLKEIFPKIEVLDSLNQDE
                     VVANGAGIHACSLSNNSTLIDFKDVTPYSLGIETCNDGFFTLIKRNTLLPVCERKIFT
                     TTNDYQEEIEIHVLQGEYKKASLNYSIGRFFFSNIQKALRGMPKIEILFSLDESGILS
                     ISAKDLDTHVSKSIQIRMTSSSFDSGFENEGVLASLEDMRSSRVLEDSIELT"
     gene            complement(280582..281079)
                     /locus_tag="BT0_RS01300"
                     /old_locus_tag="BT0265"
     CDS             complement(280582..281079)
                     /locus_tag="BT0_RS01300"
                     /old_locus_tag="BT0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772222.1"
                     /db_xref="GI:500096215"
                     /translation="MFVVFCFILIIFIFIYFHIYISLKIKSNSILRKFRSEVDKTIIE
                     INQATDRNINIIEIKIESLNRIIKEVDERIEILDQRLLGFNAHSISMGSNNFSMKGDS
                     SVYKSNLDYSIPTIEKNIIKEGYNIRQQVISLYEQGMSLEVIAKKLKLDLGEIELIVS
                     IHRGT"
     gene            complement(281101..281412)
                     /locus_tag="BT0_RS01305"
                     /old_locus_tag="BT0266"
     CDS             complement(281101..281412)
                     /locus_tag="BT0_RS01305"
                     /old_locus_tag="BT0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772223.1"
                     /db_xref="GI:500096216"
                     /translation="MDINGSSEVVKIITQGAFKASEISNEDLRKKKIRENKNLSLNQS
                     KSYHVDSEINSIYPADESMDGNVNFITMSKIKTAKRNSPGIYDINFHDPKIGRNIDIE
                     R"
     gene            complement(281437..283335)
                     /locus_tag="BT0_RS01310"
                     /old_locus_tag="BT0267"
     CDS             complement(281437..283335)
                     /locus_tag="BT0_RS01310"
                     /old_locus_tag="BT0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772224.1"
                     /db_xref="GI:500096217"
                     /translation="MATISDFADFRNRIKNYLERENRINLIEVESDTLEEALNDASLE
                     LSVPYKDLNYEVLVRGNNGLFGYGKKNWKIVAYKNSYSKFGVTDVLSSQSEFEEVASL
                     DGKFFIRRTAKGVFLKVTPAQGDGSVVKFKDVMDKFASYSNIKDLDENFVRSVIEDAN
                     GKYEQVSVFEADLVESVTMMVHISEDSMSVTVEFTVPGPNGAEVLEKDIYSILKKYGV
                     SDRALLKNKIKEFVDYPFYGEPVEMARGVNPVKGRDAYINFIAKSKSSGEYGAVGNEF
                     RNVNRGDELAEIIPLSEGIEGYTVFGKILRAEHGRELDLILGDNTFMEGNKIIAGCDG
                     YISISNGIISVHDVYVVEGDVGPGTGNIVNNGMVLVKGSVLDGYNVMAKSGIEVNGLV
                     GRCNLRTDGSIVLRSGANGKGGSEIYAKKSIKSKFLENVNVRCEGNIEVVRGIVNSFV
                     SCTKKVLCIGKKSKIVGSDVRAREEVRAYSIGSEGNAETSICVGCDPEIKVLLSRFTE
                     YLVKIEKRLEVLTKDISALKKNIQLTVDKAEKSLKIDSCNELINERDILILEIKMVKD
                     KQESLQDALEDSKIDGKIFVEYIAYTGVKLHIKDAYYELPRDYNNITFVEDDNIIKML
                     AYVPFKSK"
     gene            complement(283338..283823)
                     /locus_tag="BT0_RS01315"
                     /old_locus_tag="BT0268"
     CDS             complement(283338..283823)
                     /locus_tag="BT0_RS01315"
                     /old_locus_tag="BT0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772225.1"
                     /db_xref="GI:500096218"
                     /translation="MLFTKRRKYVLLFSAFAFVLAVILGIFARVPFITVLFRAVFQFI
                     VFFCIGLLLEFIYKKYLYDLFKDDSLSNDTRKKDIDENSNCKPETDDKNSFSKNIHLD
                     NNKSGDNDNYSLSDKLSKYDTVAKESKLSSKLLDQISHVENTDPKIVAETIKSLINKK
                     E"
     gene            complement(283829..284716)
                     /locus_tag="BT0_RS01320"
                     /old_locus_tag="BT0269"
     CDS             complement(283829..284716)
                     /locus_tag="BT0_RS01320"
                     /old_locus_tag="BT0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_041178566.1"
                     /db_xref="GI:752506701"
                     /translation="MEDQAQSLRDIMRLNNRASFVVDDKIQNNRTRFIAVTSGKGGVG
                     KSNIAVGLALKYANLGKKVLVFDADIGMANINILLGVIPKYSIYHMIMQGRGIKDVIT
                     KTEYNIDLLAGASGTTELLDLSETEMNQFIKELLKVYEYDIVIIDTSAGISRQVISFL
                     FSSDDVVIVTTPEPTSITDAYGIIKVLSHKMENLKNLRLVVNRVANVSEGKGVAKKVI
                     DISSQFLNLNIDYLGYVYEDQNIRNSVFKQRPFILLNPNSKASYCLDSIVAALEEITL
                     DNKKRRGVIGFISKFFGME"
     gene            complement(284729..285895)
                     /locus_tag="BT0_RS01325"
                     /old_locus_tag="BT0270"
     CDS             complement(284729..285895)
                     /locus_tag="BT0_RS01325"
                     /old_locus_tag="BT0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538036.1"
                     /note="Positive regulator of class III flagellar genes;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis regulator FlhF"
                     /protein_id="WP_041178439.1"
                     /db_xref="GI:752506574"
                     /translation="MVQYFTERGPTYNEVIETVKKKYGKNARVMTYKTIAHGGIFGLF
                     SRDWIEVSGYVRYDIGQQQINVEEEKRKILQSIKKEESSSIEDVIKEVKSLKNELAHK
                     KEEINHPTILKIEDILRSNDFSESYIRDINDFIKREFSLSDLDDYDKVRDSVIIYIAK
                     TIKCSGSIIDNLKKRIFILVGPTGVGKTTTIAKLAAIYGINSDDKSLNIKIITIDNYR
                     IGAKKQIQTYGDIMGIPVKAIESFKDLKEEITQSKDFDLVLIDTIGKSPKDFMKLAEM
                     KELLNACGRDAEFHLAVSSTTKTADIKEIFHQFSPFSYKTVIFTKLDETTCVGNLISL
                     IHEMRKEVSYVTDGQIVPHNISIAEPLTFIKKINGYRISDDIEFIRKLKGKSYY"
     gene            complement(285900..287987)
                     /gene="flhA"
                     /locus_tag="BT0_RS01330"
                     /old_locus_tag="BT0271"
     CDS             complement(285900..287987)
                     /gene="flhA"
                     /locus_tag="BT0_RS01330"
                     /old_locus_tag="BT0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422045.1"
                     /note="membrane protein involved in the flagellar export
                     apparatus; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhA"
                     /protein_id="WP_041178440.1"
                     /db_xref="GI:752506575"
                     /translation="MDARKNSVLVYFGLNNKADLVVSVGLILVVASFILPLPAFILDA
                     LIAVNLVISLLVMLIVLYSKRSLDFSVFPTLLLVMTIFGLVLNISSTRLILIKGISFD
                     GQMIRAFGTFVVGSSGTQGLFVGFIIFLIIIAVQFIVITKGSTRVAEVAARFALDALP
                     GKQMAIDSAYSSGNLTEEEATRQKNDLQAEVNFYGAMDGASKFVSGNVKVGFLITLIN
                     ILGGLIIGVTLQGLSFSDAVNNYVSLTVGDGLVSQLPALLISTATGLIVTRSISKNSF
                     GVEIIEQFTSYSGIYWIVSGFLLFLAFLPGFPTLILILLGMLIAFLAYSLSNLDRNRE
                     LHEKQKAEEQILSYADKEIAPVVPLDPLALEIGYNLVPIVDDSKTSELLDRIVKIRRE
                     IALELGIVVPKIRIVDNMRLEPNEYSFKLRGVEIGHGEIKLGKFLVINVGSDSGIEGD
                     LTKDPSFGLPSLWVNDNGREIAEKLGYTVVDPPSIIATHMTELIKRHACEILTRQDVQ
                     NILDIFKKDYGAIVEEVLKDFSVGEIQRVLQGLLKEQVSIRNLVTIFETIADFTSITK
                     DTFFLIEKCRQAIGRQIVSGYLNSNLELNVITINPEFEQKIIDSRFETNNDLISSLDP
                     NLKTKFIYELFRLVNEVQSQGYYPVILSSESARPVIRVLTSRELPDIVVISVLEVPKN
                     VKVNVLKTVEVEE"
     gene            complement(287999..289120)
                     /locus_tag="BT0_RS01335"
                     /old_locus_tag="BT0272"
     CDS             complement(287999..289120)
                     /locus_tag="BT0_RS01335"
                     /old_locus_tag="BT0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FlhB"
                     /protein_id="WP_011772229.1"
                     /db_xref="GI:500096222"
                     /translation="MNTRNEFLSKNWYIPLNFFASEDEGRTELPTEQKKQKAREEGQV
                     LKSTEINMAVTLCILFAVFFFMLSYFAYELMDVFRWQAGKLPEIMSISIYSLGFAYIR
                     SMLGYVIVFLLISFIVVFLINVVQVGFLITFKPIVPKWDRVNPNFSKWIKNSFGSFDA
                     FFNLFKSLSKIAIISFIYYIMLRSNIGKISRMFEYSLEDGISVILSLAYRICFFSVIV
                     LMGISILDYLFQRTRYIENLKMTKEEVKQERKEMEGDPLLRSRMRERMREILNANLKV
                     TVPQADVVITNPEHFAVAIKWDSNTMLAPRVLAKGQDEIAFVIKQIARENNIPVMENK
                     PLARDLYANVDVNEEIPREYWEIVSKILVKVYSIAKKFN"
     gene            complement(289117..289905)
                     /locus_tag="BT0_RS01340"
                     /old_locus_tag="BT0273"
     CDS             complement(289117..289905)
                     /locus_tag="BT0_RS01340"
                     /old_locus_tag="BT0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliR"
                     /protein_id="WP_011772230.1"
                     /db_xref="GI:500096223"
                     /translation="MNMNFLVLKSFVILPVFVRIFLFLRFSPFFATIRMSYLNFFFAL
                     ILSIIVVDKINVVYPLDNLIAFTLILAGEAILGLIQAFFVSIIFSVFHLLGFFFSNQM
                     GLAYANIFDVFAEEDNLVISQIFTCLFLLLFLSNNVLLRFFMIGVHDSVLNVRVENMV
                     NIKNYEFIELMFYSFVILFEKALIISLPILGVLLLLYLILGILSKTAPQINLLMISFA
                     VSLGLGLIILYIGFPSLVMSVKRVIELALESMRNALNLFSETLK"
     gene            complement(289921..290184)
                     /locus_tag="BT0_RS01345"
                     /old_locus_tag="BT0274"
     CDS             complement(289921..290184)
                     /locus_tag="BT0_RS01345"
                     /old_locus_tag="BT0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliQ"
                     /protein_id="WP_011772231.1"
                     /db_xref="GI:500096224"
                     /translation="MTTGQIIYLIRISIENIIILSAPMLITALIVGLLISIFQAVTSI
                     QDQTLSFIPKIIIILLTLVIFGPWILKKLMLFAFMVFSQIQNI"
     gene            complement(290194..290958)
                     /locus_tag="BT0_RS01350"
                     /old_locus_tag="BT0275"
     CDS             complement(290194..290958)
                     /locus_tag="BT0_RS01350"
                     /old_locus_tag="BT0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein flip"
                     /protein_id="WP_041178441.1"
                     /db_xref="GI:752506576"
                     /translation="MSKKLSFFLFFGVINFAFAQTKSLQTTTGLNFPFVDLVNSVGGG
                     IIFPLQLLLILTIITLSPAFLVLMTSFLRIAIVLDFIRRALSLQQSPPNQVIMGLALF
                     LTLFTMWPTFNIIYKEAYLPLQDSKIGFNEFYDRGIAPLRNFMYKQMSNSKHEEIRLF
                     MSISNYPRPKNFSEVPTHVLIASFVLHELKVAFKMGILIFLPFIVIDIIVAAVLMAMG
                     MIMLPPVMISLPFKLMLFVMVDGWTLITSGLVKSFM"
     gene            complement(290968..291612)
                     /locus_tag="BT0_RS01355"
                     /old_locus_tag="BT0276"
     CDS             complement(290968..291612)
                     /locus_tag="BT0_RS01355"
                     /old_locus_tag="BT0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772233.1"
                     /note="possible structural component of the flagellum that
                     anchors the rod to the membrane; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliZ"
                     /protein_id="WP_011772233.1"
                     /db_xref="GI:500096226"
                     /translation="MSRLTLFKFVFLIIFIFFFKNLFAQENGVDLDISSSSLENEVNL
                     PIFEGDKANLNNKDIQNISLFNISDLVTIFLFFLFFLICIFLFKKMILNHKKVKNSYK
                     SNFIRELAFYEIDNKNSVRVINILGNVYVFLVSSNSSILLREIKQGEELDNLKFELDK
                     AKSLSDITSFKSIFNKILRKNKKDELSFDKTEYAALENDIETSLKSKQDRLKKF"
     gene            complement(291605..291949)
                     /locus_tag="BT0_RS01360"
                     /old_locus_tag="BT0277"
     CDS             complement(291605..291949)
                     /locus_tag="BT0_RS01360"
                     /old_locus_tag="BT0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliN"
                     /protein_id="WP_011772234.1"
                     /db_xref="GI:500096227"
                     /translation="MAIDDKSDIGEEKPEIKGVKLPDLIDTLPEGVDPSNFGLLMDVS
                     MQVTVELGRTERKIKDILGMSEGTIITLDKLAGEPVDILVNGKVIAKGEVVVIDENFG
                     VRITEIIKIKNE"
     gene            complement(291999..293057)
                     /locus_tag="BT0_RS01365"
                     /old_locus_tag="BT0278"
     CDS             complement(291999..293057)
                     /locus_tag="BT0_RS01365"
                     /old_locus_tag="BT0278"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliM"
                     /protein_id="WP_011772235.1"
                     /db_xref="GI:500096228"
                     /translation="MAGNPGALSQDDIDSLLESINSSDNLSSDDSLSNIISSPMGKKQ
                     KIKVYDFKRPDKFSKEQVRTVSSFHEAFARYTTTSLSALLRKMVHVHVASVDQLTYEE
                     FIRSIPNPTTLAIINMDPLKGSAIFEVDPTIAFAIVDRLFGGDGDTIKDKSRDLTEIE
                     QSVMESVIIRILANMREAWSQVVDLRPRFGHIEVNPQFAQIVPPTEMVILVTLEVKIG
                     KVEGLMNFCLPYITIEPIVSKLSTRYWHSLIGVGTTSENLDILREKLENTDMLLVAEI
                     GEVKLKVREILSLAKGDVLNLENSPIDKDLILKVGTKQKFKCRMGLVGNKISVQVTEK
                     VGEVEDFDLLKELTEEVE"
     gene            complement(293077..293610)
                     /gene="fliL"
                     /locus_tag="BT0_RS01370"
                     /old_locus_tag="BT0279"
     CDS             complement(293077..293610)
                     /gene="fliL"
                     /locus_tag="BT0_RS01370"
                     /old_locus_tag="BT0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772236.1"
                     /note="interacts with the cytoplasmic MS ring of the basal
                     body and may act to stabilize the MotAB complexes which
                     surround the MS ring; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body protein FliL"
                     /protein_id="WP_011772236.1"
                     /db_xref="GI:500096229"
                     /translation="MPERDDGSIDVGGADSKRMGLLPDVIIKILQILAIGLFTVVIMI
                     IVAYFVSKMVVSQSGAPNNFPIFSNEYLGKPPMLIWYESIDEIRGTTQDTPPKTFVIK
                     LALGYAENNVNILSELGRQKVRLKDIIREYFSQRTGQEIKNESQIKAEIKARINSILR
                     NGEIKEIALTQIDIFDM"
     gene            complement(293652..294437)
                     /locus_tag="BT0_RS01375"
                     /old_locus_tag="BT0280"
     CDS             complement(293652..294437)
                     /locus_tag="BT0_RS01375"
                     /old_locus_tag="BT0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor protein MotB"
                     /protein_id="WP_041178442.1"
                     /db_xref="GI:752506577"
                     /translation="MSLRDRKKRSKCAEGTPEYMLTYGDMVTLLLVFFVTMFSLNDII
                     LKENVLKIMSASFTGSGFFKGGKTLDINKLSYLSNSFMSLPSTEKNKQASQASKNKSI
                     IEFIEKIQSNRVIVRHYERGVVVSLLADAFFDSASAEVKLDDNRETIQKIASFIGFLD
                     NQGYNFKIEGHTDNVDVNINGIWKSNWELSSARAVNMLEQILNYTDQSKIQSIESKFE
                     VSGFAGSRPVATDDTPEGRAYNRRIDILITSDASLSSTKGINH"
     gene            complement(294437..295222)
                     /locus_tag="BT0_RS01380"
                     /old_locus_tag="BT0281"
     CDS             complement(294437..295222)
                     /locus_tag="BT0_RS01380"
                     /old_locus_tag="BT0281"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis MotA protein"
                     /protein_id="WP_011772238.1"
                     /db_xref="GI:500096231"
                     /translation="MNLASIVGWGVGFGAILISMAFTPTGLGVFWDLSSVFITVVGSF
                     SALVASSEIPTVKRIPTYLGLFFKKSSFGKVFIIKTLVELSEKARKEGLLSLDDELDQ
                     INDPFFKSGMRLVVDGADPEIIRTMLYLELDQMQERHKIGADLFGTWAKLAPAFGMTG
                     TLIGLIALLGNLEDRSALGSSMAVALITTLYGTIMANLMLLPIQIKLESIDIEEASVK
                     TMIVEGILSIQAGDNPRILEQKLVTFLTPKDRSQLGSGILGGE"
     gene            complement(295219..295440)
                     /locus_tag="BT0_RS01385"
                     /old_locus_tag="BT0282"
     CDS             complement(295219..295440)
                     /locus_tag="BT0_RS01385"
                     /old_locus_tag="BT0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538048.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlbD"
                     /protein_id="WP_011772239.1"
                     /db_xref="GI:500096232"
                     /translation="MIYVTKLNGDGYYLNPCHIESIEANPDTTILLMNGKKLIVKEDV
                     VEVVDKIKMCRREIALLDRIIQENKGVEL"
     gene            complement(295458..296786)
                     /locus_tag="BT0_RS01390"
                     /old_locus_tag="BT0283"
     CDS             complement(295458..296786)
                     /locus_tag="BT0_RS01390"
                     /old_locus_tag="BT0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook protein FlgE"
                     /protein_id="WP_011772240.1"
                     /db_xref="GI:500096233"
                     /translation="MMRSLYSGVSGLQNHQTRMDVVGNNIANVNTIGFKKGRVNFQDM
                     ISQSISGASRPTDGRGGVNPKQVGLGMSVATIDTIHTQGSFQSTQKASDLGISGNGFF
                     ILRDGNNSFYTRAGAFDVDSNRCLVNPANGMRIQGWMAKSIGGEQVINTSADVEDLVI
                     PIGDKESAKATEHITFACNLDKRLPIIEEGASEVDVARGTWVVNKTIYDSFGNTSVVE
                     LRVVKDTTTPNLWNATVLVNGETNSNFTIGFNNEGALLSLNGQAGQPGDLLEFPITFG
                     VVNANAGEVGEQQTINLRLGNVGSYTDSITQFADASTTKAIIQDGYGMGYMENYEIDQ
                     NGIIMGVYSNGIRRDIGKIALASFVNPGGLAKVGDTNFSETSNSGQARIGETGLAGLG
                     TIRAGVLEMANVDLAEQFTDMIVTQRGFQANAKTITTSDQLLQELVRLKN"
     gene            complement(296791..297225)
                     /locus_tag="BT0_RS01395"
                     /old_locus_tag="BT0284"
     CDS             complement(296791..297225)
                     /locus_tag="BT0_RS01395"
                     /old_locus_tag="BT0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod modification protein
                     FlgD"
                     /protein_id="WP_011772241.1"
                     /db_xref="GI:500096234"
                     /translation="MGRVDYIDNLVGIGRAKEISNSKVQRGVKGNNLGRDDFLKLLIT
                     QLKYQDPTDPMKDKEFIAQMAQFSALEQMTNMSKSFESLSSVLGINKDLDLLGKIVEF
                     EHVDGEIIKGKVTNIKTGIVPQIMIDGKYYVYNNILSVGLEE"
     gene            complement(297238..298407)
                     /locus_tag="BT0_RS01400"
                     /old_locus_tag="BT0285"
     CDS             complement(297238..298407)
                     /locus_tag="BT0_RS01400"
                     /old_locus_tag="BT0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-length control protein"
                     /protein_id="WP_011772242.1"
                     /db_xref="GI:500096235"
                     /translation="MDNVSKIIVSLPSLNKDFNFVNVGGIFSQAKKGVFSDLISSEIQ
                     NLSKFRDSILDFLKFLKSNGLISKDFKNISLKKPFAFEKFSDNGFVSDLKSLIKKVNN
                     LFDFDSLKVLSESLSFDSELSDKIKILKNFEKVLSDLNILFDNVTSLFNFDVLSVDLN
                     SNHRDLNIVKREREKNVIGIDVKNFKKNDSVKEFFNSGFRFRLIDSENCVRKYGLKET
                     FDGLTESIGDLSSFNAKPVKGSFIGHIADNLMSEWNLKINHNIVNKAKIVLKSNDTGE
                     IRLILKPKRLGSIRINLNLDSNNNLLGKIIVDNHNVRTLFEQNMYSISKMLNDNGFNT
                     SLNLSLAGSGSGFFSGNFEDDVESQSSSLNKNNIFKIEDNVEISGDLEKSINFIV"
     gene            complement(298411..299025)
                     /locus_tag="BT0_RS01405"
                     /old_locus_tag="BT0286"
     CDS             complement(298411..299025)
                     /locus_tag="BT0_RS01405"
                     /old_locus_tag="BT0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein"
                     /protein_id="WP_011772243.1"
                     /db_xref="GI:500096236"
                     /translation="MNDCLSFLLRFFLWLFLVIFFLVFSFFLVDLFGIYQTRDYLPVY
                     IRALLFKGDAQPPEYTHISLEEIRMIKEKEAIYIKGQQVEKLREELKKREDSLNKLEA
                     ELNQKQKDLDLKQKVIDDIVNKYKDEDANFAQAALYLINMPPKDAVKRLEELNDEIAI
                     SYMRKVEDIAKKEGRASIVPYWLSLMDSKKAAVLIRKMSVSSLE"
     gene            complement(299022..299450)
                     /locus_tag="BT0_RS01410"
                     /old_locus_tag="BT0287"
     CDS             complement(299022..299450)
                     /locus_tag="BT0_RS01410"
                     /old_locus_tag="BT0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlbA"
                     /protein_id="WP_011772244.1"
                     /db_xref="GI:500096237"
                     /translation="MNDLIFKKKIFEKILSIRTYDRKSSENALVNVNNKISKIEEFLE
                     GISAGLNKLNNMDVFSKGNYLDYLTYRKGKELKKLEKLKHEYDKYHDIYLKKYGEEKK
                     VDILIKTLNDTIIKEKVKSESLFLDEYVNYRICKKLGNNQ"
     gene            complement(299447..300754)
                     /gene="fliI"
                     /locus_tag="BT0_RS01415"
                     /old_locus_tag="BT0288"
     CDS             complement(299447..300754)
                     /gene="fliI"
                     /locus_tag="BT0_RS01415"
                     /old_locus_tag="BT0288"
                     /EC_number="3.6.3.14"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772245.1"
                     /note="involved in type III protein export during
                     flagellum assembly; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase"
                     /protein_id="WP_041178443.1"
                     /db_xref="GI:752506578"
                     /translation="MDIFFEGYSKMLDDVEPISLIGKVRKIKGLLVESLGPKCGIGDL
                     CLIEQRSGKKIYAEVLGLNGSFVNLMAYEGFDGIEIGDQVCSLGKKLQINLSDELLGR
                     VIDSLGRPIDNKGQFFCNYYKELSFSNINPLSRGVFSEQIVTGVKVLDGFLPVAKGQR
                     VGIFSGAGVGKSTLLGMIAKNSKADVNVIAFIGERGRELNEFIKYDLGEECFKRSVLI
                     VSTSDASPIARYKGAYTATLIAEYFRDCGMDVMLLFDSITRFANAKREISLSMGEPPA
                     TKGYPPSVFVEIPILLERSGLNSKGSITGFYTVLVEGDDFTEPIADNMKAVLDGHIIL
                     DRDLSDRGIYPSVNILSSTSRSLHRIVNFEKQKLISKIRNLLSIYKSYEDLIKTGIYI
                     KGSNKEVDLAVAKYPKIIDFLSQGIQEEFDFENLDSELREILA"
     gene            complement(300771..301691)
                     /locus_tag="BT0_RS01420"
                     /old_locus_tag="BT0289"
     CDS             complement(300771..301691)
                     /locus_tag="BT0_RS01420"
                     /old_locus_tag="BT0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar assembly protein FliH"
                     /protein_id="WP_041178444.1"
                     /db_xref="GI:752506579"
                     /translation="MPKVLYKSKEVVNAVKLEFVEITNPIFKSLEIKRKENELCDIDS
                     RSIKLRNELEDLMNQRAKLQEEIEREHEFAKKEIDAECSKILEEAKEQANKIVSFASE
                     RAEALQKEAENKKGAIEQESNLEIEKIVREHEERLKRELETEMARGRNEGYDAGFNKG
                     REDCDKILGKLNSIISSLVAKRKEILESSGEHIMNLVMQIAVKVVKKIIDSQTGIVIE
                     NINEALKKVKSKTNIIIRVNLDDIDVVSHQKHEFISKFDFIKNLEVVEDVNIGKGGCI
                     IETDFGEIDARISSQLDRIEEKFKNFSSIF"
     gene            complement(301706..302740)
                     /locus_tag="BT0_RS01425"
                     /old_locus_tag="BT0290"
     CDS             complement(301706..302740)
                     /locus_tag="BT0_RS01425"
                     /old_locus_tag="BT0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar motor switch protein FliG"
                     /protein_id="WP_041178445.1"
                     /db_xref="GI:752506580"
                     /translation="MEEQKEKEILGVSTLTGKQKAAILLVSIGSEISSKIFKYLSQEE
                     IESLTFEIARLDVVTSDLKDSVLLEFKELMMAQEFIQKGGIDYARELLEKSLGTQKAV
                     DIINNLGSALQSRPFEFVRRADPANILNFIQQEHPQTIALILSYLDPQKASFILSSLP
                     TEIQTNVARRIALMDRTSPEVVREVERVLEKKLASLSSEDYTSAGGVDNVVEIINMAD
                     RKTEKFIIESLEEEDPELAEEIKKKMFVFEDIVLLDDRSIQRILREIDGQELAKALKS
                     VDAPVQDKIFKNMSKRAAGMLKEDMEFLGPTRRKDVEEAQQKIVSLIRKLEEQGEIVI
                     SRGGEEDVLV"
     gene            complement(302756..304462)
                     /locus_tag="BT0_RS01430"
                     /old_locus_tag="BT0291"
     CDS             complement(302756..304462)
                     /locus_tag="BT0_RS01430"
                     /old_locus_tag="BT0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar M-ring protein FliF"
                     /protein_id="WP_011772248.1"
                     /db_xref="GI:500096241"
                     /translation="MNNFITKFFASVNKKFQKASMVQKVAFGVIALFIILAFIFLIGF
                     STKKQGVALFGVGIKDQYLLDRIVQRLDRESVEYIITADGKIYLSDENMSKKMRAILV
                     REELVPVHMDPWSLFDIDRWTITDFERNVNLRRSITRAVEQHIVALDDVDAVSINLVM
                     PEKALFKESQEAVKASVRITPKPGSDIVTNRKKVEGLVKLIQYAIEGLESDNIAIVDN
                     KGTVLNDFSNLDGIDRIDLAEKERKLKLKYESMLRDEIDSALSKVLSVDRFMIARVNV
                     TLDTSRQTTESKEYAPIEIEPQDPKVSYNTRKVSDSTLLSSQVHKREYEGQGYSPWGP
                     PGQEGNTPPEYRDLSDIIGKSNEFKEIKNVALNEKKSLNEKEPARIAGISLGIFIDGV
                     WDFVYDESGNFIIENGMRKREYKPISDEALKNITDVLQSSFEYKPERGDSIAIRNVAF
                     DRVNEFRKIDEDYFSTEKFKFLIFTVSIIFALLILIFTVFFIVSRELERRRRLREEEF
                     SRQAHLRRQQALMDSDDIGVDDVVGGIREEDELQSNAELLAREKPEDVAKLIRTWIVK
                     NV"
     gene            complement(304476..304805)
                     /gene="fliE"
                     /locus_tag="BT0_RS01435"
                     /old_locus_tag="BT0292"
     CDS             complement(304476..304805)
                     /gene="fliE"
                     /locus_tag="BT0_RS01435"
                     /old_locus_tag="BT0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772249.1"
                     /note="forms a junction between the M-ring and FlgB during
                     flagella biosynthesis; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-basal body protein FliE"
                     /protein_id="WP_011772249.1"
                     /db_xref="GI:500096242"
                     /translation="MEVDSFFTDNNVYLVRKNPLHFDKSFSVFDVKREVKAESFKDLF
                     LNLISDVNNSQLDVSRMSQQAILQPNSVDVHDITIAMAKANMNLSITKAVVERSIKAY
                     QDVINIR"
     gene            complement(304821..305279)
                     /gene="flgC"
                     /locus_tag="BT0_RS01440"
                     /old_locus_tag="BT0293"
     CDS             complement(304821..305279)
                     /gene="flgC"
                     /locus_tag="BT0_RS01440"
                     /old_locus_tag="BT0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696170.1"
                     /note="with FlgF and B makes up the proximal portion of
                     the flagellar basal body rod; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgC"
                     /protein_id="WP_011772250.1"
                     /db_xref="GI:500096243"
                     /translation="MGLFSSINTAATGLTAQRLRLDVIANNIANVETTRTSEGGSYRR
                     QRIVFSPRVVSPYWKGPFVPDYLDNGIGQGVRVAGIERDKSPLKLKYDPTHPDAIKSG
                     ERKGYVEFPNVNAVEEMVDMISASRAYEANSTVINSSKAIFRSALSILQN"
     gene            complement(305305..305712)
                     /gene="flgB"
                     /locus_tag="BT0_RS01445"
                     /old_locus_tag="BT0294"
     CDS             complement(305305..305712)
                     /gene="flgB"
                     /locus_tag="BT0_RS01445"
                     /old_locus_tag="BT0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772251.1"
                     /note="with FlgF and C makes up the proximal portion of
                     the flagellar basal body rod; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar basal body rod protein FlgB"
                     /protein_id="WP_041178446.1"
                     /db_xref="GI:752506581"
                     /translation="MNIFDRSIDLAHRYLDVLSLRQSVIADNVANVDTPNFKRSKVTF
                     ESELERAIFNEGASSLSLRRGNGKHLDGFKELGYLDVKPRRMLDYLSTLNNNGNNVDI
                     DSEMKNLAQNQMMYSLFTNIQAHHFKSVNIVIK"
     gene            complement(305746..307098)
                     /locus_tag="BT0_RS01450"
                     /old_locus_tag="BT0295"
     CDS             complement(305746..307098)
                     /locus_tag="BT0_RS01450"
                     /old_locus_tag="BT0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_041178447.1"
                     /db_xref="GI:752506582"
                     /translation="MDKTENQNIVPKEIVAELDKYIIGQVEAKKLVSIALVNRYIRSK
                     LPKEIRDDVMPKNIIMVGSTGIGKTEIARRLSKFIKAPFIKVEATKYTEVGYVGRDVE
                     SMIRDLMSIAVNMVREEMYDSVREEASKRAEERIIDKLLKTSEGSENDNTSEEERKIR
                     DKLRNKFRKQLRSGDIDDNLIDIYVSGKMPVSTIEIFSGSNFEEIDMSIGGLINNIFD
                     RKKRRELKIKKAREIIISEELEKLVDHENIVEVAKSRVENMGIVFIDEIDKIVTKNRT
                     GNDISREGVQRDILPIVEGSKVNTKYGIVDTSHILFIAAGAFNLSKPSDLIPELQGRF
                     PIKVELKSLSVNDFKNILKHTKNSLIKQYIAMFKVYNLTLTFSEEAIDRIAELAFDMN
                     YEGENLGARRLHGVMEKILADLFFEAPGSKLKKFEINLDYVNEKIKINEQKDLNYYII
                     "
     gene            complement(307098..307640)
                     /locus_tag="BT0_RS01455"
                     /old_locus_tag="BT0296"
     CDS             complement(307098..307640)
                     /locus_tag="BT0_RS01455"
                     /old_locus_tag="BT0296"
                     /EC_number="3.4.25.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZ92.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase"
                     /protein_id="WP_011772253.1"
                     /db_xref="GI:500096246"
                     /translation="MSFKGTTVIAIRRGGKTVVAADGQVTFGYTVLKSNAIKIRKLFN
                     GKILAGFAGSTSDAITLFEKFEEKVKAREDGIIDIKRAAVELAKDWRSDKILHKLEAM
                     MLVADSENILLISGTGDVVEPEEDVISIGSGGNYAYSAALAYMENKKLSAADIAFKSL
                     KVAARVCIYTNSNIVLEEIS"
     gene            complement(307652..308596)
                     /locus_tag="BT0_RS01460"
                     /old_locus_tag="BT0297"
     CDS             complement(307652..308596)
                     /locus_tag="BT0_RS01460"
                     /old_locus_tag="BT0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein Smf"
                     /protein_id="WP_011772254.1"
                     /db_xref="GI:500096247"
                     /translation="MFKLLYVDNLRFLKGEEKLRIFNDFDLSCLCKLSLRDISNYLSR
                     VFRRDYKLPDLKLIEMQQKIINKTSARIAVFGSKDYPLKLKRIYNPPFAIYYKGNLPD
                     SNSLSWAVVGSRQISRVLADKIKELSSHLAKNHVEIISGFAIGADIAAHFGAMNEKKR
                     TYAVIATDIDNIYPKQNRKYVACLLENGGGVLTETLPYEKIQNYFFAKRNRIVAGLSD
                     VVFITCAPRKSGALITAELGLDLGLDVYVYNIDYSGDGSRVLYDSGAQEIKSVSDLYK
                     ILNVQYNEPEISDNSKVCCICKDTSSMLINKLLNEISK"
     gene            complement(308602..309291)
                     /locus_tag="BT0_RS01465"
                     /old_locus_tag="BT0298"
     CDS             complement(308602..309291)
                     /locus_tag="BT0_RS01465"
                     /old_locus_tag="BT0298"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772255.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772255.1"
                     /db_xref="GI:500096248"
                     /translation="MKRWIPIFLFLVISCGDESKEKVNLGLRIREIEIAGGGSLEKIE
                     VYKEFIDKEEQNILKIINSIDKKARFFSLIGLELIRLGQYGPAIEYLNKNLEYGPDNH
                     LSHFYIGVSSYNLAKGIETKEKVREYFILAEGSFLKSISIKDDFKEAIFALSTMYVYD
                     LDKQLEAKGYLSRLESMGEDYFEFFMLRGANYYSLGDFDNALLFYKKAKDKALTQEQI
                     DGVDRIMNNFK"
     gene            complement(309292..310488)
                     /locus_tag="BT0_RS01470"
                     /old_locus_tag="BT0299"
     CDS             complement(309292..310488)
                     /locus_tag="BT0_RS01470"
                     /old_locus_tag="BT0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538804.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsZ"
                     /protein_id="WP_041178448.1"
                     /db_xref="GI:752506583"
                     /translation="MKDYNIIDSHSKRFDSATNPTVLKVIGAGGGGSNAVNRMIEYGV
                     RDVEFIVANTDLQALQTSIAPIKIALGAKVTSGLGAGGRPEIGQAAAEEDIDIIKNHL
                     AGADMVFITAGMGGGTGTGAAPVIAQVAKELGILTVGVVTKPFKFEGPKKMRLAEQGI
                     NNLRKSVDTLIIIPNQKLLTVVDKRTTIKDAFKRADDVLRMGVQGIAGLIIEHGEVNI
                     DFADVKSIMQGQGDALMGIGYGKGENRAVDAATSAISNPLLEEVRIEGSKGLLVNITG
                     GEDFSLLELEEIMGIITASVDDEATVIYGHAINSNLDDEIYVTVVATGFSSKKQKDLS
                     GAVENNTLSSKEFDSLMSGSQDVSGSVYEANDNFIAKSKNVNYFEDDIDVPTFLRNLN
                     KKNSDN"
     gene            complement(310509..311750)
                     /locus_tag="BT0_RS01475"
                     /old_locus_tag="BT0300"
     CDS             complement(310509..311750)
                     /locus_tag="BT0_RS01475"
                     /old_locus_tag="BT0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002663590.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsA"
                     /protein_id="WP_011772257.1"
                     /db_xref="GI:500096250"
                     /translation="MSRDLIVGLDVGTSKICTVVAEVNLNNQLEIVGIGTSVSRGVRK
                     GVLINIEAALDSISSSIEAAELISGCDISALSVSMSGSSIEGTNSRGVVAINSKTREI
                     DNEDVERVIEAAKAIVIPMDREILHVIPQEFIVDGIPHIKNPIDMMGIRLEGEVHIIT
                     GSSSSSQNLVRCVNRAGFSVDEVVLGSLASSYATLSKEEREMGVLFVDMGKGTTDIIL
                     YIDGSPYYTGVIPIGANRVTLDIAQVWKVPEDIAENIKITAGVAHISALESQVESVII
                     PNLGTRPPQEKSRKELAIIINSRLSEIFEMIKAEIMKRGLYNKINGGIVLTGGGSLFP
                     GISNLTEEIFKYPSRIGFPMNINGVGEEYIGPKFSSALGLVLYKHEQQKFNKLKKGNN
                     KSKRQSKISSKLKGWFLKEWF"
     gene            complement(311750..312493)
                     /locus_tag="BT0_RS01480"
                     /old_locus_tag="BT0301"
     CDS             complement(311750..312493)
                     /locus_tag="BT0_RS01480"
                     /old_locus_tag="BT0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsQ"
                     /protein_id="WP_011772258.1"
                     /db_xref="GI:500096251"
                     /translation="MLIYRKFLIIYIYVIISLILLEIVFIIFISPYFLIRYINFNDSI
                     HISKEEILSISGIKPNTYYYDADVSAYEKNIMRDRRVKNVTVKLKFPNTISINIERRV
                     PIVTAYENVDGSFIYYFIASDGLILEKCKDLIYDLPIVSGLNLNGNEVGDFLEDRMLA
                     IIKNLNYVKINQNTLYNLISEINFLKLNFYDYKIFLYIKNIYNKILITTDMDLISVMH
                     KVFMISDLLKGRSDTVDLRSGNIILLGED"
     gene            complement(312533..313627)
                     /locus_tag="BT0_RS01485"
                     /old_locus_tag="BT0302"
     CDS             complement(312533..313627)
                     /locus_tag="BT0_RS01485"
                     /old_locus_tag="BT0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division protein FtsW"
                     /protein_id="WP_041178449.1"
                     /db_xref="GI:752506584"
                     /translation="MFVERTSLRKCYLLVLWSLIAYGLVVFYTSSFFLSLELTGEPNF
                     LFLMRLKYLFLSFIVFFVFERISLDFLKKIVSIILLVTFTLVLATFFSPSVSGTQRWI
                     FLKGVSIQPSEIFKVSFTIYLASYLSRFRLKSDNNISYWIKPMLIFGIFWLLIILQND
                     YSTAIYFAMLFFIVLFVSGMSLGYVFAILFTFVPIAMLFLIFEPYRVARIFAFLNPYD
                     DPLGKGYQIIASLNAFKSGGLGGRGLGMGEVKLGRLPEANSDFIFSVLGEELGFFGIC
                     LAIVLFFLLFYFGYFVALFAKTRFRFFIAFIASLTIFLQSIMNILIAIGLLPPTGINL
                     PFFSSGGSSIVVTMALSGLISNVSRDVEGE"
     gene            complement(313644..314699)
                     /locus_tag="BT0_RS01490"
                     /old_locus_tag="BT0303"
     CDS             complement(313644..314699)
                     /locus_tag="BT0_RS01490"
                     /old_locus_tag="BT0303"
                     /EC_number="2.7.8.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZ99.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospho-N-acetylmuramoyl-pentapeptide-
                     transferase"
                     /protein_id="WP_011772260.1"
                     /db_xref="GI:500096253"
                     /translation="MFCLLGLRLLKYITFRTAYATIFAFLLALIFGPFIILRLKKLKL
                     DQILRKDGPKRHLSEKIGIPTMGGILIFFCVLVSLFFWIDFWNIYFLIILFVMVSFAC
                     LGFMDDLLKIKRKNSDGLNPRFKIYGQILFSCISVTMLYYFGDEHVSIIYFPFFKSLK
                     LDLGVLYIPFGMFILISASNSFNLTDGLDGLAIGLSIVVTGALVIIAYLASRVDFAFY
                     LNIPNIKGAEELVVFLGALLGGSFGFLWFNAYPAKIMMGDTGSLSIGAVLGMTALILK
                     SEILFAILAGVFVVETLSVIIQVVVYKHTKKRVFKMAPLHHHFEELGWSEMQVVIRFW
                     IIGLIFAIIALSTLKIR"
     gene            complement(314717..316108)
                     /locus_tag="BT0_RS01495"
                     /old_locus_tag="BT0304"
     CDS             complement(314717..316108)
                     /locus_tag="BT0_RS01495"
                     /old_locus_tag="BT0304"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
                     6-diaminopimelate--D-alanyl-D-alanine ligase"
                     /protein_id="WP_041178450.1"
                     /db_xref="GI:752506585"
                     /translation="MHIKIEDILDSLKDIKFVGYASSMQKIVSFYSLDSREINAKNSS
                     ASLYFAYKGDRVDGFSFVEYLIDIGVKCFVCSKDCESLCLEYLNRDENLVFLLTSNVV
                     ILLQNLAAHFITRTSFKRIAITGSNGKTTTKEMLYSILSERYKTCKTWGNLNSDIGLP
                     LSILRTEGDEEYAVFEVGISYIGEMNLLAEILNPEIVIVTNISYAHMQAFEDLEIVTA
                     EKGKIMTKSTQMVILNESCPYHLHLRVMAKSINPGINIFYFDFHSLQIRSFAFVNDKF
                     FYDFTYKGFDYSILLPGQHNIFNAISCIHLALLLGLSENEIRNGLLHADFQKGRAELL
                     RVKDYLILNDSYNGNLGSFMALKEMILGLEIKGKKFIILGAFKELGKFAYEVHKTAIR
                     EVVLMNFDKGFLIGEEFQEVKKIENLALDNLFYFSNFENFIDYFVKNLESECFIAIKG
                     SRSNRLERILDYL"
     gene            complement(316127..316408)
                     /locus_tag="BT0_RS01500"
                     /old_locus_tag="BT0305"
     CDS             complement(316127..316408)
                     /locus_tag="BT0_RS01500"
                     /old_locus_tag="BT0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772262.1"
                     /db_xref="GI:500096255"
                     /translation="MSKMGKIEVRLYFLLILILTIIICLNIYLNFRYVVKLREFEGLN
                     DEQSNIIDENLRLLTIIYELQSIDRIEELSKDYLNLEKKDNKDINVIKR"
     gene            complement(316401..317294)
                     /locus_tag="BT0_RS01505"
                     /old_locus_tag="BT0306"
     CDS             complement(316401..317294)
                     /locus_tag="BT0_RS01505"
                     /old_locus_tag="BT0306"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZA2.1"
                     /note="catalyzes the methylation of the N4 position of
                     C1402 on the 16S rRNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011772263.1"
                     /db_xref="GI:500096256"
                     /translation="MGNIFHIPVLLEEIINLLEASNISDGFVFVDCTLGEGGHSSAVL
                     KKYQNINVIGIDRDDVVLNRAKESLIEFKGRVSYFNTWFDDFFSEYPLSSKINFILAD
                     LGISMFHYKMSGRGFSFFEDERLDMRLYPGAGGLSAYDIINTFDKKRLENLIYELSGE
                     RYSRRIVKSILEYRKIKKIETPRELQDIVSKAYPRIKLKINPATKTFQALRIYVNDEL
                     FRLKRSLPLWVESLSNNGVLAIVTFHSLEDKIVKEFFKGLSKDQYCILTKKPIMPRCE
                     EKRFNSASRSAKLRVIKKLYE"
     gene            complement(317287..318120)
                     /locus_tag="BT0_RS01510"
                     /old_locus_tag="BT0307"
     CDS             complement(317287..318120)
                     /locus_tag="BT0_RS01510"
                     /old_locus_tag="BT0307"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772264.1"
                     /db_xref="GI:500096257"
                     /translation="MMIIAVLFFFNFFNLYAFLEFGKDEKFDLVSDFGELRNDTLSIG
                     IKLRALDTHFSIFSNNYKILYSKNKVSEYDGSILIIFDKDLGFNLEFFGDFIYKDGKI
                     FLKNDNKVFDVVVVDHYSGHIINPLFVIKNRNNLNINSSFLLSNILLKGKDDTMFELK
                     ENIDLDLELGDYGLVLNFLKKDIGVAKAINGIYYFEVFLNNNSIFRADFQSMSLNGNS
                     YVVFDNKDYNLDLFNIKRDNGNIEINNLEFTSGHNEIKIKYGDVYNTENSLTYRFTLN
                     G"
     gene            complement(318123..319196)
                     /locus_tag="BT0_RS01515"
                     /old_locus_tag="BT0308"
     CDS             complement(318123..319196)
                     /locus_tag="BT0_RS01515"
                     /old_locus_tag="BT0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178451.1"
                     /db_xref="GI:752506586"
                     /translation="MGVNLCKENSTRFRKIKNFLLSIFLLIFIVLVDSILKSTIDISI
                     FYKFNHFKKSDNLVDIVPKRNVFINDQILNLDFNKYDYHVVSDRLVSFSDYYYVLNRF
                     KNNYSVFSRKTDKFLFSLAYKDFVFTKDNVVFALNNLHKALEVYGADGSRILSFKFIA
                     SILSIDYNDDVLALGLSDGKTYVYKRGKMVYGGDLLGVGLPIICLKLSLNNKYLCILR
                     GNEEYSIEVFNLEDGYNQFLYLKNLKIKDFNPFFKIDKFYNLFVETANSFLILNINSG
                     KTFKVDNKNSVLKASYDPFSRVYRVYFYDLSGSMINIRTYSVDSYSLFDNIFFKDKVN
                     SYVEFDEGILYFNDNSDLNYLGL"
     gene            complement(319216..319974)
                     /locus_tag="BT0_RS01520"
                     /old_locus_tag="BT0309"
     CDS             complement(319216..319974)
                     /locus_tag="BT0_RS01520"
                     /old_locus_tag="BT0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772266.1"
                     /db_xref="GI:500096259"
                     /translation="MDLVHNENYQKILFIDDLILQTLKDIKGIKKSGKLALDSGVTVN
                     FINLNLNVLSYIASLNYFYTKPRLKVNYDFRVNLFSFISDFSLFVSPVLLISFGELMD
                     NESVLNLNPEERFLIVRKLGYLIDLGMYFSKGDSKAILFLEDIYLKFIVLVKNFIDFK
                     NLSKNLVIDSPFYKVQLAHLIKSLDLLEEGAFLLRSRYEVNGAYGLSEQILSYIQAGK
                     TLATVTSQKSIAEKFTKFYEVWSVKFQSDLSKSR"
     gene            complement(319990..321654)
                     /locus_tag="BT0_RS01525"
                     /old_locus_tag="BT0309A"
     CDS             complement(319990..321654)
                     /locus_tag="BT0_RS01525"
                     /old_locus_tag="BT0309A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA recombination protein RecN"
                     /protein_id="WP_041178452.1"
                     /db_xref="GI:752506587"
                     /translation="MLVELFVKNFVLIKELSIKIGTGLVALTGESGSGKSLLLSSIYY
                     LFGGKIKSNIIINGEQECVLLAKFRVNGDVRDYLSSKAILASDCIIIKRVIIFESSET
                     LLSNYYINNEPISSNILKPIFNMLIEVHSQNQQYLILKNPSSNLKILDNYANLNSQLE
                     KYRLVYEEYIQYLNDYDDFVSKEKLHKDSKEECEKIIDEIDSFNPKIGEEEILKTRLD
                     ELKNHESLCNALSSLKSVLSLNNNVSALSKIRNVICDAEYLSGVNNNYFELENRLKSS
                     YYELEDIGQAYSRYLFDKTYDEKEIESVENRLHDLSRLRKKYGPSLEDVIVFRKRCDD
                     IIDLSLNFETERLGKEQMLNDLFERVKKLAFDISSVRKAAALRFASGVTKILHKLNMG
                     DAEFFVSVSEGKIKSTGIDEVEFLISSNTGLKAQPIYRIASGGELSRIMLAIKSVQNV
                     DESKLIIFDEIDSGIGGESGMSLGKYLKGLSENMQIFVVTHLANIASLSDYHILVKKE
                     YIEDRPYVQACLLLGNDRVLEVARMLSGNVNDISFQHAEELLKGNN"
     gene            complement(321701..322537)
                     /locus_tag="BT0_RS01530"
                     /old_locus_tag="BT0311"
     CDS             complement(321701..322537)
                     /locus_tag="BT0_RS01530"
                     /old_locus_tag="BT0311"
                     /EC_number="2.7.1.23"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772268.1"
                     /note="catalyzes the phosphorylation of NAD to NADP;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic polyphosphate kinase"
                     /protein_id="WP_041178453.1"
                     /db_xref="GI:752506588"
                     /translation="MKSKVLIYVNYSNLDAEVLACEIQKYLEHKYGVLSLFAGIDKSS
                     EVLTEDNLILAITLGGDGTVLLASSLLLKNDIDIPIISINLGKVGFLADIKPIDFKEV
                     IDKFFDNSLVIHSKYLLSISAYENGNNVFTKYALNDVIIRSSVINKLIYVNLRVNSED
                     FLSYRSDGIIFATPTGSTGYSFSAGGSILESDLQAFILTPISPHSVYNRSFIFSSGSK
                     LSLSFQKGYALNSASIFVDGVNIGKFGVNIIFELGLDNKSLRFASFCTDTFVRRLKNK
                     LL"
     gene            complement(322527..323051)
                     /locus_tag="BT0_RS01535"
                     /old_locus_tag="BT0312"
     CDS             complement(322527..323051)
                     /locus_tag="BT0_RS01535"
                     /old_locus_tag="BT0312"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="WP_041178454.1"
                     /db_xref="GI:752506589"
                     /translation="MKEKIMEKKSHLQVACFKIGKESYGVAIDHIREVIKVPLEGIYA
                     IPNVPDYITGIYNLRGSVIPLINLNIRFKIPSVYVTEEDKLLTGYLIVNIKDKLLGIF
                     VDKVLKVISFDTSKVQEPPATLQTLDRKYISGVVKIENEENFESEYLILIDIERIFDK
                     GEFARIPYKENNEE"
     gene            complement(323098..323673)
                     /gene="rrmJ"
                     /locus_tag="BT0_RS01540"
                     /old_locus_tag="BT0313"
     CDS             complement(323098..323673)
                     /gene="rrmJ"
                     /locus_tag="BT0_RS01540"
                     /old_locus_tag="BT0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772271.1"
                     /note="Specifically methylates the uridine in position
                     2552 of 23S rRNA in the fully assembled 50S ribosomal
                     subunit; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA methyltransferase"
                     /protein_id="WP_041178567.1"
                     /db_xref="GI:752506702"
                     /translation="MYNVVDEYSRRAKKEGYLARSVYKLIEIDKRFSLFSSGNILDVG
                     ASPGSFSQYAYGNLKDGVLVAVDLNDIDLNFTNNFYFIKGNIYIDEVCQKIETFAPYS
                     LIISDAAPKTTGNRLVDTSNSFNLNMRIIELASRILVKGGNLLLKVFQGGEEEQLFYK
                     LKSCFKIVKKIRPKAVRKNSFEIYFLSKDFN"
     gene            323728..324774
                     /locus_tag="BT0_RS01545"
                     /old_locus_tag="BT0314"
     CDS             323728..324774
                     /locus_tag="BT0_RS01545"
                     /old_locus_tag="BT0314"
                     /EC_number="2.5.1.1"
                     /EC_number="2.5.1.10"
                     /EC_number="2.5.1.29"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="octaprenyl-diphosphate synthase"
                     /protein_id="WP_011772270.1"
                     /db_xref="GI:500096263"
                     /translation="MQNKSFLDKIEKNINNIFSQDHFLNLFKDKDLKLKLNIQKNTIK
                     TIKAPAIEIINRGGKRIRPMLMILLAYALGYNKKNTENLYKLSMLLELPHSGSLIIDD
                     IEDGAIKRRGKPAIHLIYGLDNSINTANLIYFLPAKLIQTSKLKKSQKLLIYENFFTT
                     LSNLHLGQGIDIALHNGTYIPNLDEYISLVELKTSCLFGMAGFLAGILTNNESKAKNL
                     YNTFLKLGTCFQIIDDIKNIKDGINGKDFGDDLIEGKKSLPIIYFLKEKLLDEQIIQE
                     LSAIKNKSINESKKEILKFSNMINSSSAIQNSTNLAMSYLNKFTEELNSYALINKYKD
                     MIMNIVKKIKEENL"
     gene            324771..325454
                     /locus_tag="BT0_RS01550"
                     /old_locus_tag="BT0315"
     CDS             324771..325454
                     /locus_tag="BT0_RS01550"
                     /old_locus_tag="BT0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772272.1"
                     /db_xref="GI:500096265"
                     /translation="MKKYVIMLIWMNITTFIYATIPTEDINKIDELYTKSMLLKELKK
                     YNQSKALLMQIINTDPKQVDAYLLIAELEYLMNNWLQAIEQTKTYLQIIDFKDTKNYL
                     DISWAYFLMGESRNSMDYIMQFIQDNKELLNTNIYILIDTILKKGFYHFIQDEDLIFN
                     LIINTLFQIETYDDTIFTIFLNNLDIIKQMPFYKFNKIKIKDLELQIRALKKLKNSTN
                     DIAKTGWFF"
     gene            complement(325432..326238)
                     /locus_tag="BT0_RS01555"
                     /old_locus_tag="BT0316"
     CDS             complement(325432..326238)
                     /locus_tag="BT0_RS01555"
                     /old_locus_tag="BT0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772273.1"
                     /db_xref="GI:500096266"
                     /translation="MFGIFLHSIVFAYLALGILYAERVGLLNISIEGISFLSVFLTSF
                     FIYLGYGIFASVVMTIFISLIFGFFLSFIVINGYNIFITGIGINILCYFLVRVLMKAN
                     FNFIPGFSLNISNNFAIIFFVIFFFVFLSFSIYILNYSRVRVVFEFIRSNDYENILGE
                     RTSNYFKSFAIFVSVISSSIAGSFLAINFNVYSYDLGLNNGWLAICILYIAFANPWLI
                     FPSAFLMIFIEYEFFNFQDYVNSYFALSLPFYMAILINIFVSLFRKTNLF"
     gene            complement(326239..327171)
                     /locus_tag="BT0_RS01560"
                     /old_locus_tag="BT0317"
     CDS             complement(326239..327171)
                     /locus_tag="BT0_RS01560"
                     /old_locus_tag="BT0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772274.1"
                     /db_xref="GI:500096267"
                     /translation="MRAFRREYILLIFSLSVLSISYFFDGFFSFSYMKVMLWNFMLLL
                     LIATGISTCAKSNSLTLGDEGQVYFGAFLSYIFCEFCGLTYFNFVLIIILSSFLVGVI
                     GIIPFLLTFFCGVNGMLTGLLMSYGNQRLVDGFISKLLGSNGLLNQTKSIDKIFVIDT
                     AFPYLLLFSILVWGCYVFIHKRTILGLRLEILSDRKPLSKFFGINEFKYKFCTVFTSA
                     FLNGLVGSIFLIFFKNYLFLGLTAGLGWNGFVVAVVSGFNYMYVLCFSLFFAMLNEFN
                     NYLKINYSFKFEFIGLYQAISIFISLFLINAGKK"
     gene            complement(327168..328625)
                     /locus_tag="BT0_RS01565"
                     /old_locus_tag="BT0318"
     CDS             complement(327168..328625)
                     /locus_tag="BT0_RS01565"
                     /old_locus_tag="BT0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_011772275.1"
                     /db_xref="GI:500096268"
                     /translation="MVEFKNIVKSFPDIEKPILDSVNLRIEESKILTVIGRNGEGKST
                     LSKIIAGFIRFDSGDVFVNNIRQKNWNVDVAKSNGIYIVSQIPKLDMNLKVWEYLSIY
                     WFDSQFFMPMNKSHTYRYYKWLRQFYNIAFDLETRIQDLNIKEIYFLLIISSLKKNAK
                     IIIFDESVSYFSQKEAKEFIKLLQALKRAGITSLFITHREIGDAIKFSDEFVILKEGK
                     CFRTTNKEIILSKLEIPADKFISMSIRRGGPNEDFIKFNLFFEDFWKYDISFSLKKRG
                     VLGIIAEEAVIKTWEKLFLGEIPFVGCIKMNGHRYEYINFYELKAGFLPLGIGNLFSD
                     NMTILDSFLAKIMSFENEIFIKQSIINDLKKFFKSDMEYCDSKILKTFYSKSLSFSGG
                     TLKKLALFREKYITKSFLICFSPLSNLDYRAYSETSNFIRNFSNEKPVLLITPNLDEL
                     LLLSDDVLAIKAGEVVLRLKREHINKEALKEMLFI"
     gene            complement(328629..329669)
                     /locus_tag="BT0_RS01570"
                     /old_locus_tag="BT0319"
     CDS             complement(328629..329669)
                     /locus_tag="BT0_RS01570"
                     /old_locus_tag="BT0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178455.1"
                     /db_xref="GI:752506590"
                     /translation="MSKALFFRIFCVFVSLICLFLFVYINFFRIREPRSSSNRKIALF
                     IPGIISGSPSYKAMYDFLIEFKKNKSDIEIRLFEAGFNQHEWIELLEKLLNSNNYDFL
                     ITTNNAMQGIIDRVSPNYPYTKFLLFDSLVKNINPQVYSLSYNVAEEAYILGYYVGLF
                     LKSSNLHNKNVALIAGQEYPVMNNYIFPYFKNGIREVLDSEVFFRTLGNWHDSNRVKV
                     LSDSLILDLGVSVVLPIVGTAIKGVLSSVREHGVFAVLFDGEDYLNNKDNIIGSGVTN
                     QRFYLEKVLGKALKGELKYGTYKVLGFRERGVSFNLLNKFYLEKTDSKLKKKLEEKMK
                     EMNNTEIKINLE"
     gene            complement(329994..331061)
                     /locus_tag="BT0_RS01575"
                     /old_locus_tag="BT0322"
     CDS             complement(329994..331061)
                     /locus_tag="BT0_RS01575"
                     /old_locus_tag="BT0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178568.1"
                     /db_xref="GI:752506703"
                     /translation="MLLLLLLQVTLFSQVASIKEMEGQINIIRNAIPVKLNLGDEIFE
                     YDFIEVGDNSKIKIGLYGINGIASDLTLYSNTHSLICYSSLKDMQDAKIYLFKGSLEV
                     FIYEVVQGSSFSVDLNNYFFMTDAPAKFYVNCEYFNNYFVSVFDGVLKHYNKDEYWIS
                     AGTSILLWDNNSFLYKTSDSVSQNVIENLKEMSRKNFVSLNNSRLTYIFLKYIEDSFR
                     FDFVYDYLVRDPKFNTIYSKWSLEDKNYTLGNRVDMINYVNYLRGRIGILFNNFIYLA
                     NVFFFIEDIVKHSSDVFDKVSIHGAILKYLENYKKNRSSLTKKFFKTVHSFKMYLIRT
                     NGDIPSNLSVNEFYLLKPREF"
     gene            331604..332725
                     /locus_tag="BT0_RS01580"
                     /old_locus_tag="BT0323"
     CDS             331604..332725
                     /locus_tag="BT0_RS01580"
                     /old_locus_tag="BT0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan-binding protein LysM"
                     /protein_id="WP_011772278.1"
                     /db_xref="GI:500096271"
                     /translation="MIKKSKLLFLMLSVFALPLISCKTPPEDTKNANSKISTKETGDI
                     KRDIEDIKKGVLRERGNLFYSKEFNETEKIEKEMHEKFAKGMIKEGNEIALKVLERYR
                     NIARDTTEKKEQINYLKENIEKYLNDAEANEAYIWIPLEIDEVNNLYFEATRKYKMYD
                     IESSLGMYSKTFNKAQQAAKKAKEARALKETEERMYKQLKALEAASELPVYRNNKLIK
                     PSPWNGRALLKDKGERINLLNPQDETYLLGQMDSLILAYEEKAEEVKTPDPNKFKTLQ
                     LIEKARQLWEQGLEAKNLNNLRLANELFLDSARYLKAYQSHSSKELYIIKIGNTLWGI
                     SKKLYNDPYLWPKIWFANRQKIQNPDLIHENWKIIIPSK"
     gene            332821..333189
                     /locus_tag="BT0_RS01585"
                     /old_locus_tag="BT0324"
     CDS             332821..333189
                     /locus_tag="BT0_RS01585"
                     /old_locus_tag="BT0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772279.1"
                     /db_xref="GI:500096272"
                     /translation="MKKLVLTSILFFSCYTVAHLNKQLTKDTPYSIYLREAQKATNVN
                     DYQSALKIYEKMIKNYKENESIVAIGKYEIAFIYYVTNKNNTAKKLFEELIQSNVQTP
                     KWIIPLSQKIIEKIKNQQKK"
     gene            complement(333217..334332)
                     /locus_tag="BT0_RS01590"
                     /old_locus_tag="BT0325"
     CDS             complement(333217..334332)
                     /locus_tag="BT0_RS01590"
                     /old_locus_tag="BT0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772280.1"
                     /db_xref="GI:500096273"
                     /translation="MKKAYFIISLFIVFNLFSSINDHLSINIDDVYVEAHEDGFHLFI
                     RKKPNIKSVILTESFEIPDKSKDVSTYSFRTLEYNRINGDEIRILNGRVIQNRRLLSL
                     TSSTPVQNRRFGQAFHILIPKKLRYGFPNFLTRSGDIDLEVLKRKKDPFWFSIRTFEK
                     KYNDYLGQYKDNAYELFFGDIQRESTSENNDLKKEFSRFSDNVVVAKKGLDLVDKIKN
                     ILEESEDPLADLDLVFVIDVTDSMKNHIEILREHLFSMIEPQLSQYRSYRVGFVFYKD
                     YLEDFLTRSFDFNNKEYLNNVLEDISVGGGGDYPEAVFEGINSAVTQFDWKADNRFII
                     VLGNAPPHEYPRGPIVYEDVIRSAKEKDITIYGILLK"
     gene            complement(334397..337258)
                     /locus_tag="BT0_RS01595"
                     /old_locus_tag="BT0326"
     CDS             complement(334397..337258)
                     /locus_tag="BT0_RS01595"
                     /old_locus_tag="BT0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772281.1"
                     /db_xref="GI:500096274"
                     /translation="MPDIEKINKFKRELLDNISDERAQKERFGIKMDIEPPKDGESIV
                     PWENQEEVFDLEEEPDDELDLDAMLGELDSEEDQNDGSNENDIAILKDSKKVDIDPEF
                     NELDNDFDVLSSHLEENLEKVLDDNSISLDDAINFDLDNNADSLQNLDIENDLDSDLL
                     NSDESIDNEIDANNLSQESLNDSNDDFDLENMISGLKESDETNNSLEMPYSDESFSNE
                     NSENLSDGEEDNWSNLSDDFEFLENDQKEPLGKHNFKINYPLFFKHLDSYPRNLRIAI
                     AEALMLENVSRYKIEALIDLVEQNKKGLKFIAKFVGDIVGRSVKLPVMYYKAEECSKL
                     EKKFSYRLSKALTPIFKIASLFVILTFLSFYFLVDVMFFYIASDRKYKEGISYIYENK
                     RELAKAIFRDAYYMKPNKKWFLTYAKVFEDVRDFDSAEEKYEELFTIDPFSVGASKRR
                     RKNFDRDGYISYAFMKMRLGEYADANAILDEVISYSIYDYEALMAKGDNYFQWAQRDP
                     AYYKDSINNYTILLSKYGHKKEILFKLFNAYIEAGAEREAEDVNAFIKVNKELDIDEV
                     VYTKYAKKLIDKYVEFTVYNKRINALSRNLKYFSAQMNLLNKEFSSFKAGNGKSISNA
                     LNDINLNSEIEYILRRILFKNPDYDKALFESGRYFYYMGDLKKSEGYLLTALNSFRQE
                     DSIENSSEKIVAYRILSDIYERNNDALKASNIVSLALNEYDFYKKNGLVKSSRELALI
                     YEKQGDILRTLNGFKSAISSYEMAINEGVNSPDVYYKLALLNYKENNYKDALTYLFRV
                     QNMSGFANSNKVLNSIASVLYKMGDFEAARSYYLRVLQNLESEKSSILSFKPQGNDHH
                     KALLIKEIEIYNNLGVVEIRASLGDRIESGVVRNNNLFDSGIANLTESSRIFDILNRD
                     DDMVKSVKKDLASLNLRGIFKNDFIGSKILFYDNLADNL"
     gene            complement(337274..338167)
                     /locus_tag="BT0_RS01600"
                     /old_locus_tag="BT0327"
     CDS             complement(337274..338167)
                     /locus_tag="BT0_RS01600"
                     /old_locus_tag="BT0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate O-acyltransferase"
                     /protein_id="WP_011772282.1"
                     /db_xref="GI:500096275"
                     /translation="MFIRNESFNKYFKGIENEFFSRFKAIEKINYLNNSYHEADSVSR
                     SLVDTMIKRLLKSSSTIVGIQNILKLYEKSKSGKSSIILMEHYSNFDFPCFQFLLNQM
                     NCKEVSEHIVPIAGVKLFKDNLLIKSLSLGYSVIFIYPPHAFVGVDHETIRARRVFNA
                     NSMRCIADKKSSGYMILIFPTATRYRKGRPETKKIISEISSYFKLFDYFIMVGVNGSI
                     LEVSSNEDMSCDVFKEDTLVYNATEILDILEYKNLILEQLNQEGLEPTKEILGSRIAD
                     DLEKRFEVLHEEGAKIYSGLI"
     gene            338367..339962
                     /locus_tag="BT0_RS01605"
                     /old_locus_tag="BT0328"
     CDS             338367..339962
                     /locus_tag="BT0_RS01605"
                     /old_locus_tag="BT0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011772283.1"
                     /db_xref="GI:500096276"
                     /translation="MKYKTIILLSLLIIWLTSCSGDEHKDKITFRVTNEAEPDSLDPQ
                     LATSVQAFNIIINTFAGLTTRNTQTGGHKPGLAQSWDISADGLVYTLHLREGIMWSDG
                     VPITAEGILKSYLRVLNKETGSQYVDIVKSTIKNAKDYFEGKIPESELGIKTIDNSTL
                     EITLVAPKPYFLDMLAHQTFIPVPVHAIEKYGQAWTNPENIVVSGAYKLKTRIPNEKI
                     VLEKNDKYYNASNVEIDEVIFYQVQGNTAYNMYINDELDFLTKVASEYLDEARIRNDY
                     YSHPINRVAYMAFNTTIKPLDNVKVREALTLAIDREALNKITLKGQSKPTRNLTPPFE
                     HYSYGKQLKLFDPQRAKQLLAEAGYPDGAGFPTLKYKTSQRNGMAITAEFLQEQLKKT
                     LNINIEIEIEEWNTFLNNRNKGNYQTSYMGWTGDYSDPLTFLESLFTTENQGFGAYGY
                     SNKKYDNLIEQSNFAQDPIQRQDILRQAEALIIEQDFPVAPLSILKSYYLFRHDKWTG
                     WIPNVSEAYLYEEIKYKRENINN"
     gene            340384..341970
                     /locus_tag="BT0_RS01610"
                     /old_locus_tag="BT0329"
     CDS             340384..341970
                     /locus_tag="BT0_RS01610"
                     /old_locus_tag="BT0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_011772284.1"
                     /db_xref="GI:500096277"
                     /translation="MKIKKYTFIIFFLTVILSCSKENSKENLSFKISMGGEPKSIDPQ
                     LTEDKIGATIVAQMFSGIVDGDPKTGGYKPGLAQSWDISDDGTIYTFHLRKDIVWSDG
                     VPITAEGIRRSYIRMLTKDTASNYVGMIKSTIKNAQDYFEGKIPESELGIKTIDELTL
                     EISIITPKAYFLDMLVHQSFIPVPVHAIEKYGKNWTNPENMVVSGAYKLKERNPNEKI
                     SLIKNDKYFNAANIELQELIFYTINDASTAYRMYENNEIDMLIHGAIPPDLIKEIKLR
                     NDYYSSAINGLYYFSFNTQVKPLDNVKVREALTLAIDRETLTKKVIDNGSIPTRSISP
                     KFNHYSYGKPLELFNPQRAKELMAEAGYPNGEDFPQLKLKYNTNESHKKIAEFVQNQW
                     EKILNINIVLENEEWASFLETKQKGNYEIARSGWIGDYSDPLTFLSLFQKEFAYFSSY
                     KYFNKEYENLINQSDREQDPIKRQNILRQAEEIIIKKDFPVAPIYIYAGNYLFKNDKW
                     TGWVPNISERFNFSEIKRIK"
     gene            342202..343122
                     /locus_tag="BT0_RS01615"
                     /old_locus_tag="BT0332"
     CDS             342202..343122
                     /locus_tag="BT0_RS01615"
                     /old_locus_tag="BT0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_011772285.1"
                     /db_xref="GI:500096278"
                     /translation="MLKFTMQKILETIPTLIVIIFLCFLIMKLAPGNPFDSEKPIDPQ
                     IKEKLMQKYHLDKPFYVQAYYYITNIFKGDFGPSLVKKDLNVNQYIKLGFPKSFTIGI
                     ISLIISLTLGILLGSLAAIKKNTRTDYIIRIAAICGISVPTFVTGPLLQYLLSVKLKL
                     FYTSGWISERGGLTNLIMPILTMSLPWIAIFTRIIRGSMLEILKSDFVRTAKAKGLSF
                     NVIIRKHVLIGSILPLVSYIGPAFAGIISGSMVIEQIFRIAGMGTFTVESSLNRDYPL
                     LMGSLLVYSTILLISILASDIAYKKLDPRT"
     gene            343132..344184
                     /locus_tag="BT0_RS01620"
                     /old_locus_tag="BT0333"
     CDS             343132..344184
                     /locus_tag="BT0_RS01620"
                     /old_locus_tag="BT0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_011772286.1"
                     /db_xref="GI:500096279"
                     /translation="MNEHENQDTYVEIHTANKRAWLRFKENKLAFISIFIIGFYILIA
                     ILRPILPIYKYHTQVVEHADLPPSLKYAGELWYEKELHFIKRLSAKEKREINKEEKAK
                     LEEIKRKIETEVQTIDGKEIKIHKRIYLLGTDNLGRDLLARIIQGSQISISVGFIGAL
                     ISMIIGTIIGAIAGFFGGIIDRIITKIIEIFYVLPTLLVIIILMTVMERNIIGVFIAI
                     SIISWLTIARIVRGQVKSLARSEFIQAARTLGATNTRMIFKHLIPNSFGMIVIITTMN
                     VPSFIMLESFLSFLGLGISAPMTSWGELIKNGIPTFIEYPWKIFIPATVMTIFLLFMN
                     FLGDGLRDAFDPKDNL"
     gene            344195..345073
                     /locus_tag="BT0_RS01625"
                     /old_locus_tag="BT0334"
     CDS             344195..345073
                     /locus_tag="BT0_RS01625"
                     /old_locus_tag="BT0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_041178456.1"
                     /db_xref="GI:752506591"
                     /translation="MKEDYMLDIRNLSIEFKLKHTTIYPVSNINLKMKKGEIRAIVGE
                     SGSGKSVTSMAILKLLPEITTVYKTGEILFEGQDLLKLSEKELQNIRGNKIAMIFQDP
                     MTSLNPYLRISTQIEETIMLHQKLDKKTAKQKAIEMLKTVGVINAEERIEHYPHQFSG
                     GMRQRVMIAMALSCHPSLLIADEPTTALDVTIQEQILLLIKSLSKKFNTSTILITHDL
                     GVVAEVCDTVSVMYQGKFVEEGTVQEIFKNPKHPYTIGLLKSILTLDKDPNEKLYSIK
                     DNPIGTITNKMEGDFK"
     gene            345070..346059
                     /locus_tag="BT0_RS01630"
                     /old_locus_tag="BT0335"
     CDS             345070..346059
                     /locus_tag="BT0_RS01630"
                     /old_locus_tag="BT0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_011772288.1"
                     /db_xref="GI:500096281"
                     /translation="MKNEKDIILKVENLVQTFTIGENFLFWKNKRKVNAVNGISFEVE
                     RNKTLGLVGESGCGKSTTLRTIMQLYTPTSGNIYFNGKDITKLSKRELLKTKKDMQMV
                     FQDPHTSLNPRMTIKEIIAEPLVIYNENKIFPRTKQEIEKRVNELMDITGLAKSMLSR
                     YPHEFSGGQRQRIGIARALALNPKLLLLDEAVSALDVSIRAQILNLLKDLQKELNLSY
                     LFISHDLAVVKYMSDKIAVMYLGVILEIAPREILFSNPKHPYTKTLIASIPEIDPEKI
                     KNKTIKLDEPSLTNIRNTSITPENATLEEVEKDHFVSKYLFDEMNNLINKNDT"
     gene            complement(346217..346972)
                     /locus_tag="BT0_RS01635"
                     /old_locus_tag="BT0336"
     CDS             complement(346217..346972)
                     /locus_tag="BT0_RS01635"
                     /old_locus_tag="BT0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772289.1"
                     /db_xref="GI:500096282"
                     /translation="MERILGWLFYFIFFFFNIFNICSQCYVIENFDLSLNEFLEVSTR
                     KDNLSPIVDSKRVIMFYPSNKGIRKIFAAFDFDGYAKKYLFKKNKYGLFFVKINLPHG
                     VGSIKYRLVVDGIWTNDEYNKNVVFNKDLIPFSIIDIGVDHSYVSLRNPIDSSDGREV
                     EIFYIGRPGQIVTIAGNFNNFNPFLNRLVEQEPYKGVYTIKLKDLPKGRIYYYFVDSG
                     NKVIDKNNVNRINLYLVEGIDNKMDFEVSYFDN"
     gene            347098..348399
                     /gene="eno"
                     /locus_tag="BT0_RS01640"
                     /old_locus_tag="BT0337"
     CDS             347098..348399
                     /gene="eno"
                     /locus_tag="BT0_RS01640"
                     /old_locus_tag="BT0337"
                     /EC_number="4.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S044.1"
                     /note="catalyzes the formation of phosphoenolpyruvate from
                     2-phospho-D-glycerate in glycolysis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="WP_041178457.1"
                     /db_xref="GI:752506592"
                     /translation="MGFHIYEIKARQIIDSRGNPTVEADVILEDGSLGRAAVPSGAST
                     GTNEAVELRDGNKSVYMGKGVLKAVENIINIISPELEGMSALNQVEIDKKMLELDGTP
                     NKSKLGANAILAVSMATARAAAEHLGLKVYQYLGAYKANILPTPMCNIINGGAHSDNC
                     VDFQEFMIMPIGAKTFSDAIRMSAEVFHTLKGILSKKGYATAVGDEGGFAPNLKSNEE
                     ACEVIMEAIQSAGYTPGTDIAIALDPATSELYDPKTKKYVLRWSTKEKLTSEEMVEYW
                     AKWVEKYPIISIEDGMAEEDWDGWKKLTDKIGNKVQLVGDDLFVTNTSFLKKGIEMKV
                     ANAILIKVNQIGTLTETFEAVEMAKKAGYTAIVSHRSGETEDTTIADLVVALGTGQIK
                     TGSLSRTDRIAKYNQLLRIEEELGSIAEYHGRDVFYSIKKQ"
     gene            complement(348450..348860)
                     /locus_tag="BT0_RS01645"
                     /old_locus_tag="BT0338"
     CDS             complement(348450..348860)
                     /locus_tag="BT0_RS01645"
                     /old_locus_tag="BT0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RRF2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S9"
                     /protein_id="WP_011772291.1"
                     /db_xref="GI:500096284"
                     /translation="MAKSDVKGINLGMGTGRRKSSVARVYIREGKGDIKINNRDFDSY
                     IQLENLKTIALSPLVLTNTLGKYDLYINIYGGGISGQAGAIRHGIARALFDLDEEYKM
                     VLKSNGFLTRDSRKVERKKFGKKKARKSFQFSKR"
     gene            complement(348871..349320)
                     /locus_tag="BT0_RS01650"
                     /old_locus_tag="BT0339"
     CDS             complement(348871..349320)
                     /locus_tag="BT0_RS01650"
                     /old_locus_tag="BT0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L13"
                     /protein_id="WP_011772292.1"
                     /db_xref="GI:500096285"
                     /translation="MNRITNNKTIWVKPKCVEKKWCMIDASDKVLGRVATEAVKILRG
                     KHKPYYTPHQDLGDNVIIINASKIRLTGKKYSQKIYYRHSRYPGGLRSDTFRTLSERK
                     PTAPLEIAIKGMLPKGPLGRELFRNLKVFAGSNHMLNSQNFYKLEAN"
     gene            complement(349400..350185)
                     /locus_tag="BT0_RS01655"
                     /old_locus_tag="BT0340"
     CDS             complement(349400..350185)
                     /locus_tag="BT0_RS01655"
                     /old_locus_tag="BT0340"
                     /EC_number="1.8.4.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772293.1"
                     /db_xref="GI:500096286"
                     /translation="MYNRSLFSCFPIIKRARFFYLYDIHGNRYLDLYLNGGLNFLGHR
                     VQGLNLILKQTFSRGLTASYPSVFRKQFENVLFSFFKEAGFVCIFKFERDARDFLLSL
                     TDQCCFSSPWEEKQGIYEFKAGFNNFRYPMLVKIPMPGCMSINIAIVDNLSRKIEFRD
                     SFDALTLAVARHMLTKILSYEKSTKINFNIFATPIFKLINRYMFPLYKSEYHNEIFNE
                     YLKNGYLISPFFDVPSLVPLKFSKGDLDGFHKVSLKLQDKFGC"
     gene            complement(350178..351635)
                     /locus_tag="BT0_RS01660"
                     /old_locus_tag="BT0341"
     CDS             complement(350178..351635)
                     /locus_tag="BT0_RS01660"
                     /old_locus_tag="BT0341"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZD3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA amidotransferase subunit B"
                     /protein_id="WP_011772294.1"
                     /db_xref="GI:500096287"
                     /translation="MEYKLLVGLEVHVQLGLKTKAFCGCKNDFGGIPNSRTCPTCLGL
                     PGALPSINKELISSAILAGHATNSKIKNIIKFDRKHYAYPDLPKGYQISQNDAPICEN
                     GFIFIETCSGLKKINIIRIHMEEDSGKSLHLLESENRSYIDFNRSGAPLLEIVSNPDI
                     NNGEEAVAYLSALREIFRYLDLSDCNMENGSFRCDVNVNLLINENGVEYKTPISEIKN
                     LNSFKSVKLAIDYEKSRQKEEWILHRRTFESVGKHTMGFDDKKGITVLQRSKETVADY
                     RYIKDPDLPLIKLDDSYIESIKSNRMVELPFDTRVRLKEQYGLSDFDVVTLTADKNLV
                     KYFEEAAIASSDPKRVANWILSEVLSVLNDREMNILDFNLPPSYISELVEFIVNDRVS
                     GKIAKEIFLEMLERNVSSAIIINEKNLAQISDISFIESVVFEVLNENPKSIELYKKGK
                     SHAIKFMMGQIMRKTSGRVNPVLANEILMNKLRDV"
     gene            complement(351625..353070)
                     /locus_tag="BT0_RS01665"
                     /old_locus_tag="BT0342"
     CDS             complement(351625..353070)
                     /locus_tag="BT0_RS01665"
                     /old_locus_tag="BT0342"
                     /EC_number="6.3.5.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772295.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA amidotransferase subunit A"
                     /protein_id="WP_011772295.1"
                     /db_xref="GI:500096288"
                     /translation="MDFRGLSLIKIKELILARRCKIYDIVLFYKELYEANKDINGYIE
                     FFDDSLELAKKYDELLGKGEGQNLPLIGMPIAVKDNISIKNKALTCASELLQGYVSPY
                     DATVIKRLKDSGAIMIGRTNMDEFAMGSSCEFSYYGVTLNPLNKEYVVGGSSGGSGAV
                     VAANQAPFALGSDTGGSVRLPASFSSLIGFKPSYGGLSRYGLASYASSLDQIGFFANS
                     IDDVALILKYTCGIDKMDATSIDLIQDPYPLLSKSLAGTKLAVIKELSEDLMEPEVAC
                     EFSKFKSALLNRGVEIHEVSIEAVNFVLSLYYSLSPVEAASNLARYTCLHYGKRLNDE
                     LNLNDFYYRHRSLFLREEVKRRIVLGNYLLSEGYDLQYYVKACKIVENVLIPKFNEIF
                     NNYSYIITPTSFVKPFKIGENFDNPIKMYYSDMCTVIANLIGAPALSIPFSQDDRGLP
                     IGMQIIGQVKRDFDLLSFAKNVIEELGLNGI"
     gene            complement(353082..353357)
                     /locus_tag="BT0_RS01670"
                     /old_locus_tag="BT0343"
     CDS             complement(353082..353357)
                     /locus_tag="BT0_RS01670"
                     /old_locus_tag="BT0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA amidotransferase"
                     /protein_id="WP_041178569.1"
                     /db_xref="GI:752506704"
                     /translation="MRDIRLEDSLKLSLLRLSKNEEREFAIKFEKIIGMLNKISEFEI
                     KDGIQKEACNFSVLRNDEILPSLAIESIKNFSNVFVDGYFSSPKVLG"
     gene            complement(353376..355469)
                     /locus_tag="BT0_RS01675"
                     /old_locus_tag="BT0344"
     CDS             complement(353376..355469)
                     /locus_tag="BT0_RS01675"
                     /old_locus_tag="BT0344"
                     /EC_number="3.6.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA helicase"
                     /protein_id="WP_011772297.1"
                     /db_xref="GI:500096290"
                     /translation="MDKIEKFLFSLNSYQKQIVLDDTKNPILVLAGPGSGKTRVITAK
                     IAHLIKEMQLKPEEILALTFTNKAANEMNLRLNYLFDFNKALHIQTFHSFGAWLLRLY
                     FKEFDKNYDSNFTIWDTNDVVKFVKQIGLASTIELSKHVASFILKYKENCFLDNYCGL
                     DEKSYKDIKFYEQEKSKNNAFDFADLILKAVLMLRDCEDVKMRVQKKFKAIFVDEYQD
                     TNYTQFLFLKELYCKDMHFMVVGDEDQSIYSFRGARIENILEFEKIFDNVSKYYLVQN
                     YRSSLSIVNVANDVISKNRNRYEKVISTENKMGKKIRFFVFRNPAEEAEYFSNFLIEN
                     QLETAVLYRFNYQSLQFEKSFFKHNIPHKILGSIRFYEREEIKDVISLLRLFVNKKDK
                     ISFLRVINKPARGIGKTTTNKIIAMLNDRNVNFDLILASRKVADSLKGKAKDSLVAFL
                     NLYDKLAESIQKDVYVNLSEFIKNVVIRSGFWDYYQKFDGDEKSRNIDELISSGVEYS
                     GSFEGLVIFLENSSLSPLIHGDSKSSILLSSIHGVKGLEFDRVIISGLEKGLLPAEIE
                     ELTGERLEEERRLFYVAITRAKFELIVTMNLQRFFGGMLRNTAMSVFFQDISKDNYDI
                     VFVPEYLKDNFKYFFSKSGNKSFNIGDYITYNGENGIVVDKWYQNGEPFIKINLRNGR
                     KAILSSSYIKGLAKI"
     gene            complement(355469..356668)
                     /locus_tag="BT0_RS01680"
                     /old_locus_tag="BT0345"
     CDS             complement(355469..356668)
                     /locus_tag="BT0_RS01680"
                     /old_locus_tag="BT0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772298.1"
                     /db_xref="GI:500096291"
                     /translation="MERNNFIRFGDFIKKARIDKGLTLEMISDDIRISVKYLKALEDS
                     NIELFPNEVLALGFLRTYSEYLGIDVWYVSSLFKEYKRRLNSSYIGIKTEDQNGSLNF
                     VNEGRLGGQYLDLSKIAFPKMIQILVGLVSIILLILLISNFSGIKQFLGNFFKANHAA
                     KRAPEVHEVLFDKESFWNVALGDGDFLSLVYGNTIANYRVSFMNDDLVVTNDLKNGRY
                     VFKLGKFREIDLSDNVKVKIVYDNYSQGKVRKAHVSLESFMLNIEYVLETSLSSRFNV
                     LNWGFEVNGPKSRVISEYPTVYSSQDISNIDLMINFLNDTFLRYADESNIYGKSLLVS
                     KGLPLNLKFKKSLILFLSRLSDVNIILQGKDITSILKSYGREIMAVQFFWLKTPGGFD
                     LKVSEVY"
     gene            complement(356680..357333)
                     /locus_tag="BT0_RS01685"
                     /old_locus_tag="BT0346"
     CDS             complement(356680..357333)
                     /locus_tag="BT0_RS01685"
                     /old_locus_tag="BT0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer-membrane lipoproteins carrier protein"
                     /protein_id="WP_011772299.1"
                     /db_xref="GI:500096292"
                     /translation="MKKIILILCPCLIFAQVSANQYFENIYSNYQNIEDMQAKISLNI
                     KGLKQAGTLLYKSPDKFIVNLDSNNQVFVSDGEILTVYVPTLGTSFRQQLTMGKVGSG
                     FMNILSTEYSVSYTNSPNLEPLDESGGGNTENFIKLTFSRRLYKGAATIDSFMIAFTR
                     NGVIRRVIAYPTGGGREIIIDLLSVKFNVGIPDSRFKYDLPKTSNKVDNFLYDVKKT"
     gene            357499..358908
                     /locus_tag="BT0_RS01690"
                     /old_locus_tag="BT0347"
     CDS             357499..358908
                     /locus_tag="BT0_RS01690"
                     /old_locus_tag="BT0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772300.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fibronectin-binding protein"
                     /protein_id="WP_011772300.1"
                     /db_xref="GI:500096293"
                     /translation="MSLNYSEINILLKEVPLKNSFLRKIKQPNHKTLIMELYNKETEK
                     KNFNILISLDPKKTRIHKTNKKFENTKPPLRFFEFLKSKVQNGKILEAYQIKNERIIL
                     IKVFKDKIIIFIFIKLWPSSPNIIATDANFKILDAYYRKPRSKEITGEIFTKAKEIIE
                     NNDITDKKEVKLKDGYNNEISYSEFIENYYDNLEIKETQAHNIELLKQKYEKEKINLE
                     KKINSLEKQINSIEKIEDQRKKGEMILSNINKIKKGMDEIILNNNNGEQIKIMLDKAL
                     LPKDNALKYFKEYKKNKNSLKIIQEQLEYAKTQYNTLISKTAYIDKTDCIIPTNEKTK
                     KQKITKKPSIGLHFISYGFEVVIGRNAKENDALLRNWAKGNDYWLHTRDYPGAYVFIR
                     SKKDKTPPLEVLIDAGNLCVFYTKPARQSGEADLYYTNVKYLRRIKGEKKGLVIPNRE
                     KNLNIKLDNKILNKLKNKN"
     gene            359019..360452
                     /locus_tag="BT0_RS01695"
                     /old_locus_tag="BT0348"
     CDS             359019..360452
                     /locus_tag="BT0_RS01695"
                     /old_locus_tag="BT0348"
                     /EC_number="2.7.1.40"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate kinase"
                     /protein_id="WP_011772301.1"
                     /db_xref="GI:500096294"
                     /translation="MIQKLTKIVATISDLRCDPEHIKELYEAGVNVIRLNTAHQSHDD
                     AIRVINNVRKVSNKIALMIDTKGPEVRTANIENPITVKIGDKIIISTSPINESNALQT
                     NYDGFVNEVPNGSTILIDDGELEMTVIEKLTDRLICKVKNDGQIKNKKSINTPGISLK
                     LQSVTEKDKGFIELAAKQNIDFIAHSFVRHAKDIQDVKDILNAAGNPDVKIIAKVENQ
                     EGIDNIEEIAKASYGIMVARGDMGVEIPAEDVPLAQIKITKTCIKYGVPVITATQMLH
                     TMIENPRPTRAEVSDVANAILNGTDAIMLSGETAYGKYPIEAVKMMTKIAIEVEKYRE
                     KTLFQDEIFHSKRIIRNYIIKCAIDAIKIMPVKAIIVDSLKGRTARIMATYRASVPLF
                     ITTNNERIARELSLSYGVYANLVDHNFKATTEFVVTSLEMLKTQKVVQDSDIVVIISG
                     NPNRDTNKGTEFMEINTVEEAIKGHNR"
     gene            360458..361210
                     /locus_tag="BT0_RS01700"
                     /old_locus_tag="BT0349"
     CDS             360458..361210
                     /locus_tag="BT0_RS01700"
                     /old_locus_tag="BT0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178458.1"
                     /db_xref="GI:752506593"
                     /translation="MRNSLVDNIFYSTNDCNLELFSLNKRKTHKALLISYGAYEFFLN
                     NIALFKKVIAHNTKNVFIFSQTKENSQINISDHQTWKFFNKTIDVNLDIINLIKNFEF
                     TNTEDKIIENDHKIEIVLNFIKDITQDIKIIPIILGKLKNQTLREFCTFLNPLITKEE
                     NSFIFLSHFISHSTHLNKSIQLSTTLKGLLSTPNLNSSTLLEYYNARKIFPENINAII
                     IIHKLFHKFEFINQQIINNDNEYSIIENILIN"
     gene            complement(361231..361509)
                     /locus_tag="BT0_RS01705"
                     /old_locus_tag="BT0350"
     CDS             complement(361231..361509)
                     /locus_tag="BT0_RS01705"
                     /old_locus_tag="BT0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="WP_011772303.1"
                     /db_xref="GI:500096296"
                     /translation="MGRECEITGKKTMFGNNVPRKGLSRKKGGGGQHIGVKTRRTFKV
                     NLINKKFFVPELGKSINIKVSASTLRSISKLGLSVFLKKNSKKIEDFI"
     gene            complement(361519..363078)
                     /locus_tag="BT0_RS01710"
                     /old_locus_tag="BT0351"
     CDS             complement(361519..363078)
                     /locus_tag="BT0_RS01710"
                     /old_locus_tag="BT0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178459.1"
                     /db_xref="GI:752506594"
                     /translation="MGLVDFLVSIFNRELTPEQVKQRRLREVKNNLSKVGNFFNASKI
                     QALPQFAKFIYNLYKAFMPFKFFVQRYRTSNKIIHFVVEKYLNDNQKQALEYIYSFSS
                     NDVVNFTPDISKNLDNNLNYLLNNITQEQIRLIDETCGALDIFFDLASYQYYSIIKNF
                     DSLFPENDFIYKPRFNTVSCGVILDDIKDFLECIYSIRDVSIWRNLYDILLEVYGDRD
                     NFPIKPNVWLKILTSIIEINKNKEILYLIRYVSGDPDYLPISGVKKAKAKAKLFFNDL
                     SKHVSNERAKIEILQKNSKSKLLAEKLFPGMTLVSLENYSERMHAKITSAIVNTTGYV
                     YSDLLVYIKTHAVNFVKKELSDIINVLIIKGQWKDMEVSREISNDIHSLVGVYSNLID
                     FDNNLGEQGTYGNRINSLLHRISVGDKSSEKLLLNIIADINKKALILLNEYYLVIKSL
                     ERRLNDCLEDYFKPASEKEFIYNWKELDIELVKSYGNNVNFGSIIKNVVDSLNLFLKL
                     MDLYLEKKNTV"
     gene            363202..364335
                     /locus_tag="BT0_RS01715"
                     /old_locus_tag="BT0352"
     CDS             363202..364335
                     /locus_tag="BT0_RS01715"
                     /old_locus_tag="BT0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772305.1"
                     /db_xref="GI:500096298"
                     /translation="MCIKKPILIIVFTLIFSCSRNDTITILTDNKIMPFYINQFNIQN
                     KTSFIIKYREHINMQTINEENAQVIISKNIDNININKNFKNIQQYYYSDYPILNNISE
                     KFAYRIVPLSFDVPILIYKNEYNIQKYIDIQNIKEIYKSFQKEKKIFISPYISENLFY
                     TISEINDINFYFGNNKPEYNEKKMSDMINHFKSFIDTNELELHKNFTEKYKYLNLEKI
                     LLQKKTILIAGLTNLTYYNSLNKDIKDKINFSYLTNKEKKSSICNINFMGVKEISTPI
                     EKFIQWILNQEVQKSLIKLKEKAKFNEHFGFANGFTPYKGLNLKLKHIIKKIPLFIID
                     ENYINKNSYIITKEQIEKENRMINELFLSNINNTKANEDHSSL"
     gene            complement(364320..366113)
                     /locus_tag="BT0_RS01720"
                     /old_locus_tag="BT0353"
     CDS             complement(364320..366113)
                     /locus_tag="BT0_RS01720"
                     /old_locus_tag="BT0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178460.1"
                     /db_xref="GI:752506595"
                     /translation="MKRELYTFVSKFFILLLLFICFVFCYTYFFGADYLDKHVLIATL
                     FDTILSVYHYFNGFFIFFVLVYFIFLAKHETRLYLRDYKGYLFKKLSPFMFLFFIIGI
                     VFMFVFNSIMSYVLTQRSEYKYNYERYNLLAGQANAIVNEVKSIDINLSSNKTLDVNE
                     LIEILQQKRKYLEELLRMYEKMRLISDNDELSINYYLTRSEYDRMPIYDVDLEKVRKT
                     LKLRLIKNLTKRDFQDIVNGFISKGDYSTANYFAYMGLVSTRDDEFAALLDLTFKAIN
                     EYKNIEIEKKSLIFEEKQKNFLYLNTEKFKPAYYGFLRLHNLFPNDNEILSYKNKSLE
                     KLKDEYFFFDEIEKHYEHYGINDIFLFQPNSGNGTYDYIYMQKVVNTVSSYIKMIKNF
                     ELIRFNRSGNIILHIKVPFATLKGNGVYQNVLDKKNENSDITATRMIVSLTDFDLSNT
                     KIININNDVNNLRLFANSGKDSIFLPIQVLLGAFNRVKTFNLILISVFSSSLFLMMSP
                     ILLVFFGVMFTAVASKISFEFDSKLMIFLISLIIAIFSGIISLFINYLLLILIALFIQ
                     ISVNIYISFILIFSILFFIVLHIIRVNYKEE"
     gene            complement(366129..367070)
                     /locus_tag="BT0_RS01725"
                     /old_locus_tag="BT0354"
     CDS             complement(366129..367070)
                     /locus_tag="BT0_RS01725"
                     /old_locus_tag="BT0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772307.1"
                     /db_xref="GI:500096300"
                     /translation="MLSILRFIFLISFRFIVMFVIFSLMFVCTSYLKYKFLQANLSIV
                     SFELYYDAYLYAFPLSLVVTFMRIAYPFNVKTLRVSGGFYGIIFIFILLLSYFGFLAS
                     ANFNSVFLDFHSRGEKIIKDGVVHFFDDKIVFYSDDVKSFGFKGVLKVEDNGFNEGDF
                     KTFSYDSDFSESDIMNFNANSFFTQKLYNDLINYVFSDLDTLNNFLFSLESFSLIFNI
                     FGFALLLFSFSYVFNLIFSSGLSFFLYPIFIILFFKVYNIYAIEFPESLDLIMGENVV
                     SNYVPFIFCVLTFFATYLISFIFKYIRVSEGFDNSLR"
     gene            complement(367105..367590)
                     /locus_tag="BT0_RS01730"
                     /old_locus_tag="BT0355"
     CDS             complement(367105..367590)
                     /locus_tag="BT0_RS01730"
                     /old_locus_tag="BT0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_011772308.1"
                     /db_xref="GI:500096301"
                     /translation="MAFVLDQAVVYPMQGVGKIKNIQNKEFNGEFIDYYEIYFPFNEM
                     TFMVPVSRADDLGIRALVSKEKVEEVFNIIKDFEEQIDQKKIKDGSHDFYKQSDILST
                     AKLYKFLYTKSMQKELPFYEKRILNDFELILQHEISLALQISFEEAKQKIKEVLSMGK
                     S"
     gene            complement(367637..368230)
                     /locus_tag="BT0_RS01735"
                     /old_locus_tag="BT0356"
     CDS             complement(367637..368230)
                     /locus_tag="BT0_RS01735"
                     /old_locus_tag="BT0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772309.1"
                     /db_xref="GI:500096302"
                     /translation="MANLKDIYSKPDRIYFFGIPIDVFKSSDKLIGRFEYLVSYPYHS
                     MVIFIDCKSLLKFLFFKKFRNLVRNSSLVFSNSKLLRALCKFFKRIDIGCYDSNSILL
                     VLMSVLENTYKTCYIIDKDKIISKRNFLRLKESHKEINFIGYYDLKAVKRNKEMFFAN
                     INKLTPSMIISFCSDSYLEDLFYANKFGIRTNLSVFL"
     gene            complement(368223..368951)
                     /locus_tag="BT0_RS01740"
                     /old_locus_tag="BT0358"
     CDS             complement(368223..368951)
                     /locus_tag="BT0_RS01740"
                     /old_locus_tag="BT0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011772310.1"
                     /db_xref="GI:500096303"
                     /translation="MKQIVLDDTCLFDNDIIIDDVKIYHYLVDVRRVKVGDTLNVLLG
                     GREVRFAEISSIDNNLIKLSTLKVEMLKKRDFEVSIFISSLKGRKLDLSLRQVVEIGV
                     DHINIVNADNSVARIDMDDLEFKSTRFLKLINEALKQSGNTQVPSLNFYKNFFSISYS
                     PSVNYYVAHKEGVLLGCGDDISVFGKIGILIGPEGCFSKSEIDFFKKLNFKFVRFNTP
                     ILRADTAVVYSLAHFKLLLEGNNG"
     gene            complement(368955..370385)
                     /locus_tag="BT0_RS01745"
                     /old_locus_tag="BT0359"
     CDS             complement(368955..370385)
                     /locus_tag="BT0_RS01745"
                     /old_locus_tag="BT0359"
                     /EC_number="3.4.21.102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase S41"
                     /protein_id="WP_011772311.1"
                     /db_xref="GI:500096304"
                     /translation="MKKKCLVFVYFVLALSISSSVIVESIFAQTDPSKGKMSASTYGQ
                     MMMDAFNFIKRNYVEPVDDEAIFEGALKGMFKALNDPYSQYLTKEDLVEISKTTEGNY
                     VGIGVSIVKKNVPVKSDSSVLDASYVMIVTAFEEGPAYKAGVKSGDYITDIDGKSTTL
                     MTIEQVGSLLKGKAGTKVKISVLRDKDLKLEFELVREKVDIQTVKHDVINKSVGYIKI
                     LSFNPNTNTYFKKAFEKLQAQNIKSLILDLRFNTGGYLQDAIEIADDILAEGLIVSTR
                     ARDSKVPVEYKASSSHIVPLDMPIVVLIDKHSASASEVLVGALKDNQRVYVIGEKSYG
                     KGVIQRILPFYTGGFKITNSKYYTPSGHSIHNIGIKPDLEVGEREFSETEVLAYRQIL
                     DKKLVEDFLNSRKNKKSITEKEIDAFVDKILKEHSIHNIDKDILGYYVFSQFYQDTHN
                     EMPIYNLHYDKPLRAAYEYLVKGTKN"
     gene            complement(370382..370606)
                     /locus_tag="BT0_RS01750"
     CDS             complement(370382..370606)
                     /locus_tag="BT0_RS01750"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178461.1"
                     /db_xref="GI:752506596"
                     /translation="MNAIINLIEELFTNIVLSANPYSANSINMLATVCKIRTRPVIIL
                     FVFELFVFNIILKYYIMKIKSSFIYVGIIQ"
     gene            370879..372012
                     /locus_tag="BT0_RS01755"
                     /old_locus_tag="BT0361"
     CDS             370879..372012
                     /locus_tag="BT0_RS01755"
                     /old_locus_tag="BT0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011772313.1"
                     /db_xref="GI:500096306"
                     /translation="MIIIPVASGKGGVGKSLFSTNIAICLANEGKKVLLVDLDLGGSN
                     LHSMLNIIPKKSIGTFLKTKIPFKDVIIESGIKNLSFIAGDSDIPELANIAIFQKKKI
                     INNLKNLSYDYLIIDLGAGTTFNTIDFFLISNRGVIITIPTVTAIMNAYLFLKNAIFR
                     LIAKIFTKETKAYKLISDIKKDSSDLQRIYIPNLLLKIETYDPESYEKFMKKFSQFSP
                     FIIFNMLNKPDDIKKIKKILKSAKDYLNINLQSIGSIYKDELIDKALNHKIPITIYKP
                     TSLTSKSIKKIAKKLIELETIINDVELLSEDDLNESYHFVIQEAQDEYLEKYAYLESL
                     LMNKTIDNNAIIDIIKSQQKEIATLRKQNIMFKKKLFAQLKKD"
     gene            372023..372982
                     /locus_tag="BT0_RS01760"
                     /old_locus_tag="BT0362"
     CDS             372023..372982
                     /locus_tag="BT0_RS01760"
                     /old_locus_tag="BT0362"
                     /EC_number="2.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prolipoprotein diacylglyceryl transferase"
                     /protein_id="WP_011772314.1"
                     /db_xref="GI:500096307"
                     /translation="MPNYINYPSWLHPEIIKGIPITWYSLSYIIIIIISYKFIWYQIQ
                     TDKINIEKSDYEKLMFSLVMGAIIGARLTSTLIYDRSGIYYTHPWLIFLPFDRNWNFT
                     GFRGMAIHGGFFGVIIAPIIMINTKLKNTNIKKYFRKITDYGAIAFSSGYILGRFANF
                     ANAELYGRPMKGGIIFPNAELFKVSQKGVREFAESIGLEILPHDLFINLPRIPSQLIE
                     GLFEGTVTFLLLWFIFRKIKRYDGFIFGVYIILYGLFRFFIEYLREPDKEIGFVITYK
                     KPESILDFSFLNISIGQIFSLILILSGIIWLSWAKTRSEKLKK"
     gene            373034..375025
                     /locus_tag="BT0_RS01765"
                     /old_locus_tag="BT0363"
     CDS             373034..375025
                     /locus_tag="BT0_RS01765"
                     /old_locus_tag="BT0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772315.1"
                     /db_xref="GI:500096308"
                     /translation="MKNPNAIVISEGTINDNDITKIKSIFKISQIVKSRKNISSEYIK
                     QSNIKFAIIYNHKRPIDFSINMANDLKSINNIHSIIIDNKSIDEAIYRPNYIEILKNI
                     SELNDKNKLIQQKKLYYDNNNANLDFFLNLSELIQEIVIITNTDNDIIYINEKGSKEL
                     ELPIKIGGKTNKISDINIMDLEKNTKIDLSYNINDIPEFKNILITDCLLKIKNNKKLI
                     VDLFISTIAQNNIDKLITIKDISELKSKHNIQDLTIIDQQTDLYNIKGLEKLLINQIE
                     SSYKKIYLFDLDLHINTECKYKDKKANSDLKILKKITSRIMSFYSEYIFRLKDNNLIV
                     IISTRGGEQRLISIAEEIKKTISRELKKEGLIIFKFNIGIIEVNLKEDIETKISKLKI
                     ATKISDEYKDSTPILYKDELPETILIKKQNKIFEYIVKAIKNDFFSLYYQKITPLKKD
                     LKPKIEILTRLFDYTGTPIPNGNVFSLIDKYNLTVEVDKLVVTKALREYTNFVAKNGA
                     HIFSINISPYSLKSKNFRMFLKETLLTSHVPLQNICLEITETGILENFELINTYFNEL
                     KTFGIKLALDDFGSGYTSLSYIKILPIDIIKIDGSFIQVINSSQTDLVIIKSIKDIAD
                     TKKIKIIAEFVSNEEILKKINEIGIDYGQGFLWHKPEPI"
     gene            375197..376573
                     /locus_tag="BT0_RS01770"
                     /old_locus_tag="BT0366"
     CDS             375197..376573
                     /locus_tag="BT0_RS01770"
                     /old_locus_tag="BT0366"
                     /EC_number="3.4.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772316.1"
                     /note="catalyzes the removal of amino acids from the N
                     termini of peptides; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_011772316.1"
                     /db_xref="GI:500096309"
                     /translation="MTKQNPWTSLNEEDRNNILEFTQKYKKFLSTVKTEREATNYATQ
                     RAKEKGFINACEKQELKAGDKIFYTCRNKNIALVFIGKEPIENGMNFIVSHTDSPRLD
                     AKPSPITEENEFTMMKTNYYGGIKKYQWLSLPLSIRGIIFLQNGEKVEINIGDDKNDP
                     VFVIPDILPHLDRKVQRDKKADDIIEGENLKIIIGSLPIETKEKEKVKSATLKLIKEK
                     YKIEEDDFVSAEIEIVPAGEAKDVGFDRALIGAYGQDDRVCVYTSLEAILNLEETPSK
                     TAICFLVDKEEIGSTGSTGLNSRYLEYFVSDIIFKLEQNKYNNLFVQKVLWNSKSISA
                     DVCGAINPLFKSVHDEQNAPKLGYGISIMKYTGHGGKIMASDADAELVSYVRNLLNKN
                     KIAWQVATLGKVDEGGGGTVAKFLAHYGIRTIDIGPGVISMHSPFEITSKFDIYTSYT
                     AYQAFFKG"
     gene            376570..376845
                     /locus_tag="BT0_RS01775"
                     /old_locus_tag="BT0367"
     CDS             376570..376845
                     /locus_tag="BT0_RS01775"
                     /old_locus_tag="BT0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphohydrolase MutT"
                     /protein_id="WP_011772317.1"
                     /db_xref="GI:500096310"
                     /translation="MTNMNKETIKTSEHILECFGGIANIKQVDKDLTRIKILVDSNSL
                     VKRENLTEDHNIIGAIKSNEFTEIVMNFEIIDDVYSNIVYMMNKKIQ"
     gene            complement(376860..377912)
                     /locus_tag="BT0_RS01780"
                     /old_locus_tag="BT0368"
     CDS             complement(376860..377912)
                     /locus_tag="BT0_RS01780"
                     /old_locus_tag="BT0368"
                     /EC_number="1.1.1.94"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772318.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate dehydrogenase"
                     /protein_id="WP_011772318.1"
                     /db_xref="GI:500096311"
                     /translation="MKISIVGAGAWGTAIAKVLSDKFKDNVLIWSFEEDVRDSINNDH
                     ENVKYLKDIKLADNLVASSDLHDVVDQADYVFVVTPSLYTLNVLNKLKGMYTTKKFNL
                     AILTKGFITIDGRPCTIIDVAESILSDYKDEITYIAGPSHAEEVGLGIITGLVAASKN
                     RANAFEFINLFSDTSISMFYSDDILGVQIASALKNIFAIAFGILDEYKIENPNLIGNN
                     TESFLFSVSLNDMKNIAFKLGSCNAETFLFLAGSGDLDVTCRSIFGRNRRFGREIVSK
                     NILEGLAGINDLINNIHKIGYLPEGVIAANEVALLFKCLGSDSSYHNLASIVYKILNK
                     ELRPEAVIDYIRNFKV"
     gene            complement(377937..380225)
                     /locus_tag="BT0_RS01785"
                     /old_locus_tag="BT0369"
     CDS             complement(377937..380225)
                     /locus_tag="BT0_RS01785"
                     /old_locus_tag="BT0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent Clp protease ClpA"
                     /protein_id="WP_011772319.1"
                     /db_xref="GI:500096312"
                     /translation="MYNRRALNNLFFKSFLFFMKRKHLVFTEEHIFYSLISDEKIKEL
                     LSLCTLDFYSFNKILEKFFKKLPLRDSDISDYLFKMNDLYQEIVDTIFYYKKPYRLQE
                     KDLLWVLIRKRKNIILDALLKSGFSLTIFDKIIEVYDYLGSDLDLNSSENEKFIANDL
                     FGKEIDKDGGLSIFEEDYLKLEQSDDLSDNDNLVEDFLVNVIDSLEPSLDKNPLIGRE
                     EELCELTQVMLRKYKSNPIVFGEPGVGKTILLQGLAYMIKVGQVPQELVGYEVYSLDI
                     GRLISGTRYRGDLEDRVNKLLDFLYLKKKVILFIDEIHMIVGAGATSFSNIDVSNLLK
                     PILTLGKVKLIGATTKYEYQKFFLRDKALMRRFHSIELKEPSFEDTYLILKGSKEQYE
                     KHHNVGYTDEAIWASITMSKYIKDRFLPDKAFDLLDGLGAKFKLEGNKKVITGDDVKI
                     FVKSMIGTNVFNFDDYDQNLLINLERKIRESMIIDENILSDLILNIKLLRIKFLLKNN
                     TLGIFILMGSSDVDKNKLSCILSEELKIPKLTLGMSEYGDFDGINRLIGPVYGSESYD
                     EPTKFFKFLSESSSSIIVLSDFDKSSKRVIDFFFEGFNTGRLFDSLGRSVSLSDSIII
                     LDIDIKHREFDGIGFKTETIDGRSLLEKRFSTQLLDLVDHIFFFKPVGEDDFEKVIIE
                     EMNSFIKILKNEKVDVFFEENIVDYFQNKTYRSGLGIKSVRKIVLKEIGGLLVNDMIS
                     KKFKENDKIRVFLDETIKYELL"
     gene            complement(380236..381456)
                     /locus_tag="BT0_RS01790"
                     /old_locus_tag="BT0370"
     CDS             complement(380236..381456)
                     /locus_tag="BT0_RS01790"
                     /old_locus_tag="BT0370"
                     /EC_number="6.1.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZF9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosyl-tRNA synthetase"
                     /protein_id="WP_011772320.1"
                     /db_xref="GI:500096313"
                     /translation="MNLALEILEKRGFLKQCTNLEALSTLMDKERVVFYVGVDATSTS
                     LHIGHLIPFMVMAHLQRQGHIPIALVGGGTTKIGDPSGKDAMRKILSKEDIEKNVKAI
                     RAQLLRIIDFSHGYILDNSAWLDNINYIEFLRDIGVCFSVNRMLGFETYKRRIKDGLS
                     FIEFNYQLLQSYDFYMLNKIKNCKLQIGGDDQWGNIVSGVDLIKKKLGTEVFGLTLPL
                     ITRSDGKKMGKSEKGAVYLDAELYSVYDFYQYFRNVPDLDVKNFLYLFTFLGDDEIEH
                     MSSVKGYLLNKAKETLAFEITKIVHGEDAALKASSAARAAFKGSEGDRADIPFFKLAL
                     DSLEGSILLIDLMVLSKVVSSKSEARRLINSGGVYIDKVRIGDQDYCLNKDNFINGEI
                     ELKIGKKRILRVIL"
     gene            complement(381453..382790)
                     /locus_tag="BT0_RS01795"
                     /old_locus_tag="BT0371"
     CDS             complement(381453..382790)
                     /locus_tag="BT0_RS01795"
                     /old_locus_tag="BT0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine-tRNA synthetase subunit beta"
                     /protein_id="WP_041178462.1"
                     /db_xref="GI:752506597"
                     /translation="MIKIEDIISLAKRKGFVFQSSEIYGGLSGVWDYGPLGIELKKNI
                     QKEWWNTMVYLHENVVGLDSSILMRPEVWEASGHVDSFLDLLVDCKNCKNRFRIDSID
                     LSNGCSSCNSIGTFTAPRSFNLMFKTNIGAVEDSSNEIYLRPETAQGIFVNFRNVLDS
                     TRLKVPFGIAQVGKAFRNEIVAKNFIFRTCEFEQMEMQFFVHPNQMSDWYYYWQQKRM
                     NFFIETLGIRSDNLRFKEHKGDELAHYAKAAVDIEYKFPFGFQEIEGIHNRGNYDLSQ
                     HAKFCGKPKLFEYHDLTSGDKYIPYVIETSLGLTRSVLMTLCDAYAHEELEGEGKRIV
                     LRLHPKLAPYKVAILPLVKKDGLPELARKVFMQFSDDFYMFYDDNGTIGKRYRRQDEI
                     GTPYCVTVDYDTIENRTVTLRDRDSMAQIRIPIDDLYSYIRTEILNYKGVANR"
     gene            complement(382822..384300)
                     /locus_tag="BT0_RS01800"
                     /old_locus_tag="BT0372"
     CDS             complement(382822..384300)
                     /locus_tag="BT0_RS01800"
                     /old_locus_tag="BT0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="WP_041178570.1"
                     /db_xref="GI:752506705"
                     /translation="MNIRVRYAPSPTGLQHIGGIRTALFNYFFAKSCGGKFLLRIEDT
                     DQTRYFKEAEEDLYQSLEWLGIDFDEGPTCGGPYAPYVQSQRTEIYQKYAKQLVELGS
                     AYYCYCTPERLERIRKIQTVNKMAPGYDRHCRNLSESEVRDVLSLGITPVIRFKIPLD
                     GETCFNDILLDKITWANKDISPDPVLLKSDGLPTYHLANVIDDHLMEVSHVLRAQEWI
                     SSGPLHVLLYSAFGWNPPIYCHLPMVMGSDGQKLSKRHGATALKQFIDDGYLPEAIIN
                     YITLLGWSYDDKSEFFTKDELRRLFSIERVNKSPAVFDYNKLDFFNSHYIREKGNNEL
                     AKLIIPFLQKAGYIKEDINSFDEQKLILLVSLIKPRIRKLSESVTMLKFFYEDIKTWN
                     LDEFLGKEKTAGDICLLLEKIKPLLEGFETRILSENEKIFYNFAKENNLKIGEVLLPI
                     RIAVLGSKVSPPLFDSLQLLGKTKVFNRINQAQQFLRRHECK"
     gene            complement(384314..385093)
                     /locus_tag="BT0_RS01805"
                     /old_locus_tag="BT0373"
     CDS             complement(384314..385093)
                     /locus_tag="BT0_RS01805"
                     /old_locus_tag="BT0373"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772323.1"
                     /db_xref="GI:500096316"
                     /translation="MVDRILFIFNIIFFVAFLYFVYLLEIFKFSNFLDFIFLHCSFIL
                     TFIVFIFIFNIVYSKFLYSRLYFMLNGIEHTYTFLKLKILRKTLKSVFDISLLLKIIL
                     IKQDKKSLDEIYFYLKDTKMSNKTIIELYSICISFREKEKASGLIANHAYSKNKWLRY
                     CVALNTIADEDYEKLSNEINFLKRYFLRGDPIFTVYFYYVLKRSNLEYQLVEKNRLEI
                     RDKYFKYKDRLNVKHTRLLNSNLFFVVFYYIYDISKKDIFY"
     gene            385224..386363
                     /locus_tag="BT0_RS01810"
                     /old_locus_tag="BT0374"
     CDS             385224..386363
                     /locus_tag="BT0_RS01810"
                     /old_locus_tag="BT0374"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772324.1"
                     /db_xref="GI:500096317"
                     /translation="MQNFDNLAKDIKNFSYIIDKDFLVWPQNSLLQPVNTELIEKWDL
                     KSSLKIQRTFFNETLIRETKKLINVEYDEESIANYHMLINNLEEIYENCKKNKKIYYQ
                     DVLPAVKKVMEFYKKNQQTFIKYMKLPKLLSDYHIVHSINTAILTVALGNEMNLNNHK
                     MVELCTIAILHKIGFLFIPLQISEKKEKLSNEEFEIIKKYPVLGHKILSTTNFSQSIC
                     SAILNHKENLDGSGYPNKLKSENINIESNIIGAASAYSAILLDRTYKGALNSGASLIE
                     LIQDADKKFDKRVLKLIIKVLSQCPLDFIVELNDNSIAKITKINEDNINVPYIKYIIK
                     DDKIVPPSENKNYVKSIPKTETGIKKILRQDEIEFISKKYGLKEI"
     gene            386376..387089
                     /locus_tag="BT0_RS01815"
                     /old_locus_tag="BT0375"
     CDS             386376..387089
                     /locus_tag="BT0_RS01815"
                     /old_locus_tag="BT0375"
                     /EC_number="3.2.2.16"
                     /EC_number="3.2.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5'-nucleosidase"
                     /protein_id="WP_011772325.1"
                     /db_xref="GI:500096318"
                     /translation="MILITSAMDEESIEINKIIENKEEIILDDYSGEKKIYKGEIAGH
                     KVISLTTGIGKVNAAMWNSYIISKYKITHIINSGTAGGLKESEDLKITDIIVSSETAF
                     HDFNLTKFGHKIGQVPGFPQKFKADENLLNKVVNIIEDKLKNISVHIGLILTGDQFIG
                     DKKQLEEIKNNFADALAVEMESAAIAQVAHTFKIPFIITRSVSDLPNIKDNHIDFNKF
                     LQDASMNSAKIVKELIKLI"
     gene            387108..388277
                     /locus_tag="BT0_RS01820"
                     /old_locus_tag="BT0376"
     CDS             387108..388277
                     /locus_tag="BT0_RS01820"
                     /old_locus_tag="BT0376"
                     /EC_number="2.5.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772326.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-adenosylmethionine synthase"
                     /protein_id="WP_011772326.1"
                     /db_xref="GI:500096319"
                     /translation="MLNNNLTSTSEAVSEGHPDKIADQISDAILDEILKRDKMAKVAC
                     ETLVSQNLIIIAGEISSKAKKEINIKEIAKQTIKNIGYTNIEYGLDYKSATIIDAIGS
                     QSIDITNAVEKKDTNDIGAGDQGIIFGYACNETKNFLPIAYELSNLILQKASKLRKSG
                     QIKWLRPDAKSQVTIEYDSNKNPIRVNNIVVSHQHDPGIPQDFLRQTIIEKIIKPILQ
                     SKSMLDENIKYYINPSGNFVIGGPTGDTGLTGRKIIADSYGGFARHGGGAYSGKDATK
                     VDRSAAYMARYIAKNMVAAGISKEFEMQLAYAIGIPNPISIKITTGINNNEYEKKILS
                     FIINNFDLTPNGIIKKLKLREPIYSKTCTYGHFGKNELEWEKLDFVDTIKKEFKI"
     gene            388274..388747
                     /locus_tag="BT0_RS01825"
                     /old_locus_tag="BT0377"
     CDS             388274..388747
                     /locus_tag="BT0_RS01825"
                     /old_locus_tag="BT0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="S-ribosylhomocysteinase"
                     /protein_id="WP_041178463.1"
                     /db_xref="GI:752506598"
                     /translation="MNKIPSFTIDHTKLKPGIYVSRKDIFDNLTFTTVDIRMKAPNRE
                     PVINNAEMHTIEHIGATLLRNNKVWGDKVLYFGPMGCRTGFYLILLGNYESKDLIDLI
                     SWLFHEIANFQGNIIGATEKECGNYQDHNLNMAKYESNRYLAILANIKEENLTYP"
     gene            complement(388890..389321)
                     /locus_tag="BT0_RS01830"
                     /old_locus_tag="BT0379"
     CDS             complement(388890..389321)
                     /locus_tag="BT0_RS01830"
                     /old_locus_tag="BT0379"
                     /EC_number="3.6.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HIT family hydrolase"
                     /protein_id="WP_011772328.1"
                     /db_xref="GI:500096321"
                     /translation="METILSGCIFCKIVKNEMSCYKVYENELVLAFLDINPLNVGHTL
                     VIPKQHSNDALGMSDELNGQILKVCKKVALSLKKLGSNICNGINIYSAIGSDAGQVIF
                     HTHFHVVPRFKGDNFGFTRGSNIELSGDEFLDLSKHISQNI"
     gene            complement(389372..390733)
                     /locus_tag="BT0_RS01835"
                     /old_locus_tag="BT0380"
     CDS             complement(389372..390733)
                     /locus_tag="BT0_RS01835"
                     /old_locus_tag="BT0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium transporter"
                     /protein_id="WP_011772329.1"
                     /db_xref="GI:500096322"
                     /translation="MIDVVFLRTLLEEKKYSDIKEELLKYDAFDISEALKKLNGSDLI
                     LLYRFLPKKVAVEAFSNFDQGTKNKLANSFTNREIREMIDELNLDDVIDLLEEVPANV
                     VQRFLASSTEENREIINKFLSYSDDSAGSIVTIEYIELKDYFCVGEALDYIRRVAKTK
                     EDIYTYYITDEEKRLKGVIKIEDLMLSGDDVIISAIMRTSGFYIVKVGDEKEDVALLF
                     QNHDISSVPVVDNEGRMIGVIIIDDILEVIQNLNTEDFQIMAAVTPLGKSYLDTSIFD
                     MTKNRIIWLLILMISSTLTATIITNYQHLVLSLVILTSFIPLLMDTSGNAGSQASALI
                     IRELALGTLKVKDFFKVLLKEVCVSILVGSILAGINFLRIVFFVIPEHNEKFKIAFVV
                     SACLMIGLMVAKILGGLLPILAKFIRIDPALMAGPLITTIADVVTLIAYFNIARLVLT
                     NYF"
     gene            complement(390788..392212)
                     /locus_tag="BT0_RS01840"
                     /old_locus_tag="BT0381"
     CDS             complement(390788..392212)
                     /locus_tag="BT0_RS01840"
                     /old_locus_tag="BT0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178464.1"
                     /db_xref="GI:752506599"
                     /translation="MNKSVFPKIYYYDQDFIDIYNKSLSWIRDKIVFPQALERGRKDK
                     NYYSENLEFIDQLQACLSSFFLVYSNGEYSPTSTIDKFYELQEASGAIRARYDRNNNI
                     VHIEGNDDGIGLPIFAWVEYNLYHKTGNKKRICDVLPVLDKYYKWIEKKFLKANGLYS
                     IDMNKIFYKNSPRNDAYYPIDFNSLQVHSAYCIAKLADILNDKNLSLEYKKRFFSLKA
                     KINSLMWDEKDGFYYDLDINENIVRCKTIVGFLPLLSEIPSEDRIERMIFYLKSHEHF
                     GTPNPFPTLSANDPSFNLDGNGYYGSVYTYMNFFVIKGLEYCRRSNIAREFTIRHLYY
                     ILDTLLPDGKVKGHVWEAYKPMKEGPAYLDVEKKILPEKDVICYLALFSISLMIENII
                     GLTISLPDKTVYWNIPALEVMGIESLSLKKNQTTIICNKGKRGWEIKMESEKLYYFTI
                     NILNKKEKTLPIPSGRCSMLLDKL"
     gene            complement(392490..393476)
                     /locus_tag="BT0_RS01845"
                     /old_locus_tag="BT0382"
     CDS             complement(392490..393476)
                     /locus_tag="BT0_RS01845"
                     /old_locus_tag="BT0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178465.1"
                     /db_xref="GI:752506600"
                     /translation="MLCCSCFNSKVNGNLAKIAVLVDGVFDDKTFNKGAWDGAKKVEK
                     EFGLEIVMKESNSNSYLADLESLKNNGSNFIWLIGYKLSDSAIIVALKNPEIKYVIID
                     PVYDSDLVIPENLSAITFRNEEGAFLVGYIAAKISKTGKIGFLGGVDNVIVNAFRYGY
                     EAGAMYANRNINIDNKYIGSFVNINTGRNMANEMYVDKVDIIYHVAGLAGLGVIEAAH
                     NFGDESYVIGVDQDQSHLAPDSVITSSIKDIGRILNIIISNYLKINAFEGGRILNYGL
                     REGFLDFVKNPKMISFKLEKELDDISEKIINRKIVVPNNESTYNKFLKEFVN"
     gene            complement(393540..394610)
                     /locus_tag="BT0_RS01850"
                     /old_locus_tag="BT0383"
     CDS             complement(393540..394610)
                     /locus_tag="BT0_RS01850"
                     /old_locus_tag="BT0383"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772332.1"
                     /db_xref="GI:500096325"
                     /translation="MSNNLCFIILFILLFVSCFSSKESSSFVDRQIIMGIMFPGNFDD
                     KGYFQNAFEGAVKITNEFEIKLLPKVLTPYPVEGKRLMTASEVLEEDVYTLQKDGANL
                     IWFISAHFSDSALRLAHENTNTSYGIIDSFGYDDNILIPKNFLAINFKAEEGAFLAGY
                     LAAKMSKSNRIGFMTGVNIKYVERFLVGFRAGAFYAEPKTRMIVKRVLDEFSEASGKS
                     VAEHMYIEDGVDVIFPVMGPAALGVFSAAKKLGAGHYVIGINKDQSSLAPGHVITSVL
                     KDVGKTIYNFSLDAIKKHKFNGGRIIEEGVKEGVIDIVKDPNIIGNNLFDTMTKIQTE
                     IVNGQLIIPSTEHEFDLFKARL"
     gene            complement(394772..395803)
                     /locus_tag="BT0_RS01855"
                     /old_locus_tag="BT0384"
     CDS             complement(394772..395803)
                     /locus_tag="BT0_RS01855"
                     /old_locus_tag="BT0384"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772333.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178466.1"
                     /db_xref="GI:752506601"
                     /translation="MNKFVMFIFVVLTFLGCDKKSLTSKSLAKPIISLIVDGTFDDKS
                     FGEDAWKGSQMLEGGFGVEIIGKASTSTAYASDLEDLKDKGSSIIWGVGFRLQEATEQ
                     AATLNKDVNYGMIDVTYEDDINLPDNFLGLSFKVEEASFLAGYLAAKTSKTGKIGFLG
                     GMEGVVINAFRYGYEAGAKYANKDIELNSQYLESFVDLSLARTIALKMYEDGTDVIFV
                     AAGLAGLGAIEVAKELGAGYYIVGVDQDQSYLAPDNVLTSVVKNVGNSIYEITKNYLN
                     TNDFDGGKVLKLGLKNGSVSIVKHDSIKDDIKVEIETIEDKIVSGDISVPSNLDEYNK
                     FLDIYNLLN"
     gene            complement(395846..396859)
                     /locus_tag="BT0_RS01860"
                     /old_locus_tag="BT0385"
     CDS             complement(395846..396859)
                     /locus_tag="BT0_RS01860"
                     /old_locus_tag="BT0385"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178467.1"
                     /db_xref="GI:752506602"
                     /translation="MLKKVFLFFFILGCSGSRDQTSLSDTISVIVDGTFDDRGFNESS
                     SNAMAQIKEEFKVNIIRKESKVSDYLADIGILEEGGSSLIWGVGFKFTDTFLRKSLEN
                     ANVHYGIIEGAYSEDVELPKNLVNVNFRSEEGAFLVGYLAANASKTGKIGFLGGMEGV
                     VINAFRYGYEAGAKYANKNIELNSQYVGTFSDLSLGHLMASKMYASGVDIIFTAAGLS
                     GLGAIEVAKELGNGHYIIGVDQDQSYLAPDNVLLSYVKRVDLVMLDLMRSYLDFGKWN
                     GGDNLEFGLKDGALDLILNKSISLDLIKDYDFLSEIKNKIVGNEIKVPKDEKSYGDFV
                     VNL"
     gene            complement(396934..397407)
                     /locus_tag="BT0_RS01865"
                     /old_locus_tag="BT0386"
     CDS             complement(396934..397407)
                     /locus_tag="BT0_RS01865"
                     /old_locus_tag="BT0386"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZH4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S7"
                     /protein_id="WP_011772335.1"
                     /db_xref="GI:500096328"
                     /translation="MSRKSKKIKKKVFKDSKYDSQVIAKFVNRMMYDGKKSISEAIVY
                     NSIDLLAEKTEEVDKVAAFSKALDNVKPLVEVRSRRVGGATYQVPVEVREERREALAM
                     KWIIAAARKASGKSMQEKLGNELVNSYNSTGVAFKKREDTHRMAEANRAFTHYRW"
     gene            complement(397422..397796)
                     /locus_tag="BT0_RS01870"
                     /old_locus_tag="BT0387"
     CDS             complement(397422..397796)
                     /locus_tag="BT0_RS01870"
                     /old_locus_tag="BT0387"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RLU7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S12"
                     /protein_id="WP_011772336.1"
                     /db_xref="GI:500096329"
                     /translation="MPTINQLIRKPRKSQKEKTASPALQNCPQRRGICTRVMTVTPKK
                     PNSALRKVARVRLSNGFEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIIRGAK
                     DTLGVNNRKQGRSKYGTKKPKA"
     gene            complement(397859..401992)
                     /locus_tag="BT0_RS01875"
                     /old_locus_tag="BT0388"
     CDS             complement(397859..401992)
                     /locus_tag="BT0_RS01875"
                     /old_locus_tag="BT0388"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZH6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="WP_011772337.1"
                     /db_xref="GI:500096330"
                     /translation="MKEIKDFEKIRIKIASPDQIRSWSYGEVKKSETINYRTLRPEKD
                     GLFCERIFGTTKEWECYCGKFKSIRYKGIICDRCNVEVTHFKVRRERMGHIELSAPVA
                     HIWYYKYIPSRIGLLLDITASNLNSILYYEKYIVIEPGDTDLKKMQLLNEDEYSEAKE
                     RYGMSFSASMGAEAIKTLLENLDLDELSSKLRLQMIDKDDKTDKKLLRRLEIIENFKV
                     SGNKPEWMIMDVLPVIPPEIRPMVQLDGGRFATSDLNDLYRRVINRNNRLRKLLLLNA
                     PEIIVRNEKRMLQESVDSLFDNSHKRKVVKGTSNRPLKSLSDALKGKQGRFRQNLLGK
                     RVDYSGRSVIVVGPELKLHQCGIPAKMALELFKPFVIRKLIESESVFNIKRAKSLIEQ
                     EVDEVWQILDNVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGKAIKLHPLVCHAYNADF
                     DGDQMAVHVPLTPAAQAESWALMLSTNNLLNPANGHPIVFPSQDIVLGLYYLTMERKN
                     VVGEGRKFSNFNHVLLAINNKSLDYNARIYVKVDGEYIETTAGCVVFNEALPGKISFV
                     NKTLSDYELQNLISEVYVVYGSSIVIEMLDIIKELGFKYATKFGCTISMSDIIVPEEK
                     KVYVDKANREIAKIQNDYTKGVITGEERYNNVVSVWSKTNEELTNKMMEILKKDRDGF
                     NVIYMMADSGARGSRNQIRQLAGMRGLMAKTSGDIIELPIISNFKEGLSVIEFFISTN
                     GARKGLADTALKTADAGYLTRRLVDIAQDVVVRIEDCGTINGIKVEALKNGEEIVEPL
                     REKAVGSYSIERIKSPITGEIILDVNEEITEDKIKLLETVGIDKLVIRSVLTCEAEHG
                     VCQKCYGRDFSNNKPVNIGEAVGIIAAQSIGQPGTQLTMRTFHIGGVAQAGSEDDKIA
                     LKNSFILNGLEGFNVQVDGGLLFTRKGTLRVINVIYEEDIKDIKEFKVLDSQKVIKGM
                     PLFTSKDGIDVLSSHIGYVRIKDNKLMIVSEEQEISLKTGTKLEVNVGDYVEAGRVIG
                     TFDPFAEPIIAEVRGKVKFKDIILGTTLKEEINLETGNIEKRITDQVFESLDPRILII
                     NDRGIEIASYVLPGDAYLQVEDGQDIDIGDIIAKLSKGSEKTQDITGGLPRVNDLFET
                     RIPKNLTEMAKVSGVVQFKAIQKGKRLINVLDEYGVEHKHYIPAGKHLLVRDGDVVKA
                     GDMLCDGRINPHDVLEILGGISLQEFLLAEIQDVYRKQGVSINDKHIGVIIKQMMKKV
                     KIVSVGDTNFVYNQKVDKHTFYEQNKRVIEQGGEPAVASPILIGITKASLNIDSFISA
                     ASFQETTKVLTDASIAGSVDDLKGLKENVVIGHLIPTGTGMNLYKRVKVRENSSSEM"
     gene            complement(402007..405474)
                     /locus_tag="BT0_RS01880"
                     /old_locus_tag="BT0389"
     CDS             complement(402007..405474)
                     /locus_tag="BT0_RS01880"
                     /old_locus_tag="BT0389"
                     /EC_number="2.7.7.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RRJ7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="WP_011772338.1"
                     /db_xref="GI:500096331"
                     /translation="MIKRVHLGQGKAEEILDLPNLIEIQLNSYEKFLQLDRLKNNKPL
                     LNEGLESVFRDVFPMKSSNGEVALEYEKYYVEYDSLSFTEKECKRKGQSYEAVLKIRL
                     NLQFLTTGEIRQKDVYMGTIPLMTDRGTFIVNGAERVIVSQIHRSPGVVFYKEKDLYY
                     ARIIPYRGSWLEFEIDSKKDYLYVKIDRKKRILVTLFLRALGLDTREKIIETFYKIKK
                     IEVNEDTKREITGQYLAVNITIKENMTYRAGDKITLQDIEDFLQNGVKEIDLIDFDGY
                     DSVPGKHFISSDVILNCFEKEDAYFSLKDGFKELSRESVMLAVYSVLLPGEPISIDNA
                     ENDLRTVFFSEKRYDLGHVGRYKLSKKFGLNDLTTSVLTMTDIVNTISHLLRIYDGHD
                     VLDDIDHLGNRRVRSVGELLTNIYKGAMSRVEKIAKDRMSNKEVFNLKPQELISVKPI
                     VSAVKEFFATSQLSQFMDQVNPLAELTHKRRLNALGPGGLSRDRAGFEVRDVHYTHYG
                     RMCPIETPEGPNIGLIVSLATYAKVNDYGFLETPYRKVINGKVTDEIEYLSAIDEEKK
                     CIAQANAAVNAESNYIDDLISVRVSGDYTTMIPKNIDYMDVSPRQLISVSSALIPFLE
                     HNDANRALMGSNMQRQAVPLLFPQPPIVGTGMERIVAKDSGVVIKAKRSGTVVLATSK
                     RIVIRPDNADDEHDLDEYELAKYERTNQDTSFNHSVLIKEGQVVNKGEIIADGPATRY
                     GELALGNNLLVGFIPWNGFNYEDAILISERIVKEDLYTSIHIKEFSIEVRETKLGPEK
                     VTADIPNVSGKILNKLDENGIVRIGTYVKPGDILIGKVTPKSEGDITPEFKLLTSIFG
                     EKAKDVKNNSLKVPHGTEGTVIDVQRITKNDVGNLPPGVDEILKVYVAKKRRLKEGDK
                     MAGRHGNKGVVAKILPVEDMPYLADGTPLDICLNPLGVPSRMNIGQLMESQLGLAGKY
                     LSEYYDVPVFESATNECIQEKLKKAGFNETSKAILYDGYTGEPFENEVMVGIIYMLKL
                     HHLVDDKMHARSTGPYSLVSQQPLGGKAQFGGQRLGEMEVWALEAYGAAYTLQELLTV
                     KSDDMSGRVKIYENIVKGIPTNVSGIPESFNVLMQELRGLGFDLSIYDDNGNQIPLTE
                     KEEELINKT"
     gene            complement(405560..405931)
                     /gene="rplL"
                     /locus_tag="BT0_RS01885"
                     /old_locus_tag="BT0390"
     CDS             complement(405560..405931)
                     /gene="rplL"
                     /locus_tag="BT0_RS01885"
                     /old_locus_tag="BT0390"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RLV0.1"
                     /note="present in two forms; L12 is normal, while L7 is
                     aminoacylated at the N-terminal serine; the only multicopy
                     ribosomal protein; 4:1 ratio of L7/L12 per ribosome; two
                     L12 dimers bind L10; critically important for translation
                     efficiency and fidelity; stimulates GTPase activity of
                     translation factors; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="WP_011772339.1"
                     /db_xref="GI:500096332"
                     /translation="MALSKEDILTWLEEAKTSEVVELITAIEEKFGVTAAAVAVAAGS
                     GPASVDAEEQTEFDVMLMSFGDSKINVIKEVRAVTGLGLGEAKALVEAAPKAIKEGVS
                     KADAEDIKKKLEAVGAKVEIK"
     gene            complement(406008..406505)
                     /locus_tag="BT0_RS01890"
                     /old_locus_tag="BT0391"
     CDS             complement(406008..406505)
                     /locus_tag="BT0_RS01890"
                     /old_locus_tag="BT0391"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZH9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="WP_011772340.1"
                     /db_xref="GI:500096333"
                     /translation="MHAKINPKKVEMFNLLKEFLDGKDSVFFLDYRGLTVATLTELRN
                     RVENEKGELKVVKNNIMKRVLKDKHMEGLDSYLLGPTAVVTAVDEANVIAKIFYEFVK
                     TSSLKVKGGFVLGEVYDEAKLNAYSKLPTKKESISLFMNVLKAPISKLARTLKALSDV
                     KDVKV"
     gene            complement(406516..407190)
                     /locus_tag="BT0_RS01895"
                     /old_locus_tag="BT0392"
     CDS             complement(406516..407190)
                     /locus_tag="BT0_RS01895"
                     /old_locus_tag="BT0392"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZI0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="WP_011772341.1"
                     /db_xref="GI:500096334"
                     /translation="MAKSGKKYIQALSKVDKLKSYSIDDAISLLKEIKFVKFDETIDV
                     SVNLNLKKNHTVRDTVVLPNQFMREKRILVFAKGDKAEEAREAGAVYVGDDDLINKVK
                     GGFSDFDVVVATPDMMKDVGKLGPILGKRGLMPNPKTQTITNDLKGTIASLKKGRTEF
                     RANKNGVINFSVGKSSMDNNKVKENYDEFIKELLKRRPSDLKGTFVDSVYMSSTMGPS
                     VKIDFV"
     gene            complement(407190..407624)
                     /locus_tag="BT0_RS01900"
                     /old_locus_tag="BT0393"
     CDS             complement(407190..407624)
                     /locus_tag="BT0_RS01900"
                     /old_locus_tag="BT0393"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="WP_011772342.1"
                     /db_xref="GI:500096335"
                     /translation="MSKKKREIAWVKLQVPAAQAAPGAKIGQALGPHGVSGPQFVKEF
                     NERTAKMEPGIIVPVIITVYADKSFSFIVKTPPASVLIKKAVGIETGSKKSNTEKVGT
                     ISKEKVMEIARVKMPDLNAKTELAAFKIIAGSARSMGVEVEK"
     gene            complement(407678..408232)
                     /locus_tag="BT0_RS01905"
                     /old_locus_tag="BT0394"
     CDS             complement(407678..408232)
                     /locus_tag="BT0_RS01905"
                     /old_locus_tag="BT0394"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription termination/antitermination factor
                     NusG"
                     /protein_id="WP_011772343.1"
                     /db_xref="GI:500096336"
                     /translation="MSRAWYVLQTFSQYERKVEQEIKLLISEGVFGSNVLDVKAPIER
                     VEEIKNGKKRIRERRIWPGYILIELDLPEQEWKSTVANIIKIPGVVNFVGTNKEQKPF
                     PISDEEVKSVFMLAGEIKADKSIFILYDFEEGERVRIKGGPFDSFEGVIGSIDYEKKK
                     LKVAVQIFGRSTPVEVDFQHIEKV"
     gene            complement(408242..408412)
                     /locus_tag="BT0_RS01910"
                     /old_locus_tag="BT0395"
     CDS             complement(408242..408412)
                     /locus_tag="BT0_RS01910"
                     /old_locus_tag="BT0395"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="WP_011772344.1"
                     /db_xref="GI:500096337"
                     /translation="MFKFVKESVLELKKITWPKYGEVIGSGKQVFWLVVFISIFLGIV
                     DYIMYLAITYVF"
     gene            complement(408443..408514)
                     /locus_tag="BT0_RS01915"
                     /old_locus_tag="BTT0006"
     tRNA            complement(408443..408514)
                     /locus_tag="BT0_RS01915"
                     /old_locus_tag="BTT0006"
                     /product="tRNA-Trp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(408480..408482),aa:Trp,seq:cca)
     gene            complement(408525..408704)
                     /locus_tag="BT0_RS01920"
                     /old_locus_tag="BT0396"
     CDS             complement(408525..408704)
                     /locus_tag="BT0_RS01920"
                     /old_locus_tag="BT0396"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O51357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="WP_011772345.1"
                     /db_xref="GI:500096338"
                     /translation="MGKKKGKGAVELIALVCEETGIRNYTTTKNRRNKQEKLELMKYC
                     PILRKHTLHKEGKIK"
     gene            complement(408727..408799)
                     /locus_tag="BT0_RS01925"
                     /old_locus_tag="BTT0007"
     tRNA            complement(408727..408799)
                     /locus_tag="BT0_RS01925"
                     /old_locus_tag="BTT0007"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(408764..408766),aa:Thr,seq:ggt)
     gene            complement(408885..409736)
                     /locus_tag="BT0_RS01930"
                     /old_locus_tag="BT0397"
     CDS             complement(408885..409736)
                     /locus_tag="BT0_RS01930"
                     /old_locus_tag="BT0397"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178468.1"
                     /db_xref="GI:752506603"
                     /translation="MNLLSRLLSFLFLFYSNVSIVNDSLSKSSIKRTIDWDTKIIYFD
                     IIKPVDEDKFGRVGLDSTSRLVFSVNDFKDTLIRQSLFEMIIDSDNTFKDYFDSDPHL
                     ILYFSGLDSILKRGYTKYSEDLKSITVRYELCLFPDFVNLFIAHSKPYMAFYPLMDTS
                     VDQFVYTGIIIYAGDDYQFSSGGVVKLTDAFFIRIYDEDIKLYFDKKMVEPDALRKWG
                     MLEYTNDISYKNKDRVGNYPLRLIAKGVYGKNHSDIILDKYSINKIFSNKNNVNLLRQ
                     GKLVIIK"
     gene            complement(409748..410770)
                     /locus_tag="BT0_RS01935"
                     /old_locus_tag="BT0398"
     CDS             complement(409748..410770)
                     /locus_tag="BT0_RS01935"
                     /old_locus_tag="BT0398"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772347.1"
                     /db_xref="GI:500096340"
                     /translation="MKLLIQAFGLMLVFSCCKIKQSEIQSLVSLLEESSKKGLDRFLI
                     VDRIVDIHMRNKDYQDALRSVNQEIAHYESREYYPLYFYLMGNIYSSIKEDLVAFTYY
                     RYVVDNFDDYIYENSSVKLDIAKRVINLNIEAGHKIRYYKLLLDDHAESLTNSDRGNY
                     YYNLALSLESIQNYDEAYFYYNKLLSIPRSDLRIDSIDYSGVITKVNYYNNPDFIIYR
                     NLNDLIQDVKRYIFSGNTTKLLSIRDKHNFFIQSWDQRGGKSNSINTNSFLTTMIKLG
                     SRRKNGIQFASSFEADSSDDISYLGSSGWEHIWEWYFVFKKISYPKDPEINNGWAWIG
                     VYLGKK"
     gene            410795..412153
                     /locus_tag="BT0_RS01940"
                     /old_locus_tag="BT0398A"
     CDS             410795..412153
                     /locus_tag="BT0_RS01940"
                     /old_locus_tag="BT0398A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772348.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772348.1"
                     /db_xref="GI:500096341"
                     /translation="MYNKTYLRVNKNYQDFNMNKKLIYILLLILFLSCFNKNNKYGIV
                     LDSKNREKLPNGSLVKIEDANQEKKTVTINYNGIKFIVHKFTIEEFQTKKEAENFKLS
                     IQPYVNKYAISKKDLLPLRTSPDSYRENIIYRISKESILKIIHIGKDTEVGSLKGKWL
                     YVLTKDGHKGYVFDYALEVFDNITGTILTNPLDQVSQNDIINTFNNIKYLRPLYYEKM
                     IAYNTYNTNLLREEYGLFFTPKNEIIINIPELSLHFKFDIVEEVKPNGFLFRSKTSEE
                     DFILLTKETQNYYKSIIKVKEHNFESKFVIIEQNVEKIILESKKQNQNLINRLISYGT
                     LINTQYGNIEFKSDQTFIWKVDKKIYNFPSSGTFEIIGLSPNLQISYKKAIKLMTKER
                     EKYFCLLDYTDNALQLIFISPKNVKDDLIIIDDKDKIAVILFNNAQSNQEIIKQQSQK
                     TI"
     gene            412166..412822
                     /locus_tag="BT0_RS01945"
                     /old_locus_tag="BT0399"
     CDS             412166..412822
                     /locus_tag="BT0_RS01945"
                     /old_locus_tag="BT0399"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ankyrin"
                     /protein_id="WP_011772349.1"
                     /db_xref="GI:500096342"
                     /translation="MKIIFILLLTQFITFLNANENTKIIKELSKTIYNLSNKEYEIDK
                     AKLDSFIESIDLNNTNILKELQKIKNDFLITSVYFQNIKGTLIALNLSAEINFQYKIS
                     PLSISIINNDFQTTKTLIDYGIKINQIDETEYPSIFWAIYLNNEKIFNLLKEKGADLS
                     LALKNGKTPIQAAIEIENINLIELLLKKNAYIKDKYKKEIKNLKNKNIKDILKKYKVI
                     "
     gene            complement(412834..413109)
                     /locus_tag="BT0_RS01950"
     CDS             complement(412834..413109)
                     /locus_tag="BT0_RS01950"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178469.1"
                     /db_xref="GI:752506604"
                     /translation="MYKYPELVNTDLNLKLPEINSLEENDKNFFLDDYFLWLDKESKV
                     IQKIEKMVCGIMWRNALFYKDLKEEFSKKSFAYKEFFDKDKNIKMSS"
     gene            413248..414438
                     /locus_tag="BT0_RS01955"
                     /old_locus_tag="BT0401"
     CDS             413248..414438
                     /locus_tag="BT0_RS01955"
                     /old_locus_tag="BT0401"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate transporter"
                     /protein_id="WP_011772350.1"
                     /db_xref="GI:500096343"
                     /translation="MNTKVKFSLIIPIGILLGLFFPSGAYNILSHIFIRLGYLSLIPF
                     LIFSIPLGIENIIENKKFRKLFGKTIYYGILVNIMGIIISIVIATIYLPQRIPILDKN
                     IQNTYTFDQKVFLETFFPKNIFIIFTNNNPNLLSIYIVSIIIGASLYYAKQKGRIARE
                     LILSFSNLFYHANGIVVKILHFGIIFITAAYTTNLKNFKNYQYYIDSIIFLSLWTITI
                     ILIIIPMISYRLTKNFKLSYKNILISIQNIIFAGLTMDAYAPYSILIEDIKNERINIK
                     KSIITNIPIINFISKSGTIFIATISFFIILKSYSSLPISIYEISYMSILAFLFIFAFP
                     HIPNSLIYIITMLCSTYTKGIELSHSNIIPILPILTSLALMIDFTSNIAIIQIIDFNE
                     LKDT"
     gene            complement(414465..415931)
                     /locus_tag="BT0_RS01960"
                     /old_locus_tag="BT0402"
     CDS             complement(414465..415931)
                     /locus_tag="BT0_RS01960"
                     /old_locus_tag="BT0402"
                     /EC_number="6.1.1.15"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772351.1"
                     /note="catalyzes the formation of prolyl-tRNA(Pro) from
                     proline and tRNA(Pro); Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline--tRNA ligase"
                     /protein_id="WP_041178470.1"
                     /db_xref="GI:752506605"
                     /translation="MGNFISSKEEEFSKWYLDIVQKAKLVDYSPIKGCMVIMPYGYAI
                     WEQIKSILDNKFKETGHENAYFPLLIPYEFLEREKEHVKGFSPELAVITTAGGEELAE
                     PLVLRPTSETIIWNMYSKWIKSYRDLPVKINQWANIVRWEKRTRPFLRTTEFLWQEGH
                     TAHETAGEALEETLFILNLYKRFIEDYLAIPVFCGQKTEREKFAGAVSTYTIEALMQD
                     KKALQAGTSHYLGLNFAKAFDVKFQNKKGEMDYVFATSWGVSTRLIGALIMVHSDSKG
                     LILPPKIAPIEIIIVPIFKRDDEVNKKIIEYATTIFNILKEAKFRVELDRDIKNSPGF
                     RFAAVELKGIPIRIEVGSNDILMDCVTVARRDQDKNSKYQVSVKELPSKMRHELETMQ
                     CELFNRALKFRNLHTKEIIGFKENDYDTFKTYINEHLGFVLSSWCGNEVCEESIKNDT
                     KATIRCIPEDFQNRSLNNLTCIYCNTTAKHLVLFARSY"
     gene            416518..417117
                     /locus_tag="BT0_RS01965"
                     /old_locus_tag="BT0405"
     CDS             416518..417117
                     /locus_tag="BT0_RS01965"
                     /old_locus_tag="BT0405"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772352.1"
                     /db_xref="GI:500096345"
                     /translation="MKTLLKLIMVFLTSLSVATTINTSNLNKILNKQQTQFRSFGIGF
                     GIGNPITNIIINFPYVDIDIGYGGFNGLHPNNFIPYIVFGTDILFKEEIYQSIMLTGG
                     LGIGIDLSQIKPDEQNSSNIKQENTQDKQEEFSIASSNNRLGIVFRLPIILEYSFLTN
                     VVIGFKAITTIGGTMIFQPTSMEGIRFGFFGFGFIKIYI"
     gene            417128..417955
                     /locus_tag="BT0_RS01970"
                     /old_locus_tag="BT0406"
     CDS             417128..417955
                     /locus_tag="BT0_RS01970"
                     /old_locus_tag="BT0406"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772353.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178471.1"
                     /db_xref="GI:752506606"
                     /translation="MKNNTQKIFILLLIFNLHHFAFSKSNNNYSIRCKQEDDGTTCIT
                     NDKPIIEEPKLTLEEPKLTLEEPKPIIEEPKPIIEEPKLTLEEPKPISEEPKLILEEP
                     KPIFEEPKPQIITNFHAIHREKNPYSFAAGIGTGNPLINLLISVPYVDIDIGYGSFLY
                     FNPTNFKPYNLIAIDLIFKQQIGEYLIVGGGVGIGTDWSQANLTSLGTTQPSPYDRIG
                     IVTRLPLSIEHKIIKNLSLGFKVYPTLGPTIFLTKPKIVFEGIRFKFFAIGFIRVFM"
     gene            complement(417995..419110)
                     /locus_tag="BT0_RS01975"
                     /old_locus_tag="BT0407"
     CDS             complement(417995..419110)
                     /locus_tag="BT0_RS01975"
                     /old_locus_tag="BT0407"
                     /EC_number="5.3.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-6-phosphate isomerase"
                     /protein_id="WP_011772354.1"
                     /db_xref="GI:500096347"
                     /translation="MRSDNIFLMKNKIKEYDWGGTSFIPSLLGQREDGLPKAEMWLGA
                     HKTFSSKILVDGQYVFLCDFLENHKELLGCESELSFLLKVLSAQKPLSIQIHPSKDIA
                     LKGFELENDKGIDINDSKRIYKDKNPKIELVYALSDFYALKGFLPIFEIKSIYKKLKL
                     DFHFATHKEFIKIIFSLQKFEIEDAISRVKKNLSFINDFRAYWFNEIYEIYGADIGLL
                     VFLGMYIFKLSPGEVLYTESQEVHAYLQGDCLELMTNSDNVIRAGLTTKYIDKDEMLK
                     VGRFEEGVFSLLRGKEIDGFNVFKLPDTNLSLFQRNINEKICFKKDGVMILLVMNGEI
                     QINNGVCLKRGESVFIGNYDEKLLICGNGEIFIALSL"
     gene            complement(419107..420111)
                     /locus_tag="BT0_RS01980"
     CDS             complement(419107..420111)
                     /locus_tag="BT0_RS01980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015055544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system fructose-like transporter subunit
                     EIIC"
                     /protein_id="WP_041178571.1"
                     /db_xref="GI:752506706"
                     /translation="MSGVSPMIPIVASGGILIALGISLAGIGSDGPNFDKYPFYKTIT
                     DIGGVAFGMMLPILSGFIAMAIADKPGLAPGLVGGVLARDVKAGFLGAILVGFMAGFV
                     AKWIAKRKIPEWLRPVMPIFVIPLISTVIVGFFMIYVGVYIGQFMALLENGLKSLQNN
                     SETYGIIGKLFLGLILGAMVAIDMGGPFNKVAFLFGVGMIPQVPQIMGMVASAIPVPP
                     MAMGLATLIMPKLFEEEERESGKISFLISFIGISEGAIPFAASDPARVLPSIVLGGAV
                     ASIIAAFLGVADHAPHGGPIVLPVVDNKLGFIIAIAVGVVVATSLVIFLKSLKVKESK
                     "
     gene            421091..421738
                     /locus_tag="BT0_RS01985"
                     /old_locus_tag="BT0409"
     CDS             421091..421738
                     /locus_tag="BT0_RS01985"
                     /old_locus_tag="BT0409"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178472.1"
                     /db_xref="GI:752506607"
                     /translation="MKKLIEFCFLLLCASLYSSNNEGHKKNEINNKKSILLKEKSTNH
                     ENDFFSVKRGFIYSTGTGLGTGFFLNSKVNHIIFRPYYIFAINNFDFLVVCMILMIKE
                     YNISKKVKYSSSYIGTGINWHIINLSKKMKYLSSTTGIGGRLYLSTNLIGDFKFYDKL
                     PYVIEPYIFFEFSTKKATPYLNIYSKIECLFLDTFNISFDFGIRYNLKNSNEVNS"
     gene            421735..422616
                     /locus_tag="BT0_RS01990"
                     /old_locus_tag="BT0411"
     CDS             421735..422616
                     /locus_tag="BT0_RS01990"
                     /old_locus_tag="BT0411"
                     /EC_number="3.1.30.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease"
                     /protein_id="WP_011772357.1"
                     /db_xref="GI:500096350"
                     /translation="MNKRLKILFCFYILILLGFLFLYQNPKILNNIKEIAYNYLSKLK
                     DKIYEPEISTELKEEYLLPKGYLTTQIIHKKYYSLGYAESARQSEWVAYQLKREMVEL
                     ALTLLREKKITRSKNFFEDQDIKGIAPKLSDYLKSGYDRGHIVSSADMSFSKDAMLDT
                     YFLSNISPQQREFNSGIWLKLEQLVRKWAILKEKIYIVSAGILTENKGFIGKNKILVP
                     KNFYKIVLSLNNNNFYDILAFIIPNEKAQDLELRNYVVNVNLIEEKTKINFFAKLDAE
                     IKKIIKMKKDVRSWKFR"
     gene            complement(423381..423977)
                     /locus_tag="BT0_RS01995"
                     /old_locus_tag="BT0413"
     CDS             complement(423381..423977)
                     /locus_tag="BT0_RS01995"
                     /old_locus_tag="BT0413"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772359.1"
                     /db_xref="GI:500096352"
                     /translation="MFDQVFYNENVKYELYRKFFHISTLVFLFFYKLNFWVGLVSSLF
                     FMFAYLILEIFRIMEINLFFLRGISEIIIKSREVSSYKISLSPIFLVVSIFCTYFLID
                     KPFSYIGIFSACLGDGLASLVGKLIPSFKLVNNKTFSGSVAVFLVAFIVCYYFFPNFI
                     IASVVGMGAVLVELFDFEKYDNLFLPLGVATLSFVLIA"
     gene            complement(423977..424996)
                     /locus_tag="BT0_RS02000"
                     /old_locus_tag="BT0413A"
     CDS             complement(423977..424996)
                     /locus_tag="BT0_RS02000"
                     /old_locus_tag="BT0413A"
                     /EC_number="5.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidylprolyl isomerase"
                     /protein_id="WP_011772360.1"
                     /db_xref="GI:500096353"
                     /translation="MKRCLLYFLLILMLITCDSKRKDLVEKKGIFALIDTNKGNIEIE
                     LYYKIAPLTVMNFIGLSEGTIKNSVTSQPYFENIIFHRVVDEFVIQTGDPTGTGTGGP
                     GYVFPDELNKNLSHNEPGIVSMANSGPDTNGSQFFITLADNLTYLDLKHSIFGKVVAG
                     MDTVRNIRQGDKIEKVRIIRVGEDAKAFKVDNEEFLKLKKSYEARKIAEVKKYMASQL
                     EIIDKDYKDFQKDESGILYKINKQGNGKNVKSGNIVKVDYEGFLLSGIKFDSSIDRGK
                     PIEFVVGSGQVIEGWDVMLSDMCEEEERVVIIPPNLAYGERSIGNVIKPNSFLKFNII
                     LRKIS"
     gene            425143..426003
                     /locus_tag="BT0_RS02005"
                     /old_locus_tag="BT0414"
     CDS             425143..426003
                     /locus_tag="BT0_RS02005"
                     /old_locus_tag="BT0414"
                     /EC_number="2.1.1.80"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheR"
                     /protein_id="WP_011772361.1"
                     /db_xref="GI:500096354"
                     /translation="MLNISNELLLKFCNFIYENSGIRFDEKNKVVLQGRINDAIHELE
                     NINTPEQLYDLINSDKFQKEYFLDLVTTNLTRFFRNEAHFATFERFIIPNLINIKTQE
                     GKNRIIIWSAGCSTGEEPYSLAFVLKHNLPKNFDFIIIASDLSLKSLMIAKEGYYSVK
                     KCEHIPIQYKIYIKPHMNGYKVIDDIKKHIRFDYHNLNFESGFSEMDVIFCRNVLIYF
                     DEKSKIRVLKKFYSSMAMKSYLFIGHSESLFGLNLPFKFLRTPWAIIYEKDDKDVPKK
                     KFQFKNKYKL"
     gene            426039..427175
                     /locus_tag="BT0_RS02010"
                     /old_locus_tag="BT0415"
     CDS             426039..427175
                     /locus_tag="BT0_RS02010"
                     /old_locus_tag="BT0415"
                     /EC_number="3.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011772362.1"
                     /db_xref="GI:500096355"
                     /translation="MQIKIYVLVIEASSVNRKTISDIINSSLKLEVIATAANTDFALK
                     KLKKHPDVILLSLEEETIKEITLIKKKENINNKLPVIILSSNKDIAKNAILKGADDFI
                     IKTDNKLESIKDKIIDLLSIYGNKTIKNKIITDINFKFKTNQYLINNKVNKENSNTTK
                     ATDKNENTNLNQEKIIDEKDLKKLKNRKFEIVVIGISTGGPAALKTILPEIPKNFPLP
                     IIIVQHMPKGFTTEFAKSLNNICNLTVKETSNKEILQKGFIYISSGGYHTRINKINEN
                     YQIEVFDAENVNGHKPSIGVLFKSISENVKDKAIALIMTGMGSDGSREIGEIKKAGGL
                     TIAQDEKSSVVFGMPKIAIEENNIDYIVSISHVVKLLKAILLDG"
     gene            427199..428407
                     /locus_tag="BT0_RS02015"
                     /old_locus_tag="BT0416"
     CDS             427199..428407
                     /locus_tag="BT0_RS02015"
                     /old_locus_tag="BT0416"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pheromone shutdown protein"
                     /protein_id="WP_011772363.1"
                     /db_xref="GI:500096356"
                     /translation="MDITKENTEDCFLHVSTLDTDHDKIYVLGTAHVSKKSSQDTATL
                     IETLKPDFIAVELDEARYHAILKTDENEKWRNLDIYKVIKQGKAFLLIVQIILSNFQK
                     KLAKEQGINPGEEMKTAILKAKEHNIPLILADRKVETTLKRAWNCVPTFEKVKIISSL
                     FSFSDVKVTQDEIEKLKEQDVLSNMMEELAKEIPTVKKVLIDERDEFIASKILEGSGT
                     ILAVVGAGHVKGIIANLKEIKENKKIVNIDNLNTIPKNTFSVSKLISYFIAISIVILM
                     ASSFYFKGFDFAYKNLEFWIICNSLFAGLAALLLRANIITIITASIGAPIFSLIPFIG
                     TGMVAGLVEAYINKPKIKDFEKLQEDLENIKGYFKNKVTKILLIVFFVNIGSAIGTIV
                     GFKFLLNIFS"
     gene            428445..429077
                     /locus_tag="BT0_RS02020"
                     /old_locus_tag="BT0417"
     CDS             428445..429077
                     /locus_tag="BT0_RS02020"
                     /old_locus_tag="BT0417"
                     /EC_number="2.7.4.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZK3.1"
                     /note="essential enzyme that recycles AMP in active cells;
                     converts ATP and AMP to two molecules of ADP; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate kinase"
                     /protein_id="WP_011772364.1"
                     /db_xref="GI:500096357"
                     /translation="MKLVFLGPPGSGKGTIAKILSGKLNYYHISTGDLFRANISNATP
                     LGKEIKQIVENGQLVPDSITIKIVEDKINTLANKDNFILDGFPRNINQAKALDTFLQN
                     IQIINFLLDEAILIKRLSGRRICQSCGGIFNIYTLPTKEKGICDLCKGSLYQRKDDVE
                     ESLKIRLQEYHLQTKPLIDFYSKNNRLNNINASKDIDGVEKSLIEIISKY"
     gene            429183..430205
                     /locus_tag="BT0_RS02025"
                     /old_locus_tag="BT0418"
     CDS             429183..430205
                     /locus_tag="BT0_RS02025"
                     /old_locus_tag="BT0418"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772365.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178572.1"
                     /db_xref="GI:752506707"
                     /translation="MIKKLFMVLIFLQTILIYSKENQDEMGYFYVNSQMAYYPSHALG
                     TSGSKFSPSFISPQFKSVSPNNQISPSSWGSIKLISNLGYYKFFKILKNPDPHSLLLQ
                     NTGIDVDFKIGLSPVVALLKGNIGFTPIAFINLYTGIEIGIGWQGFGFKGIGIHVGNG
                     RYSSKPELYSEVTMGGRLQFDLNAVFGGDWTHIITVVGNNILHIKNPHAKDNQLWKYK
                     ADEGKNINGFTINPYALLAYKMPIPLNIIGLLYEGQTYIGHARNVSTTQNQGWGSDFF
                     YHNFSLISKIEIIENLTLDMQFKFSTAPIYTVNTMGMADISKRISTNNSYIYYDSIGF
                     SLTYKI"
     gene            complement(430208..431128)
                     /locus_tag="BT0_RS02030"
                     /old_locus_tag="BT0419"
     CDS             complement(430208..431128)
                     /locus_tag="BT0_RS02030"
                     /old_locus_tag="BT0419"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="WP_041178573.1"
                     /db_xref="GI:752506708"
                     /translation="MILDNFEEISVEPQKLLLVDDTPTNLDLLIDILQHKYEIRVALN
                     GFDALKQVEIASPDLILLDVLLPDVSGYEVCKRLKNDPETKDIPVIFISSSDSTDAQL
                     EGFSVGGVDYILKPFNGRIIDARIKTHLELKRLRDYFKNLARIDGLTQIPNRRFFTDK
                     FAKSWMQALEHKKNVIVGMLDIDYFKKYNDNYGHTNGDECLRLIAKSLNKIAIKYKID
                     IARYGGEEFILFSVNKSLNEVIKIVSILIEDIRNLEIVHEYSNISNFVTVSIGLAEQI
                     PYDSNFTNIIKLADDKLYEAKISGRNQCKY"
     gene            complement(431152..435585)
                     /locus_tag="BT0_RS02035"
                     /old_locus_tag="BT0420"
     CDS             complement(431152..435585)
                     /locus_tag="BT0_RS02035"
                     /old_locus_tag="BT0420"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensory histidine kinase"
                     /protein_id="WP_011772367.1"
                     /db_xref="GI:500096360"
                     /translation="MRGLSLFLFLFFVSHVSLPAKETLKFKLVDQYYPLYYKNQENKM
                     VGMIFYLLDKWAQDNDYDISIEAIDYLNKDKIEDDVVYLGLTYNSDLNEYLYFKNEIG
                     KCVTAFIYDSEKEQKPSNLFFSNELRVGVVKNTIYEDILRFHGHNDNIFLFPDTEKLL
                     LALRGNKIDLVYGSYKSLSCVWYSSFYPSFMKVFNSEYFYSFGIRAAISKNAISQLRD
                     LNVDLLSYMQSLSREEYASFKEFDFLFKLDVGIYNDYPPFSFINSKGQFAGILVDLWN
                     TLAREYGFSVKFVGFPKESIKGSLDDKDVSVWGGIIEDDNILTSKKYKATAPICSLNF
                     NLYFTNAKNSNKVINSQVIGLSLNDIQLDKNTDIVNNFLDIVNHSYGFVENSITVNYL
                     LKLHGYNNILKLQDSSLSKGKFLVLAANNKRLQLFAYMLNALTENILFDTLLQIGKNW
                     LGQDEIEDYQNNFYGHINSGNFNIEEKIWLQNNKRLTLAVKDWYPIDYFNSGRYKGVN
                     EWLIKKIKRLTNLDFNIISVHERDIEELMKLGKIDILSANLDDANSDYIFNIKAVSGI
                     PLHLFSNKTRLFTSRSFNSIAVLKFLYTKKLETKIGTRLVQVDSFTDALDLLYRGKVS
                     GIVSDEYTATINFEDLNIRDIKKIFTVPNLTFDLNIAVHNQDYILRRIIQKILFRTNV
                     NNKLYFDDWVFNVHESFKDLRLKKSGIAVLTMGMFVFTIFMFCLFNLWKEIGFRKKMY
                     SSAISEKKVIENAIAAKTIFLASMSHDIRTPINGIIAATELLENTDLLGVQKEYVQMI
                     NYSSISLLSLIDEILYISKIDMNEIYIDNNEIDLEHEIECVLKGFQSQSAKQNIDLIF
                     YSKSDLENYLIGDRARLKRVLINLIGNSFKFTTDGIIVLNYEMIRSTEDNDGNKIITI
                     EFKVTDTGKGIKESNIPVIFGLFRQGNDSDSKKYEGSGLGLAISRKLVSLMGGPGIAV
                     ESEVGKGTTFSFMLPFVLGHKIKDKEVNKLELVTNKKILSLFLSKKTVEVLRDISKIF
                     DYKDIHYFYSYEHAYKAFYRYPYYDFVFINVDDFGLQEGLKFAEKIESLNSNVRIVFV
                     FYCLKSDEIIDFKYEYMQKPFQRWDFYSDWIKNGAIVDVPIINESNTLKLKNNVGILI
                     AEDNEINQKILKNVLIVIGVKEDSIDIVDDGVKAIEFLKTNKYDMAFIDIRMPNCDGL
                     TVSKEIRKFESQNNLNPCVLIAVTAHALREYKDRCLENGMNDYLAKPIHISSIKYILK
                     KYLHIEVEDNKIIADKTFDGFSNLPNLDINNALKDLNISYDMYVDLCRGFVNMSDNLI
                     RDLDEAFNLNNIKLVKELAHSIAGALGNMRSNLFGNFKQIEINTGSIHELKILYSEAR
                     KGLIVLIKNIREQILDVIETYDQEKLKFKSNDEFLSLMQKLLNGIEDRNPKEYKEVLE
                     VLKRYSLDDNNIILFDSLIKYLRVYNFKESANIVKRMINLR"
     gene            complement(435641..435751)
                     /locus_tag="BT0_RS02040"
                     /old_locus_tag="BT0_844"
     rRNA            complement(435641..435751)
                     /locus_tag="BT0_RS02040"
                     /old_locus_tag="BT0_844"
                     /product="5S ribosomal RNA"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            complement(435771..438711)
                     /locus_tag="BT0_RS02045"
     rRNA            complement(435771..438711)
                     /locus_tag="BT0_RS02045"
                     /product="23S ribosomal RNA"
     gene            complement(439012..439851)
                     /locus_tag="BT0_RS02050"
                     /old_locus_tag="BT0421"
     CDS             complement(439012..439851)
                     /locus_tag="BT0_RS02050"
                     /old_locus_tag="BT0421"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_011772368.1"
                     /db_xref="GI:500096361"
                     /translation="MNANYEKYKMLVFDLDGTLLNNNHEIAPLTLKVLLRLKNDFHII
                     VATGRRLYEIKDVLMQLKDLQIDESYIVTANGAEIFLKNNLILRYKINYDIVRELLKV
                     KRGDIDINLYTLNNWYSDREIRSPIMNYFIETLGIQPIITDLSELEIDSCSKIVYYSH
                     DFSKLEDFANKIRDKNFKDISIFYSANDLLEITNIDASKYNAIKSIALFECISIDAIL
                     AFGDNGNDYEMLKNAGKGILMKNANKFVKNNLSNNEVTKFNNDEDGVAKFLIEFFNLD
                     IQF"
     gene            439985..440509
                     /locus_tag="BT0_RS02055"
                     /old_locus_tag="BT0421A"
     CDS             439985..440509
                     /locus_tag="BT0_RS02055"
                     /old_locus_tag="BT0421A"
                     /EC_number="2.4.2.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772369.1"
                     /note="catalyzes the formation of inosine monophosphate
                     from hypoxanthine and 5-phospho-alpha-D-ribose
                     1-diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine phosphoribosyltransferase"
                     /protein_id="WP_011772369.1"
                     /db_xref="GI:500096362"
                     /translation="MSDKISTLFTEEKIKSKIKDLAQKIRNYYEDKNNVVFISLLKGS
                     FIFFADITREIGLNVKIDFLQASSYKNKTLSSLNVLIKKDIDINIQNSYVIIFDDIID
                     TGLTYKKIVEHLKTKNPKEIKICTLFNKPSRRLIELKIDYSGFEIENDFIVGYGIDFN
                     EQHRTLKNVAKISK"
     gene            440519..441802
                     /locus_tag="BT0_RS02060"
                     /old_locus_tag="BT0421B"
     CDS             440519..441802
                     /locus_tag="BT0_RS02060"
                     /old_locus_tag="BT0421B"
                     /EC_number="6.3.4.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZK9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthetase"
                     /protein_id="WP_011772370.1"
                     /db_xref="GI:500096363"
                     /translation="MSIYAVIGTQWGDEGKGKIIDFLSSKIDYVVRFNGGNNAGHTIV
                     VNNKKFIFNLLPSGVLQGAKCILGPGVVIDPLILIKELEALKHNNIKTEIFISDKAHI
                     IMPYHIKLDELNEQKKGVYKIGTTKRGIGPCYADKINRTGIRAVDLLDIKIFERKLKI
                     NLDEKNEIIEKIYNHKPFNYDDILSKYKKCIAILQYAITNTEEILNQAINSGKIILIE
                     GAQGTMLDIEHGTFPFVTSSNTLITATTGCGIPISKIKEKIGIVKAFSSRVGSGPFVT
                     EILGPIGDKIREKGQEYGSTTNRPRRIGWLDLLTIKKSISLNELNHLALTKLDILNNI
                     EDLKICTAYEFKGKIYDYIPTSCEILENVKPVYKVFKGFKQNIRNISHYEDLPIEAKE
                     YIEFIEREVGVQISILSLGAEREKTIFRNQKWINI"
     gene            441787..443190
                     /locus_tag="BT0_RS02065"
                     /old_locus_tag="BT0421C"
     CDS             441787..443190
                     /locus_tag="BT0_RS02065"
                     /old_locus_tag="BT0421C"
                     /EC_number="4.3.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate lyase"
                     /protein_id="WP_011772371.1"
                     /db_xref="GI:500096364"
                     /translation="MDKYINPLKSRYASKEMLYIFSPKFKYTTWRKLWYNLALVQKEL
                     GINISNKQLNKLSKHIENIDFELVKKYESKFQHEVMAHLYAYADLAGDDARKILHLGV
                     TSAYLMDNTDLVQIKEALLLIENKLLKLINTLKKFSIKHKNLVTLAYTHLQEAQLTTL
                     GKRSSLWLQSLIFDFEELKFIMSNMRFRGVKGTVGNQSSFKELFASNFEKVKDLDINL
                     AKKMGFDKVYQITSQTYDRKFDSSILNFLSNLAQSAHKITNDIRFMQHLKEIEEHFEP
                     HQIGSSAMPYKRNPIYSERIASLAKFIMSLQSSGGFIAATQWLERTLDDSACKRLNIP
                     QAFLAADATLILLSKVFNNIRVNKKMIEKHVKTEMPFILTEDILMKATKNGGDRQILH
                     EKIRIYSMKVKENIYSGTTENDLIKLILNDQSFKLTSKDIDEILNPNENIGFASYQVE
                     NFITEIIDPILEKNKEN"
     gene            complement(443187..443741)
                     /locus_tag="BT0_RS02070"
                     /old_locus_tag="BT0422"
     CDS             complement(443187..443741)
                     /locus_tag="BT0_RS02070"
                     /old_locus_tag="BT0422"
                     /EC_number="3.2.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772372.1"
                     /note="responsible for recognizing base lesions in the
                     genome and initiating base excision DNA repair; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="WP_041178473.1"
                     /db_xref="GI:752506608"
                     /translation="MDREFFMQDAVTVAKSLLGHLLVRKIGAKEIISRIVETEAYMGV
                     MDKACHAYGGRRTSRTSAMYNIGGYAYVYMIYGMYYMLNVVASNEHNPHAVLIRGVEL
                     ISPKIDGIFTNGPGKLAKFLNIDLKFNKVDLINNGELFLKRGLSFNFEVSCSKRINVD
                     YAGEEYANKLWRFYIRGNKYVSKY"
     gene            443906..443979
                     /locus_tag="BT0_RS02075"
                     /old_locus_tag="BTT0008"
     tRNA            443906..443979
                     /locus_tag="BT0_RS02075"
                     /old_locus_tag="BTT0008"
                     /product="tRNA-Ile"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:443940..443942,aa:Ile,seq:gat)
     gene            complement(444516..444590)
                     /locus_tag="BT0_RS02080"
                     /old_locus_tag="BTT0009"
     tRNA            complement(444516..444590)
                     /locus_tag="BT0_RS02080"
                     /old_locus_tag="BTT0009"
                     /product="tRNA-Ala"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(444553..444555),aa:Ala,seq:tgc)
     gene            complement(444660..446204)
                     /locus_tag="BT0_RS02085"
                     /old_locus_tag="BTR0002"
     rRNA            complement(444660..446204)
                     /locus_tag="BT0_RS02085"
                     /old_locus_tag="BTR0002"
                     /product="16S ribosomal RNA"
     gene            complement(446363..447751)
                     /locus_tag="BT0_RS02090"
                     /old_locus_tag="BT0422A"
     CDS             complement(446363..447751)
                     /locus_tag="BT0_RS02090"
                     /old_locus_tag="BT0422A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="WP_011772373.1"
                     /db_xref="GI:500096366"
                     /translation="MIKNRDKEIYKCLNCGYKSLKWLGKCPECFSWESLELYSEFKSG
                     YEGDLSKSKNEIFSLRDFKQVDNVRHLTGIEEFDRVLGAGIVIGSAILISGEPGIGKS
                     TFLLQISSILSLSDKNVLYLAGEESIPQIKLRANRLRISSDILITNEINVDSLIKMLA
                     NIELDFIVVDSIQTLHSKEVQGGLGGVAQLKHCVYKLIEWARGKNITLCLVGHITKDG
                     ILAGPKVIEHMVDSVFYFEEAEKSLRMLRATKNRFGAINEVGIFEMTGLGLVEIKDPS
                     SIFLEKKEEISSGIAIGIINEGSRVLFVEIQALVTRTGMNIPRIFSEKIDSKKISRIL
                     AVLSKYLNLSFNNDDVYVNVSGGLRMDDIEIELAVLVALFSAKTNVIINQDLIFTGEI
                     SLSGKIKASSNIESKVIAAKKAGFQHVLGANLRENYYNGYEGIESVLGVVRRLVRDSK
                     REGHGDSRLKNR"
     gene            complement(448139..448813)
                     /locus_tag="BT0_RS02095"
                     /old_locus_tag="BT0427"
     CDS             complement(448139..448813)
                     /locus_tag="BT0_RS02095"
                     /old_locus_tag="BT0427"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA methyltransferase"
                     /protein_id="WP_011772374.1"
                     /db_xref="GI:500096367"
                     /translation="MLYIVGTPIGNLGDITYRAIDILRLVDVVFAEDTRVAKRLLSHY
                     GIVKKLISCNAIIEHKRIGLLLEYLSNGKSVAFVSDAGTPCLSDPGGLLVDAAFKNGH
                     KVSPIPGVSSLNTVISVNPFKDKVVVFEGFLPNKGIKRIKRIEELYHRGDAFVLLESS
                     HRILKLLFEISLVNLDANVLVGREMTKLYEEYKIGKPLELKEYFEENNKNKGEFTVLV
                     SRKSKS"
     gene            449083..449403
                     /locus_tag="BT0_RS02100"
                     /old_locus_tag="BT0428"
     CDS             449083..449403
                     /locus_tag="BT0_RS02100"
                     /old_locus_tag="BT0428"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772375.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772375.1"
                     /db_xref="GI:500096368"
                     /translation="MFKLIKKIFIIYFLCITLTGLTMVFIDSKFSERQTIQDGKSKII
                     KHVIDPNLIMLTSAIGGFLGIYSGIWFFDHGKDNFYLSWGSLIILIYNIGLIISVYSK
                     SKNK"
     gene            complement(449413..449802)
                     /locus_tag="BT0_RS02105"
                     /old_locus_tag="BT0429"
     CDS             complement(449413..449802)
                     /locus_tag="BT0_RS02105"
                     /old_locus_tag="BT0429"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178474.1"
                     /db_xref="GI:752506609"
                     /translation="MISGLNPTLKLFKEHRILYSNMERGLKPLLEVDNFINKYIQNKE
                     GLEIYDKVVGKAAAVIIYNIGLQNVQAGVISQPAKDFLESRGIRVTFKRLVEKINDKT
                     ENLIESLENPEEVYKYLIKRGIIVSNS"
     gene            449917..450495
                     /locus_tag="BT0_RS02110"
                     /old_locus_tag="BT0430"
     CDS             449917..450495
                     /locus_tag="BT0_RS02110"
                     /old_locus_tag="BT0430"
                     /EC_number="3.4.13.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772377.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="proline dipeptidase"
                     /protein_id="WP_011772377.1"
                     /db_xref="GI:500096370"
                     /translation="MMLIPKENIYSKIEVKKSIFLSYIFHVEKKEEINKILKEYKLKF
                     KNATHVIYGFRIGNSNSFINGMNDDKEPRLTAGKPTLEAILNKNLTDTLIITVRYFGG
                     TLLGKQGLIKAYSKAAQEVINKSNLTEKKEMETLCLNLNYNQYNLLIRTKNKMEIKIT
                     DAKFLDKINTTIKFNIKDKKNIITFLQANSLL"
     gene            450687..451439
                     /locus_tag="BT0_RS02115"
                     /old_locus_tag="BT0431"
     CDS             450687..451439
                     /locus_tag="BT0_RS02115"
                     /old_locus_tag="BT0431"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobyric acid synthase CobQ"
                     /protein_id="WP_011772378.1"
                     /db_xref="GI:500096371"
                     /translation="MKIISIINQKGGVGKTTSAINIAYSITLLNKKALLIDIDSQGNT
                     SSGFNILKKEDTNSSYELIYKKQKITPIKNFNLDIIPSSLKLALLEKELIHEIARENF
                     LKNALEQYKQDDYDFIILDCPPTLSILTINALVASKYLLIPIETEFFAFEGINQLLDT
                     ITAVKQINQELEITGIFINKYDIRNKSKEKYIDYLKKVFKEKFLNTKIRKNISISKSQ
                     EENIPVYMYNKESNAAKDFLELTKEIIEKIKG"
     gene            451442..452146
                     /locus_tag="BT0_RS02120"
                     /old_locus_tag="BT0432"
     CDS             451442..452146
                     /locus_tag="BT0_RS02120"
                     /old_locus_tag="BT0432"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772379.1"
                     /db_xref="GI:500096372"
                     /translation="MSDNLDTLMALMGQKLKNNVKNEKTLAKQELIIIQNKSFKYEKL
                     DKEIADFLKMKQYEIFNIFNNTYTEIGRILKEAQEKLRGNNQYDGLFYKWFTSMGFKK
                     DKVYSLISRYELLVENSDKQLIINNLPLSLSYEISKKSCPTHLKMEVLNGKIKSLKEF
                     KSRYQKDEHNKKNLEINFNKTQLNREDIIKLIELLLQELENIKNIKLDKIENKKEFLI
                     ILKDIRQKINLIKKIT"
     gene            complement(452139..452921)
                     /locus_tag="BT0_RS02125"
                     /old_locus_tag="BT0434"
     CDS             complement(452139..452921)
                     /locus_tag="BT0_RS02125"
                     /old_locus_tag="BT0434"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_041178475.1"
                     /db_xref="GI:752506610"
                     /translation="MSETFKMVDINLVDVDKSQPRKSINLAELEELSISIRENGILQP
                     IVVFHDNGRYHLVIGERRFRAAKLAGMRQISIIEIETTRKNKDFMSLIENIQRENLTP
                     VEEAYAYKNLMDKHSLTQRALSEKIGKNRSHVANLVRILDLEQEILNSLHKKEISLGH
                     AKVLLSLKDSQDRYGLYLLIIKKKLSVRETENYVKNFYKPINDKSEISRDPFLNSVKE
                     FLISRIQTKISIKGSKEKGKIEISYFTSSDLKRIISIFESIK"
     gene            complement(453056..455488)
                     /locus_tag="BT0_RS02130"
                     /old_locus_tag="BT0435"
     CDS             complement(453056..455488)
                     /locus_tag="BT0_RS02130"
                     /old_locus_tag="BT0435"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0D7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit A"
                     /protein_id="WP_041178476.1"
                     /db_xref="GI:752506611"
                     /translation="MAIEEDKEQILNIKIEDEVKTSYLNYAMSVIVSRALPDVRDGLK
                     PVHRRILYSMHEMGLRADKAFKKAGRIVGDVLGKYHPHGDQSIYEALVRLAQDFSLRY
                     PIVSGQGNFGSIDGDPPAAMRYTEARMAKIAEELVKDIDRQTVDFRANYDDSLLEPEV
                     LPAAFPFLLVNGSSGIAVGMATNMAPHNLREICDAIVYMLNHDSVSVYDLIAIVKGPD
                     FPTYAEIIYNESLVKAYTTGKGSVVIRSRYHIEEKREDHIAIIITQIPYAVNKSSLLM
                     KIAFLIKEEKLEGISDIRDESDREGIRIVLEIKKGFDPHVVMNLLYEYTELRKNFSIN
                     NLALVNGIPKQLNLKELISEFIDHRKEIVRRRVEFDLKKARDKAHILEGLNISLRHID
                     RVIEIIRFSRLVKDAKECIIKEFNLSEIQANSILDMKLQKLTSLEIEKLEEEFKIVLD
                     LIKDYEDILVSPERVVNIVREEIINLSLKFGDERRTKIIYDEEVLKTSMSDLMQRENV
                     IVILTKQGFIKRILQDEYKLQGIGGKGLGSFDLQDKDQVNIALCVNTHDFLLMISNEG
                     KLYVINAYGIKDSSRTSKGQNIRELINLGETEEILAIKNCNELSLDNYLLITTANGKI
                     ARIETEGFKTVKSRGVIVIKLDDKDFVTSAEIVSKNDKIICISKKGNAFAFNSNDIRL
                     THRGTQGVSGMKVREGDMLIKALSAKQGSHLLIVSENGYGKRLEISRVTELKRGATGY
                     TCYKKSDEKAGAVVDAITVAQDDEILLVSKTSKVLRTLVDKISEQGKDARGMQVLSLD
                     EDKLMSVSKFIK"
     gene            complement(455500..457404)
                     /gene="gyrB"
                     /locus_tag="BT0_RS02135"
                     /old_locus_tag="BT0436"
     CDS             complement(455500..457404)
                     /gene="gyrB"
                     /locus_tag="BT0_RS02135"
                     /old_locus_tag="BT0436"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696293.1"
                     /note="negatively supercoils closed circular
                     double-stranded DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="WP_041178477.1"
                     /db_xref="GI:752506612"
                     /translation="MSYVASNIQVLKGLEAVRKRPGMYIGSVSINGLHHLVYEVVDNS
                     IDEALAGFCDKIEVVINSDNSVTVNDNGRGIPTDIHEEEGISALELVLTKLHSGGKFN
                     KGTYKVSGGLHGVGISVVNALSSFLEVVVSRDGNFFKQTYSRGIPTSEVEIVGVSSNR
                     GTKVTFLADSEIFETLEYDFETLSKRLRELAFLNDKIRISIEDKRLGKERFLEFYFEG
                     GIKAFVDFITNNSKNIQSEPYFIEGTYDDVIVSVGLKWTEGYSDNILSFVNNINTREG
                     GTHVAGFKSGFLKAMSEAFKDSKISKKDVPNLTLDDFKEGLTAVISIKVPEPQFEGQT
                     KGKLGNSYIKKIVETIVHNELLKVIGNNLLEVDIILNKAIRAARAREAARKARESERK
                     KSAFESLALPGKLADCASKNPVEREIYIVEGDSAGGSAKMGRDRFYQAILPLWGKMLN
                     VEKTREDKVITNDKLIPIIASLGAGVGKNFYIEKLRYHKIIIMADADVDGSHIRTLLL
                     TFFFRYMRELIDNGHVYIAMPPLYKIKYENSVHYFYDDSEKEVFLSSIETGKRDKISL
                     QRYKGLGEMNPTQLWETTMNPATRKMKLIEIDDAIQAENIFVTLMGDDVEPRREFIEQ
                     NALDVVNLDV"
     gene            457651..459105
                     /locus_tag="BT0_RS02140"
                     /old_locus_tag="BT0437"
     CDS             457651..459105
                     /locus_tag="BT0_RS02140"
                     /old_locus_tag="BT0437"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZM2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="WP_011772383.1"
                     /db_xref="GI:500096376"
                     /translation="MQEGKNIWSLILAAIRKELSEEEFYIWFENLYFIDATDESIKIS
                     APNSFHKNQVEKRFSKRIKEILTEKGHNTINVEFINPPKEPKTHSMELKNTSLKDISI
                     QQDSPEKRTILNTHTKNIIEHTKHYVIKEDIHTKYRNPFLKKKYTFENFIIGPNNKLA
                     YNASLSIAKNPGKKYNPCLIYGGVGLGKTHLLQSIGNKTEELHKEFKILYVTAENFLN
                     EFVESIKTNETKRFKKKYRHLDMLLIDDIHDLQKKEGIQEELFHTFNALYEDNKQMVF
                     TCDRQPSELINFTDRLKSRFTRGLNVDISKPNFELRVAIIEKKAEEDGIKVPKNILNL
                     VAKKVTTNIRDLEAAVTKLKAHIDLEDIEIDTSIVDKIIKEIIAYENDKTNTNNTINI
                     ESIKKVILRELKLTNKDIEGNSKKPEITKARHIYAYLLRNFTELSTIEIGKIIGGKTH
                     STVLYSINKIDKERNNDLEINNLIIELMNKINKN"
     gene            459346..460506
                     /locus_tag="BT0_RS02145"
                     /old_locus_tag="BT0438"
     CDS             459346..460506
                     /locus_tag="BT0_RS02145"
                     /old_locus_tag="BT0438"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="WP_011772384.1"
                     /db_xref="GI:500096377"
                     /translation="MNEKFILCDTEQISNEIDKAKSIILNRNINDIWSAILLEVKNSN
                     LKIKATDRNIFFESTIPIVSAENFKVLINASNFSDAVKALNLYNELKIKFIEDESKLS
                     IIGESENKNDNFINDHLSEPTFSSEEIEIYNYDINEEIYNLTVELTQREFKKIINKVS
                     FSASHDESKNVLNGIYFTKDKNSALTFVSTNSHRLSVYKTDLIFEEDINFIVPVKMVN
                     LLRQMMVGEGIIKLKISDKKFYVEFNNYKIVCSLINGNYPDYESIIPNEQQNKALIDV
                     SILKDRLSRVSSYTDKRSKKVILNFAGNQLRLMAEDPITGRKGEFFVQSPNYDYEGSE
                     EVVAINSAYFTEAMGVFDTSKLEIKFSGGGILKLSDPANFGFIHLIMPMVLN"
     gene            460528..461595
                     /locus_tag="BT0_RS02150"
                     /old_locus_tag="BT0438A"
     CDS             460528..461595
                     /locus_tag="BT0_RS02150"
                     /old_locus_tag="BT0438A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication protein RecF"
                     /protein_id="WP_041178478.1"
                     /db_xref="GI:752506613"
                     /translation="MIKKVEFFNFKNIENRVINFDFNNIYFCGENGSGKTNILDAIYC
                     LAFASSFLVRTDRELITYGKTEFYLKCFYNTEGKAGEIGLSLRNGKKEIKVNNSIVKD
                     RKNLILNIPSVIFSNYDTDFIIGAPAKKRWFFDQAISLVSLSYLDSLRKYRKILQQRN
                     LILRQGNKDLLKVYNETFVDFAFEITKMRENFIKHFYEFFKYYYSFIFDVSYSLEIKY
                     LPSVKCSKRDEFLQTLLLKEQDELYSESTLIGPHRDLYEILSGERVFTHHSSTGQIRA
                     LALIYRLIQVIMFNKQFGIAPILLFDDVFLELDSMRRKRIFDILPKDSQCFFTFLDDC
                     YDIKQDSKFIVYRIKNGRFQL"
     gene            461576..461875
                     /locus_tag="BT0_RS02155"
                     /old_locus_tag="BT0439"
     CDS             461576..461875
                     /locus_tag="BT0_RS02155"
                     /old_locus_tag="BT0439"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772386.1"
                     /db_xref="GI:500096379"
                     /translation="MEDFSFKKAADVLKEYLNTDICANEKLNASFILSKNWQIIFKDL
                     ADRVKLLNLKDNKILFVAVKNSSVLYTVSLNRSKIIKLIKESTGLEILDIKVLIR"
     gene            461966..462121
                     /locus_tag="BT0_RS02160"
                     /old_locus_tag="BT0440"
     CDS             461966..462121
                     /locus_tag="BT0_RS02160"
                     /old_locus_tag="BT0440"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZM6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L34"
                     /protein_id="WP_011772387.1"
                     /db_xref="GI:500096380"
                     /translation="MKRTYQPSRVKRNRKFGFRARMKTKGGRLILARRRAKGRSKLTV
                     SDEKKKY"
     gene            462102..462446
                     /locus_tag="BT0_RS02165"
                     /old_locus_tag="BT0441"
     CDS             462102..462446
                     /locus_tag="BT0_RS02165"
                     /old_locus_tag="BT0441"
                     /EC_number="3.1.26.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZM7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease P"
                     /protein_id="WP_011772388.1"
                     /db_xref="GI:500096381"
                     /translation="MKKRNISIKSKVEIQELFKKGRFIRIEGINIFYEFTSLSISRMI
                     VTFPKVFKGAVKRNRVRRIFKECFRKQLALLKNRYVDFIFVVYPQRVDVNYCEVDTML
                     KNIIVHVMKRKV"
     gene            462443..464080
                     /locus_tag="BT0_RS02170"
                     /old_locus_tag="BT0442"
     CDS             462443..464080
                     /locus_tag="BT0_RS02170"
                     /old_locus_tag="BT0442"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0E5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="insertase"
                     /protein_id="WP_011772389.1"
                     /db_xref="GI:500096382"
                     /translation="MSQSKRILRAIYLSLFFIGIFMLVDDVFFSRKSPSVMEREIGFN
                     LDRDFDVEHHSIDENDTLSLSANSKEIGVETGIYYATFSTFGGNLVSLKLKDHLNLER
                     NPTEMVKVNMDREGLFYITFDNLTKSLFSYDKINDYTHEFKTKFEYNDKYYEYIKRYT
                     FSSKDEYLIKLEIFLNNVDANDNFDIDFYKFVLSSDIENLSERGKLQYNNYLSQSIYY
                     DTKLRYGKDGLSVIKPKWVGSSTKYFEVLVSKENMNVEFKQENKVLKTFVLNKIGDTS
                     FSDTFYIYAGPRDNGYLDIFNENNLNSFGLSNVEFGMSVEKSLLYFIQVPMQLIMQIF
                     YDVIPNWGLSIIFLTIVVRILIFPLTFKSFRATAELSKLQPKMKEIQVKFKNDPKRLN
                     EEMGKLYREEGVNPLGGCLPILLQLPVFFALYGLVNNFFLLRGASFIPGWIDDLSIGD
                     SIYYFGYKVFVWTDIRILPFIMMITQLLSTIISSNVSFKNLGSQQKFLYFGMPIMFFF
                     ILYDMPSGLLIYWITTNIFTILQQYYIKMNVSERRNR"
     gene            464077..464799
                     /locus_tag="BT0_RS02175"
                     /old_locus_tag="BT0443"
     CDS             464077..464799
                     /locus_tag="BT0_RS02175"
                     /old_locus_tag="BT0443"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Jag protein"
                     /protein_id="WP_011772390.1"
                     /db_xref="GI:500096383"
                     /translation="MSYEFYGKTEQEAIKKAMRDLDLREGEFDVEILDKEKVGFLFKK
                     EMIKIKVSPHVKEDTLKSEAQINEGICDKVLDFIKEMINKMGYCVDLKIESREGEYIK
                     ISIDTDSPNILIGREGRNLDALQLLANVYMSRLIGDNGIFNRIVLDIEDYRERFKSRF
                     INLAINSLHKVKRSRRSILLPTMNPFERRIIHTTLNRYSDIKTESEGDGNLKRVRISY
                     VRSSKYNNNFRSYQKRDSNVRK"
     gene            464950..466008
                     /locus_tag="BT0_RS02180"
                     /old_locus_tag="BT0444"
     CDS             464950..466008
                     /locus_tag="BT0_RS02180"
                     /old_locus_tag="BT0444"
                     /EC_number="5.1.3.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucuronate 4-epimerase"
                     /protein_id="WP_011772391.1"
                     /db_xref="GI:500096384"
                     /translation="MRVFLTGIAGFIGFHVAKRLADNGHEVLGVDVLNDYYEPNLKYE
                     RLEVLGFDRKNIGSKKVIQSNKYNNLSFIYLDILDKDKVLSLFSDYKFTHVCHLAAQA
                     GIRDSIENPDSYISVNIVGFFNVLDACRIHKSHIEHFVYASTSAVYGINKKMPSDEDS
                     ITDHPLNLYAASKKSNEVIAHAYSSSFNIPTTGLRFFTVYGPYGRPDMALYLFADGII
                     KQTPINVFNNGDMARDFTYVDDVADGVYSVLKKPAESDVNFDVQNPNSSSSLAPYKIY
                     NIGTGHATELLEFINELETNLGNKACKNFLPMQKADVVKSCCNISKLKTDFAYESLIS
                     IKEGIKKFANWYKSKIVE"
     gene            466129..467208
                     /locus_tag="BT0_RS02185"
                     /old_locus_tag="BT0445"
     CDS             466129..467208
                     /locus_tag="BT0_RS02185"
                     /old_locus_tag="BT0445"
                     /EC_number="4.1.2.13"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538908.1"
                     /note="catalyzes the formation of glycerone phosphate and
                     glyceraldehyde 3-phosphate from fructose 1,6,
                     bisphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-bisphosphate aldolase"
                     /protein_id="WP_011772392.1"
                     /db_xref="GI:500096385"
                     /translation="MGVLDKIKPGVVYGKELHTLYEICKSEGFAIPAINCVGTNSINA
                     VLEAAKEINSPIMIQFSNSGSAFVCGKGLKVEKPQGTSILGAISGAMHVHLLAEHYGV
                     PVVLHTDHCAKKLIPWVEGLLEYGEKYYQEHKRPLFSSHMLDLSEEPIKENIEISKKF
                     LERMSKIEMFLEIELGITGGEEDGVDNSDREQHELFSTPEDIYYGYSELMKVSPNFQI
                     AAAFGNVHGVYKPGNVQLTPKVLRDGQNYVISKTNSSDPKPVSYVFHGGSGSTIEEIH
                     EALSYGVVKMNIDTDTQWAAWEGILNYYKNNENRLQGQLGDGSNADVPNKKFYDPRVW
                     LRESEISIKERVKLACKSLNNINRN"
     gene            467456..467887
                     /locus_tag="BT0_RS02190"
                     /old_locus_tag="BT0445A"
     CDS             467456..467887
                     /locus_tag="BT0_RS02190"
                     /old_locus_tag="BT0445A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat-shock protein"
                     /protein_id="WP_041178479.1"
                     /db_xref="GI:752506614"
                     /translation="MDKKGFYMLLTNYKKNFLDFLNDDFDFMSPKGVHDIPVNIKDEG
                     KSFILEAYLPGIKKDDISISIKNDYLTISYESKDESEEKHDKYLRVERRDISFARSFR
                     LSGNIDQDKIKSELKNGVLHIKLPKKAEVIEKIQEKKIAIE"
     gene            complement(467915..469672)
                     /gene="aspS"
                     /locus_tag="BT0_RS02195"
                     /old_locus_tag="BT0446"
     CDS             complement(467915..469672)
                     /gene="aspS"
                     /locus_tag="BT0_RS02195"
                     /old_locus_tag="BT0446"
                     /EC_number="6.1.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZN3.1"
                     /note="catalyzes a two-step reaction, first charging an
                     aspartate molecule by linking its carboxyl group to the
                     alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; contains discriminating
                     and non-discriminating subtypes; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aspartyl-tRNA synthetase"
                     /protein_id="WP_011772394.1"
                     /db_xref="GI:500096387"
                     /translation="MFKTIKCNQINDKLINQKIEINAWVKKIRHHGKVTFINLRDRYD
                     EAQVLVNDEKLLKITSQIKMEYCIKVQGKLELRPSNLVNKEMRTGAFEILAENINIIS
                     RCNELPFMIEDNNNANENAKLEYRYLDLRREEQKQKIILRSKVTHTIRNYLTKKDFLE
                     LETPTFVKSTPEGARDFLVPSRIHKGHFYALPQSPQIYKQLTMIAGLDKYFQIARCYR
                     DEDSRGDRQPEFTQLDIEMSFIKKENIFKLMENLIFTIFKNTLNISLPKKFKRMTYKH
                     AMNTYGSDKPDTRYELLIQDMGKYFKQSSFNVFKDILQNKGTIKALIIKNQAHNFSRS
                     KINNLEEHAKIYKTSGLYFAKIENNEFVGGIAKFLNKIKQTLFQTYSLKNNDIIFFIA
                     DSWETACKAMGQIRIKIANELNLTNKNTFEFLWIYDFPLFEYDEDTKNYKAAHHMFSL
                     PQQKYIDTLESNPSKVLGEVYDLVLNGMELGSGSIRVHTRELQQRIFNIVGFKDTIAE
                     ERFGFFLKALEYGAPIHGGIAIGIDRLLMIMTHSSSIKDVILFPKNSFAASPLDKAPS
                     KVPNEQLRELNLTIEDYKN"
     gene            complement(469676..471796)
                     /locus_tag="BT0_RS02200"
                     /old_locus_tag="BT0447"
     CDS             complement(469676..471796)
                     /locus_tag="BT0_RS02200"
                     /old_locus_tag="BT0447"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_011772395.1"
                     /db_xref="GI:500096388"
                     /translation="MNKKILYKILFIINPILSFGMADYMKDTSHNIDAKISSFIMSLA
                     IIVISASLLGNLVSKFGIPKVIGQITAGILLSPTFLGKIKIPLLFPLGIISVSDHYLI
                     NEEIFAISTIASIILLFMAGLETDLKLFLKFLPRGGLIGITEVIGTFTSFALISTILF
                     DVQLISPTALFIGIIATPSSAGIAASILSAKKKMSTSEGVTIISTSIIDDVLSMIMLT
                     SVITISRSLSDLDIAISITATIKNILIWFCLTFILILLSEPISKLLKSFNSVTLATVI
                     TITFTFIVASFFQNLGMSFVIGAYIFGLAMSKTDIVCVIQDKLTIFERFFIPIFFTSI
                     GLMADINVILSKEVLILGTLLSLIAIATKLIYCFIPSCFLGFNKLGALRIAFGMVPRG
                     EISLIIANLALSSEFISQKIFGITIIIVFLPTIIVTPIINILFQINKNGLKKEIKTEQ
                     NTQITVSFKYDNLTKILVWELKNELRKEGFFTQQIKNDFSQYINARYNDISLSIKREG
                     SKITFECPNKHLIIIQDLFRETILNLERITEEVKTVSVKAQKLNYSINYDKIRSNIAL
                     NKRIKKENIILELKATNKTEVLRELLGVIKIEIDKEIILQDLMEREKLITTALKEGFA
                     IPHLKTNLITKMHIAIGISHDGIDFNATDKNLSHIFILILYPAKEYVNYPRILASIVG
                     KVDSNKKEMLKAKTDKEIYNIIVG"
     gene            complement(471793..472074)
                     /locus_tag="BT0_RS02205"
                     /old_locus_tag="BT0448"
     CDS             complement(471793..472074)
                     /locus_tag="BT0_RS02205"
                     /old_locus_tag="BT0448"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphocarrier protein HPr"
                     /protein_id="WP_011772396.1"
                     /db_xref="GI:500096389"
                     /translation="MQAITIEINNKEGLHSRPSSMIAELASKYPYCNVKLVTEDGREA
                     DAKSTVEIMILGVIYKEKIKIIANGKKETEIIDILSELLKSNFKKEIQK"
     gene            complement(472089..472385)
                     /locus_tag="BT0_RS02210"
                     /old_locus_tag="BT0449"
     CDS             complement(472089..472385)
                     /locus_tag="BT0_RS02210"
                     /old_locus_tag="BT0449"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated factor Y"
                     /protein_id="WP_011772397.1"
                     /db_xref="GI:500096390"
                     /translation="MEPKIQAINYHLSDHTKDFIIKKLEKLGTHIKQNSESLKITIKK
                     ENDIFDIDAHLHFNWGKIIHITEHGKELYALIERLVERLQNTANKEKNKKDTVK"
     gene            complement(472349..473573)
                     /locus_tag="BT0_RS02215"
                     /note="RNA polymerase sigma54 factor; disrupted; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            complement(473576..474109)
                     /locus_tag="BT0_RS02220"
                     /old_locus_tag="BT0451"
     CDS             complement(473576..474109)
                     /locus_tag="BT0_RS02220"
                     /old_locus_tag="BT0451"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="WP_041178574.1"
                     /db_xref="GI:752506709"
                     /translation="MILINLFITFFKIGILNFGGGNGIATIINKEIIDNKGWITKEEF
                     INIITISRITPGPVATNIATYVGTKVAGITGAIIATIALITAPILIITFITLTLHKIN
                     FLNYYLKSLRPVIIALWIMTIIILFESIFLKISYNGTEFLKSFAIAGLNLIILLFYKN
                     ITPAILIISSGILYIFM"
     gene            complement(474112..474690)
                     /locus_tag="BT0_RS02225"
                     /old_locus_tag="BT0452"
     CDS             complement(474112..474690)
                     /locus_tag="BT0_RS02225"
                     /old_locus_tag="BT0452"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
                     /protein_id="WP_011772399.1"
                     /db_xref="GI:500096392"
                     /translation="MDKTKKTPYELLTLFYLVLKITTITIGGGLLIISELRKIIVNKK
                     KLISDKEFNEILATSNVVPGVTAINFAFLIGKKLKGFKGAIMLTIAGILPSILVITMI
                     ALYVNLNSNNIYAQKFLEGAKISSTIIMSIIILEFSKKMLKQSITKWITCLLITYTLY
                     KFNIDISYILITVLFICSLTYTIQKIFFQKKV"
     gene            474864..475730
                     /locus_tag="BT0_RS02230"
                     /old_locus_tag="BT0453"
     CDS             474864..475730
                     /locus_tag="BT0_RS02230"
                     /old_locus_tag="BT0453"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mechanosensitive ion channel protein"
                     /protein_id="WP_011772400.1"
                     /db_xref="GI:500096393"
                     /translation="MDKQSKTFSVFREIFVFQDYVNEIFEMVIVYGLKVLVALVVWCV
                     SRFFVKRVGRLFFSAFEKSKLETKLDSTILNFFKSFFKVMIDMVLILMILPYLGVSTT
                     SIFAIFGSLGLAVGLAAQGILSDFVSGFVVLNSSFFKIGDYISCDDVEGEVNDIHIFF
                     TTLQTVDGKIIKIPNSKFTDTSVTNFSTNPERRIAFDFQVPYDTDIGSLKSRIENLAF
                     SFNKEQYGINKPSVVVKEYTPYYIVMQVRSFVKTEFFWDFQYFIAENIKGILDDMGIK
                     FPIHNVDFSKLR"
     gene            complement(475727..476878)
                     /locus_tag="BT0_RS02235"
                     /old_locus_tag="BT0454"
     CDS             complement(475727..476878)
                     /locus_tag="BT0_RS02235"
                     /old_locus_tag="BT0454"
                     /EC_number="2.4.1.157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 1"
                     /protein_id="WP_011772401.1"
                     /db_xref="GI:500096394"
                     /translation="MKIAIFTDTYLPDKNGVATSIKQIKEGFERKGHSVYIFCPQSQK
                     TDLQEDHIYRCFSIKLNQTVDAKIAFPNKTRIKKIIQEYQPEIIHTHSEFTMGKIGKK
                     LALQHNIPIVHTNHTMWNYYLHYLGIFKYLTNPDKMMKKFYDQIHHFIYPSIKSHNKY
                     FHLATNADYKIIPNGVDRKIFIKDLSQEKRQEILTKHGISKNDKIIIFVGRINEEKNI
                     CLLMKHLKKLLIENKNCKLILIGKGKEETKIRRFRKQYELEKQIILIGTIPWEEMYYY
                     YKISDVFTSLSRSEVYPMTTIEALTAGIPAVLINDIIYKDVIQQGKNGFLIDDYENLY
                     KYIKEIIENEEKLQTLKKNTEETSMMFSSSFFVEKIEQYYSEIIKNKKY"
     gene            476938..477927
                     /locus_tag="BT0_RS02240"
                     /old_locus_tag="BT0455"
     CDS             476938..477927
                     /locus_tag="BT0_RS02240"
                     /old_locus_tag="BT0455"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta"
                     /protein_id="WP_011772402.1"
                     /db_xref="GI:500096395"
                     /translation="MKEIYLLLGKEQGLKEAYLNNIFSKLNADNICVTKLFMSELSSI
                     ELSERLLTNSFFSKEEVFIIYESENLKNKKDLELVYSTILKSLNKIIIFVSNENSISF
                     DPKGSLNLVKKTFYELSDTDKFLFVKKSFFKLGIKITDKAIHLMLFMLDADTKILQFY
                     VNSFALMIKNKTIDEHDVNSWLSFMRPENPFSLFESILKKDMEYALVKIKSILEQGED
                     LVNIVMSLGWQFKKFLKVKIDCESLHDIPSVFKKHKIFVSLEKVYKIGLKNYSIFDIK
                     FILKLLHKFDLYARIYGKNMHLNLSYFMILVLLSQDDTILDNFSSKFKFTNVL"
     gene            complement(478027..479835)
                     /gene="uvrC"
                     /locus_tag="BT0_RS02245"
                     /old_locus_tag="BT0457"
     CDS             complement(478027..479835)
                     /gene="uvrC"
                     /locus_tag="BT0_RS02245"
                     /old_locus_tag="BT0457"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZP2.1"
                     /note="The UvrABC repair system catalyzes the recognition
                     and processing of DNA lesions. UvrC both incises the 5'
                     and 3' sides of the lesion. The N-terminal half is
                     responsible for the 3' incision and the C-terminal half is
                     responsible for the 5' incision; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="excinuclease ABC subunit C"
                     /protein_id="WP_011772403.1"
                     /db_xref="GI:500096396"
                     /translation="MREHLNCLHKKVQEFPTTSGCYKMYSQDNKILYIGKAKNLRSRL
                     KNYFLEKISLKTKILMRNVVNIEVITTNSEYEALLLECNLIKEHKPDYNIKLKDDKGY
                     PMIRITCEKYPKVFKTRKIINDGSEYFGPYVNAKHLDLVLNLINKTFKTRKCKKKSKN
                     PCLYFHMGQCLGVCYRNDLEEQYKEEVNKIRHILNGNISKLLDEIEIKMKEVIKREDF
                     ESAIKLKETKRSLIEISQTQIITKINKLSTDYIYIHKTDNLNVIVIFKYKDGKLVEKD
                     INFDESIYEEEELIAEFITQYYTSLNMIVPDKICIFKKIETEDITKLINELKSTNTEI
                     VYEETKDAIKIMEMAISNAEIALKAYNNEKNKALENLKIILEMTKLPKTIEGFDIAHL
                     NGYKTVASLVTFKMGKPFKDGYRVYKINSLNDGEINDFKAIKEIISRRYTKLINEQLE
                     LPTLILIDGGKGQLNAAYSILKGLKIEDKVTICALAKQEETIFLPNKTQGIKLPKGNP
                     ALKILQNVRDESHRKANSFNRKLRKNIKLNYSKIEGIGEKKAKNILKTLGTYKDIFLL
                     NEDEIAQKMKINIKMAKKIKKFSEDQNLKNTHSIES"
     gene            479953..481470
                     /locus_tag="BT0_RS02250"
                     /old_locus_tag="BT0458"
     CDS             479953..481470
                     /locus_tag="BT0_RS02250"
                     /old_locus_tag="BT0458"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fibronectin"
                     /protein_id="WP_011772404.1"
                     /db_xref="GI:500096397"
                     /translation="MRLIFIFALFCLCLYSVFSQELKLILDAKDGFKFIQEAHNISFT
                     RGDRGVLGIYLDRHKGVLDFNNVDFRLEIEKDSIVKDAALNYSVDSNNAKISNSFHNI
                     AGNSLIFYSSRNTIKLKPLTKKAFFCSGNVISDFTIQFWAYRSTSVTGEVIVSWNGYK
                     NIKGVWLDQAIRLESEGGTFVWNFNNVFLNDNGEPIKIKLRSDDDFIPKEWHLHTVRY
                     RQKDGLLEYLIDSKPQAIEYVTADKREGFGYLLNIGNFIDFTLGQYFTGAIENFEIHK
                     SFEEVHNAFFSRDKGYIITEPIKLSKDYSQILSVEFDTVKPKDTDIFYYYRLDNKMFY
                     GTDKNGKIKKNLTGDWIHFDPKNGFPKFDVSKYIQIKVELYPSGDPVDSPSLYSMILT
                     YIPEAAPFPPLITKAVPGAGEILIEWFPVISSNVGGYYIYIGVSPGNYHDKAGNILTS
                     PIDVGNQTSFRITGLENGRLYYISVASYNLDKSVNEASFSKEISVRPMEFFKQYE"
     gene            481463..482770
                     /locus_tag="BT0_RS02255"
                     /old_locus_tag="BT0459"
     CDS             481463..482770
                     /locus_tag="BT0_RS02255"
                     /old_locus_tag="BT0459"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772405.1"
                     /db_xref="GI:500096398"
                     /translation="MNSIDFEKALELYKNGDLKNALLNLDVFDDSFDSLALKSLIYFR
                     LKDYKALLYVLDTYPVLSEYRFLIKLLHYGKFEDQKSELSYFQNYNLGVFYFGLKDYE
                     KSLSYFLKSSQQHPSLIQAINNAAILLEILGRKDEATQMLIKAVDVDKNNALVKLNVW
                     FLKNNCIFNSAKPFEIDESFKEANLSLVVNYLMYYFYSIGEISSAIKLSERFLTDSNY
                     SKYIWHNRATILHKIGNMTQATKSYVKAILNFPNIYTIYNMHIATIELLNFSPKRSID
                     RMLLDYPNMDSVCFYAFLFFLRNRELEDAYFYIKKLCEIKPDTYSKFLNLLESREDIL
                     IEELLDEFAMVLKGRWTLEYLFFIDNSLNLKDPVFVFDYNTRLCPYIWKIKDEHIELR
                     ANNNEVEITKKIFSDELMQVKLDVAIKEIRDLIEAYRDFKINC"
     gene            482839..482928
                     /locus_tag="BT0_RS02260"
                     /old_locus_tag="BTT0010"
     tRNA            482839..482928
                     /locus_tag="BT0_RS02260"
                     /old_locus_tag="BTT0010"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:482873..482875,aa:Ser,seq:gct)
     gene            482995..483080
                     /locus_tag="BT0_RS02265"
                     /old_locus_tag="BTT0011"
     tRNA            482995..483080
                     /locus_tag="BT0_RS02265"
                     /old_locus_tag="BTT0011"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:483029..483031,aa:Ser,seq:tga)
     gene            complement(483105..483810)
                     /locus_tag="BT0_RS02270"
                     /old_locus_tag="BT0460"
                     /note="hypothetical protein; disrupted; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /pseudo
     gene            483938..484011
                     /locus_tag="BT0_RS02275"
                     /old_locus_tag="BTT0012"
     tRNA            483938..484011
                     /locus_tag="BT0_RS02275"
                     /old_locus_tag="BTT0012"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:483972..483974,aa:Arg,seq:gcg)
     gene            484028..484114
                     /locus_tag="BT0_RS02280"
                     /old_locus_tag="BTT0013"
     tRNA            484028..484114
                     /locus_tag="BT0_RS02280"
                     /old_locus_tag="BTT0013"
                     /product="tRNA-Ser"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:484062..484064,aa:Ser,seq:gga)
     gene            484378..486024
                     /locus_tag="BT0_RS02285"
                     /old_locus_tag="BT0461"
     CDS             484378..486024
                     /locus_tag="BT0_RS02285"
                     /old_locus_tag="BT0461"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772407.1"
                     /note="catalyzes the DNA-template-directed extension of
                     the 3'-end of a DNA strand; the tau chain serves as a
                     scaffold to help in the dimerizaton of the alpha,epsilon
                     and theta core complex; the gamma chain seems to interact
                     with the delta and delta' subunits to transfer the beta
                     subunit on the DNA; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit gamma/tau"
                     /protein_id="WP_011772407.1"
                     /db_xref="GI:500096400"
                     /translation="MISARGTAIKRRPRDLNSLEGQDFVVETLKHSIENNKIANAYIF
                     SGPRGVGKTSSARAFARCLNCKIGPTIMPCDMCFSCKSIDNDNKLDIIEIDGASNTSV
                     QDVKQIKEEIMFPPASSRYRVYIIDEVHMLSNSAFNALLKTIEEPPSYIVFIFATTEV
                     HKLPDTIKSRCQHFNFRLLPLDKVYEMLKHVCLEDNIKYEDEALRWIAYKSGGSVRDA
                     YTLFDQIVSLSNSDIQFERIRSKMGFTSSEFLEKLALSILNDDLKELLCILDAVFLTG
                     ISCEQLLLDTIEFFREILFLKLGIKNLMFIGIKPESLKEKLLSFDLKHVERSISVLLE
                     TYRDLQFSVNPKYELEINFIKILRLKDYVPSHVLIKQIQDIEAKVLDEVSLNLNDTDF
                     DTDVEPKLENISSVEPVELGLDKTETALKTEVKASTHLDLNGDDIDEIFIETKDNFDK
                     VDDNDKIKESFVYLVSKYVQTLVYSGEVLIDNDVLYYKIFSGFEYNQLQAYQNEIRAE
                     FCKEFPRLNVVFQKQFKDDDDEFDSKVLKIKNIFGASEVK"
     gene            486031..486330
                     /locus_tag="BT0_RS02290"
                     /old_locus_tag="BT0462"
     CDS             486031..486330
                     /locus_tag="BT0_RS02290"
                     /old_locus_tag="BT0462"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0G4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772408.1"
                     /db_xref="GI:500096401"
                     /translation="MAVNPLDFLKNMSGFKDNIDNFKKEISQIVVCGRAGSDVVVVEM
                     NGEFVVKKVVIKEEFFSDLDNEALEHMIKSAFNDAISKVKEEIKSKTMGSIPFGI"
     gene            486334..486918
                     /locus_tag="BT0_RS02295"
                     /old_locus_tag="BT0462A"
     CDS             486334..486918
                     /locus_tag="BT0_RS02295"
                     /old_locus_tag="BT0462A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase RecR"
                     /protein_id="WP_011772409.1"
                     /db_xref="GI:500096402"
                     /translation="MIIQDLIVLLSKLPGIGRKTAVRMVYDILYNGEEYSRALGQILI
                     GFHSSIRKCKNCHNLAEGEFCNICMDLSRCKDMICIVEMPQDLEVIESTREYDGLYFV
                     LHGHLDPLRDIGPNRLNLDKLENYVREVGAQEVIIATEFSIEGDVTANYISGILKNLG
                     INVTRIASGLPAGGSISNADKITTLRALRLRLKM"
     gene            487242..487751
                     /locus_tag="BT0_RS02300"
                     /old_locus_tag="BT0463"
     CDS             487242..487751
                     /locus_tag="BT0_RS02300"
                     /old_locus_tag="BT0463"
                     /EC_number="2.7.4.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772410.1"
                     /note="catalyzes the formation of nucleoside triphosphate
                     from ATP and nucleoside diphosphate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nucleoside diphosphate kinase"
                     /protein_id="WP_011772410.1"
                     /db_xref="GI:500096403"
                     /translation="MSTLIQRTLCIIKPDGVRRGLIGNVISRFERTGLKIVAAKMILV
                     NREMAETHYLYDDIAVRHGEFVWQSLINFIISSPVFVFVVEGVEAVEVVRKFCGSTEP
                     KMASPGTIRGDFAYHSFNYANEKEFSVYNVIHASANVDDALREVSLWFKENEILTYKR
                     DDEFEHYYG"
     gene            487744..488577
                     /locus_tag="BT0_RS02305"
                     /old_locus_tag="BT0463A"
     CDS             487744..488577
                     /locus_tag="BT0_RS02305"
                     /old_locus_tag="BT0463A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methyltransferase"
                     /protein_id="WP_041178575.1"
                     /db_xref="GI:752506710"
                     /translation="MVNVDMNIAIRPILKWAGGKKNLLSSILDNIPLAFNNYIEPFVG
                     GGALFFALNVKNSIINDINSNLINFYREIAYNLDDFLLEIEKYNNAPLTKEYYVHIRN
                     SFNNENLTNLEKACIFLYLNKTCYNGLYRENGNGKFNTPFGKHKKISLYEIKNLQLAS
                     KLLREVKVLNLDFFCLLDFIKKDDFVYLDPPYIPYSKTSNFTSYSKYGFDFRMHEKLL
                     QFCDKIDKKGAKFLLSNSNTASSLELYKNYNVTFVDAKRFINSNPIRRGSIREILVKN
                     F"
     gene            488815..489351
                     /locus_tag="BT0_RS02310"
                     /old_locus_tag="BT0464"
     CDS             488815..489351
                     /locus_tag="BT0_RS02310"
                     /old_locus_tag="BT0464"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772412.1"
                     /db_xref="GI:500096405"
                     /translation="MMRFALFYFLSILLFLNCTFDYDEHSGRAGAAKETPSIQILGIS
                     YHNVVGGKKQTILEALSFNYFNYYKIYKIDNGRFLYHALENRISGRFNSLEGSHVTKD
                     LDIKDSVELKIEDVNNYYLINTNRLLWKDNEKKLLSPPNELVFIRFDESNITGKGFSY
                     FLKNNNFYFYSGIEGLVK"
     gene            489348..490046
                     /locus_tag="BT0_RS02315"
                     /old_locus_tag="BT0465"
     CDS             489348..490046
                     /locus_tag="BT0_RS02315"
                     /old_locus_tag="BT0465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772413.1"
                     /db_xref="GI:500096406"
                     /translation="MRSLVICLVCIYFLSSYAQDEKSFNKSSKLKTEGDAQKKNEFTF
                     RADFSHGIFSSVYRRVILKGNPEVISSDFKLRADEIEIYGEGSAYIEARGNVYYEDYV
                     NKMNVKSQFLFVNRKLDNFYLQKGVELEDLENELIVKAERIEGSRKTSVYIMQYSVKI
                     YKGDIFARAENGIYNKEDKEIVLEGIPVIYQDDNYYSASRIIFNTETKKYNLEGDVEG
                     KFTQVEGDVPQQKK"
     gene            490024..490815
                     /locus_tag="BT0_RS02320"
                     /old_locus_tag="BT0466"
     CDS             490024..490815
                     /locus_tag="BT0_RS02320"
                     /old_locus_tag="BT0466"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_041178480.1"
                     /db_xref="GI:752506615"
                     /translation="MFLNKKNSIKSIKEKLSLDTVTNIVLKADNVVKRYGKKLAVNGV
                     TIDVHRGEVVGLLGPNGAGKTTTFYTIVGFIKANSGRVLINSHDISGLNMYERARLGI
                     VYLPQEPSIFRELTVEDNILIALERREDLSQTERKMELVNLLKDFEIKRIQHQKAYTL
                     SGGERRRTEIARALAVSPYFLLLDEPFAGIDPIAIGDIKDIIRILKSKNIGVLITDHN
                     VRDAFDIIDRAYIIYQGQVLDEGNVDYIINSEKAKKLYLGEEFRL"
     gene            490812..491501
                     /locus_tag="BT0_RS02325"
                     /old_locus_tag="BT0467"
     CDS             490812..491501
                     /locus_tag="BT0_RS02325"
                     /old_locus_tag="BT0467"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="laccase"
                     /protein_id="WP_011772415.1"
                     /db_xref="GI:500096408"
                     /translation="MRVVENEFYYEFELDPSIKLIYTKKPFDLNIRDISIDNLSFIPK
                     DKKVKYLKQLHTNVVYEVSDDFVNFQEGDGLVSSSCNVALLAYYADCLPIYIFDKSKK
                     YIGLAHSGYKGSFKLIILKMLFMFESMGSNFEDLKIVFGPYNRLCCYEVSSEFLSEIN
                     LKFSKKLLDMSFCKKDDKIYFDNANFNLGLISNFNLDVEDSGLCTYCNCNLYSHRKFK
                     GKRSYAAIWRT"
     gene            491503..492249
                     /locus_tag="BT0_RS02330"
                     /old_locus_tag="BT0468"
     CDS             491503..492249
                     /locus_tag="BT0_RS02330"
                     /old_locus_tag="BT0468"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178481.1"
                     /db_xref="GI:752506616"
                     /translation="MTVKELSLNLDEIFKVKDYRSIDKSLNGLQVGNLELEVKRVAFA
                     VDASMATLREAKDYDFLITHHGIFWSKSEKIVSGIYEKVKWLIDNDLSLYCVHLPMDA
                     HPVYSHSRVLSDFFGFHNPIPFANYKGINLGIISIAGFNFSEILKKIEIHNKHILYYK
                     KFKEYVEKVAIVSGSGYSFFEESLEHGVDLFITGDTSHQIYSLAEEYGVNLIFAGHYF
                     TETFGLIKLMEYFRNQEKLEVNFILKNTNL"
     gene            492259..492771
                     /gene="lspA"
                     /locus_tag="BT0_RS02335"
                     /old_locus_tag="BT0469"
     CDS             492259..492771
                     /gene="lspA"
                     /locus_tag="BT0_RS02335"
                     /old_locus_tag="BT0469"
                     /EC_number="3.4.23.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZQ6.1"
                     /note="lipoprotein signal peptidase; integral membrane
                     protein that removes signal peptides from prolipoproteins
                     during lipoprotein biosynthesis; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptidase"
                     /protein_id="WP_011772417.1"
                     /db_xref="GI:500096410"
                     /translation="MNINRSRLINNFIFISILVFFDQWSKYLVVKYIRIGTEYLSFFG
                     DFFKIIHVRNTGVLFSIGSNIDPSLKNLFFLIIPIIILIFVFSFALKETNRIARIALV
                     LILSGGIGNIIDRFFRPLGVVDFLDVKFFGIFGLQRWPTFNFADSYVVIGITLFIIYD
                     LFAKNQSTNL"
     gene            492768..492995
                     /locus_tag="BT0_RS02340"
                     /old_locus_tag="BT0469A"
     CDS             492768..492995
                     /locus_tag="BT0_RS02340"
                     /old_locus_tag="BT0469A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772418.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772418.1"
                     /db_xref="GI:500096411"
                     /translation="MKILYFILCSLINLSLMFLVFFLEFLCIAKLNIIVSSVFQLVLV
                     FFMIIIAIVISYVLSSIILKNIISKFFNLDK"
     gene            493010..493828
                     /locus_tag="BT0_RS02345"
                     /old_locus_tag="BT0471"
     CDS             493010..493828
                     /locus_tag="BT0_RS02345"
                     /old_locus_tag="BT0471"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772419.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772419.1"
                     /db_xref="GI:500096412"
                     /translation="MSLRILIAGEVVGKPGIVVIKNFLSSFKQKKGIDFVISGNNFTT
                     GFRGLCKRHAFLLKKYGVDVLTLGENAFVRAGLSDELDKYNFILKPLNCPTKLKGYSY
                     FIYSVSGSKVAVIRLVGQTGITKYNFNNPFFAFDYFYEKIKLHTNNIIVLFDSNTTAE
                     VNAMFFYLKSRVSACLGIGKRILTADLRIFDSTAVITDLGRVGSLNSVIGYEPKFEID
                     KFLRGFLNNRFTESWDGLGFNGVIVDIDNGKAVKVEIVREYIDFDGYLENSNDV"
     gene            493895..495175
                     /locus_tag="BT0_RS02350"
                     /old_locus_tag="BT0472"
     CDS             493895..495175
                     /locus_tag="BT0_RS02350"
                     /old_locus_tag="BT0472"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772420.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /protein_id="WP_041178482.1"
                     /db_xref="GI:752506617"
                     /translation="MYSYLVEGGFKIGGKITASGNKNAALPCITATLLTDEEVILENI
                     PDIKDVEVILSILKDIGAEVLREGDTLKIKALNVVKTEIDSSLTDLIRASILFLGPMI
                     ARCGRIDIAPPGGDVIGKRRLDTHFYGLGKLGARLIEGERIVLEIDKLVGAYMFLDEA
                     SVTATENIIMAAVLAFGETVIINAACEPHVQDLCNMLNSMGADISGIGSNVLRIKGVK
                     KLSGTRFRIGADFMQVGSLISLSALTGGELEINKADPKNFVLISHVYSRLGINFEYDN
                     ENIYVKEKQDLKVKLDFGGHVPKIDDGPWPAFPTDLMSIMIVTATQVHGTVLIFEKMF
                     ESRMFFVDKLIKMGAQIVLCDPHRVVVTGKTILKGSNVSSPDVRAGMSLLIAALCAEG
                     ESRIQNVYQIERGYEDVVVKLGALGAKITRVEER"
     gene            495437..496783
                     /locus_tag="BT0_RS02355"
                     /old_locus_tag="BT0473"
     CDS             495437..496783
                     /locus_tag="BT0_RS02355"
                     /old_locus_tag="BT0473"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178483.1"
                     /db_xref="GI:752506618"
                     /translation="MLLSRTKTRELILEGNLYRVLLVISFPIVITNVLQAFYELVDMF
                     YVGKLGVMPLAALSLTGPINFFIMVFAMGMAIGSVSLMSRCIGEETFSKFSKYAGQLI
                     FLNFVLSLFVAVLVLVFIDSILDIMNVSGELRELTKSYFYVVIYAIPVMFLSVSVVYI
                     LNAQGETVIAMMLILVANVINFILDPILMFTFGLGIAGAAWSTLFSKLMTVFSYFFLT
                     YRLNCGLKVRLRDIAPDIIIIKNIINLGFPAIFGQMMASLSFLIFNYIVIQISSKFLA
                     AYGMANNIISFLLLPGMSIGTGIIAIVGQNLGAKNISRVEDILKKGFFVTLIIMITVA
                     SFLISFKEIIIETFTNDLEVVGYANSYFLLASIGAVGFGLQQVFFGGLIGAGFTKLVM
                     IVICIRLWIIRLPAVFILQYFGFMEDSLGYAFIISNYVALIILLCLTFTKYWAKAQ"
     gene            complement(496918..497307)
                     /locus_tag="BT0_RS02360"
                     /old_locus_tag="BT0475"
     CDS             complement(496918..497307)
                     /locus_tag="BT0_RS02360"
                     /old_locus_tag="BT0475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772422.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772422.1"
                     /db_xref="GI:500096415"
                     /translation="MSQHNLEKRLLNIFTIFIVSITTSCIKNNSVKSKEISREITHII
                     SIKKDTEKIEIVKFHTNNKNELIITLKNNKKIAIKQNSLAIFKKGNKTGHIIKEGLKA
                     GEEKTFKLKINTNKRQKNIFYIFLKQD"
     gene            497704..498888
                     /gene="tuf"
                     /locus_tag="BT0_RS02365"
                     /old_locus_tag="BT0476"
     CDS             497704..498888
                     /gene="tuf"
                     /locus_tag="BT0_RS02365"
                     /old_locus_tag="BT0476"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0H9.1"
                     /note="EF-Tu; promotes GTP-dependent binding of
                     aminoacyl-tRNA to the A-site of ribosomes during protein
                     biosynthesis; when the tRNA anticodon matches the mRNA
                     codon, GTP hydrolysis results; the inactive EF-Tu-GDP
                     leaves the ribosome and release of GDP is promoted by
                     elongation factor Ts; many prokaryotes have two copies of
                     the gene encoding EF-Tu; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="WP_011772423.1"
                     /db_xref="GI:500096416"
                     /translation="MAKEVFQRTKPHMNVGTIGHVDHGKTTLTAAISIYCSKVNKDAK
                     ALKYEDIDNAPEEKARGITINARHIEYETAGMHYAHVDCPGHADYIKNMITGAAQMDA
                     AVLLVAADSGAEPQTKEHLLLAQRMGINKIIVFLNKLDLADPELVELVEVEVLELVEK
                     YGFPGDTPIVKGSAFGAMSNPDDPEATKCIKELLETMDNYFDLPQRDIDKPFLLAVED
                     VFSISGRGTVATGRIERGVIKVGQEVEIVGIRETRKTTVTGVEMFQKILEQGQAGDNV
                     GLLLRGVDKKDIERGQVIAAIGTITPHKKFKASIYCLTKEEGGRHKPFFSGYRPQFFF
                     RTTDVTGMVSLEGKEMVMPGDNVDIVVELISSIAMDKNVEFAVREGGRTVASGRILEI
                     LE"
     gene            498935..499246
                     /locus_tag="BT0_RS02370"
                     /old_locus_tag="BT0477"
     CDS             498935..499246
                     /locus_tag="BT0_RS02370"
                     /old_locus_tag="BT0477"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RM35.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S10"
                     /protein_id="WP_011772424.1"
                     /db_xref="GI:500096417"
                     /translation="MITKDKIRVRLFSFDVKILDQSAESIVRAVQKSKAQIKGPIPLP
                     TKIKKYTVLRSPHVNKKSREQFEMRTHKRLIDILEPTSALMDSLMKLELPAGVEVDIK
                     Q"
     gene            499282..499911
                     /locus_tag="BT0_RS02375"
                     /old_locus_tag="BT0478"
     CDS             499282..499911
                     /locus_tag="BT0_RS02375"
                     /old_locus_tag="BT0478"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0I1.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L3"
                     /protein_id="WP_011772425.1"
                     /db_xref="GI:500096418"
                     /translation="MLGLIGKKVGMTQVFQGNGVVVPVTVIEFEPNYVIGKKTVERDG
                     YDALIMGSVDLRSSKISKPIRGQYKNLENVEPKRYVIEFKGLKGYDAGDEIGLDAFRE
                     IKYVDITGTTKGKGFQGAMKRHNFSGGPSSHGSKFHRHLGGTGQATTPARTFKGTKMA
                     GRMGGEQQTIQNLEVVFIDEEKRAILVKGAVPGVKGSFVIVKKAKKVGV"
     gene            499913..500542
                     /locus_tag="BT0_RS02380"
                     /old_locus_tag="BT0479"
     CDS             499913..500542
                     /locus_tag="BT0_RS02380"
                     /old_locus_tag="BT0479"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L4"
                     /protein_id="WP_041178484.1"
                     /db_xref="GI:752506619"
                     /translation="MERKVFSKDGQELRTINLEEGVFNIDISYGSIYNAINNELANLR
                     VGTASTKTRSEVRGSSKKPWKQKGTGRARVGTKRNPVWVGGGVALGPKPRDYSYKLPK
                     KVKRLAFRSVLSLCVSVEDRLKIVENFTIESGKTKDLALIMKNFIKINGKTVILLGND
                     DQMVKRAGKNIRDLKILSFNRLRVVDLFYAKNLIALESAINGLNELYVK"
     gene            500564..500860
                     /locus_tag="BT0_RS02385"
                     /old_locus_tag="BT0480"
     CDS             500564..500860
                     /locus_tag="BT0_RS02385"
                     /old_locus_tag="BT0480"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L23"
                     /protein_id="WP_011772427.1"
                     /db_xref="GI:500096420"
                     /translation="MKAYDIIISPMLTEKTNIQRENMNVYAFKVRKQANKKEIGAAIK
                     ELFNVTPISCNLLNVKSKVKMVVSRKGYPIGKGKTSSWKKAYVYLKKEDKIDIF"
     gene            500878..501711
                     /gene="rplB"
                     /locus_tag="BT0_RS02390"
                     /old_locus_tag="BT0481"
     CDS             500878..501711
                     /gene="rplB"
                     /locus_tag="BT0_RS02390"
                     /old_locus_tag="BT0481"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772428.1"
                     /note="one of the primary rRNA-binding proteins; required
                     for association of the 30S and 50S subunits to form the
                     70S ribosome, for tRNA binding and peptide bond formation;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L2"
                     /protein_id="WP_041178485.1"
                     /db_xref="GI:752506620"
                     /translation="MGIKTYKPKTSSLRYKTTLSFDELSKGNSPLKSLTRGKVSRAGR
                     DSSGRISVRRRGGGHKRRYREIDFGRRDKFGIPARVVSIEYDPNRSSNIALLVYRDGD
                     KRYIIAPKGIKVGDILESGPNAPIRIGNALPLEDIPVGKAVHNIELNVGKGGQLVRGA
                     GGYAMVLASKGDYVTVKLPSGEMRMIFKKCIATLGEVGNEDYINVSIGKAGKSRWLGK
                     RPKVRGVAMNPIDHPHGGGEGKTSGGRHPVSPWGQPTKGYKTRKKNKYSDKFIIKRRN
                     N"
     gene            501721..501999
                     /locus_tag="BT0_RS02395"
                     /old_locus_tag="BT0482"
     CDS             501721..501999
                     /locus_tag="BT0_RS02395"
                     /old_locus_tag="BT0482"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P94271.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S19"
                     /protein_id="WP_011772429.1"
                     /db_xref="GI:500096422"
                     /translation="MARSIKKGPFIEKSLYQKVLASSGREKRVVIKTYSRASTIIPEM
                     VSLTISVYNGKSFIPVYITEDLVGHKLGEFSPTRIFRGHAKSDKKGRK"
     gene            502005..502367
                     /locus_tag="BT0_RS02400"
                     /old_locus_tag="BT0483"
     CDS             502005..502367
                     /locus_tag="BT0_RS02400"
                     /old_locus_tag="BT0483"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZR9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L22"
                     /protein_id="WP_011772430.1"
                     /db_xref="GI:500096423"
                     /translation="MFVNRRYTARGKNLPSSPKKVRPIADNIRGKPYSEAVAILCSMP
                     NKCAKLLGKVVKSAASNAMYHNRNLSEDMIFIKTVMVDDGRRRRSVWPRARGRADRLV
                     NRSCHIFVEVYEKMYGGE"
     gene            502371..503201
                     /locus_tag="BT0_RS02405"
                     /old_locus_tag="BT0484"
     CDS             502371..503201
                     /locus_tag="BT0_RS02405"
                     /old_locus_tag="BT0484"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZS0.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S3"
                     /protein_id="WP_011772431.1"
                     /db_xref="GI:500096424"
                     /translation="MGQKVHPYSLRIKINRDWKSKWYFDKKLYSEILHEDFLIRRETM
                     KFLKGIRFDISDIEIIRNNLQRVTVIISTPRPGSVIGVKGANLEKIGQLLTRKISKKI
                     NIKIKEIKKPEFDAQIVANGIAKQLENRASYRKLLKSSLLSSISKGVQGVKIKVSGRL
                     GGAEIARSFEVKEGRIPLHTLRANIDYGFAEAQTTYGVIGVKVWLFKGEVLGKQTNSD
                     AGQVINKKTSREKSEYFDKNRVDDKSKKVVNDDKFSRKKLEFGSKSNSSFKKKNGSDV
                     "
     gene            503221..503637
                     /locus_tag="BT0_RS02410"
                     /old_locus_tag="BT0485"
     CDS             503221..503637
                     /locus_tag="BT0_RS02410"
                     /old_locus_tag="BT0485"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O51438.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L16"
                     /protein_id="WP_011772432.1"
                     /db_xref="GI:500096425"
                     /translation="MLSPRKVKYRKKQRGRLSGEAQKGNEISFGEYGLVSLETYFITA
                     RQIEAARVAMTRRVKRGGKVWIRIFPDVPYTKKPAETRMGKGKGGVDHWNAPVKLGTV
                     MFEMAGVPRELAEAAMMLASSKLPVKTTFVVRRDLR"
     gene            503641..503841
                     /locus_tag="BT0_RS02415"
                     /old_locus_tag="BT0486"
     CDS             503641..503841
                     /locus_tag="BT0_RS02415"
                     /old_locus_tag="BT0486"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0I9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L29"
                     /protein_id="WP_011772433.1"
                     /db_xref="GI:500096426"
                     /translation="MLKKFRDLTLEDIKAKRLSLKKEYMDLRFKAVVGHVENPLKKRE
                     LRRDIARLNTIVHEYEIGIRKV"
     gene            503847..504101
                     /locus_tag="BT0_RS02420"
                     /old_locus_tag="BT0487"
     CDS             503847..504101
                     /locus_tag="BT0_RS02420"
                     /old_locus_tag="BT0487"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZS3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S17"
                     /protein_id="WP_011772434.1"
                     /db_xref="GI:500096427"
                     /translation="MARENKKELIGKVVSDKMSKTIVVEIVQRKMHPIYHKYLKVSRR
                     VKAHDEREESKLGDKVKIIESRPISKEKRWMLVEVLEKSK"
     gene            504132..504500
                     /locus_tag="BT0_RS02425"
                     /old_locus_tag="BT0488"
     CDS             504132..504500
                     /locus_tag="BT0_RS02425"
                     /old_locus_tag="BT0488"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZS4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L14"
                     /protein_id="WP_011772435.1"
                     /db_xref="GI:500096428"
                     /translation="MVQMQTYLTVADNTGGKIAECIKVLGGSKKRSARVGDIIVIAVK
                     QAIPNSPIKKGEVHKAVVVRTSKEIRRKNGTYVRFDDNACVILDANLNPRGKRVFGPV
                     ARELRDANFMKVVSLASEVI"
     gene            504511..504816
                     /locus_tag="BT0_RS02430"
                     /old_locus_tag="BT0489"
     CDS             504511..504816
                     /locus_tag="BT0_RS02430"
                     /old_locus_tag="BT0489"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0J2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L24"
                     /protein_id="WP_011772436.1"
                     /db_xref="GI:500096429"
                     /translation="MKTKLKVGDNVKILCGKDRGKTGEVVSIDRKNLKVIVKSCNMVK
                     KVVKARTPQEKSKIIDKEAPIDISNVMLFSSGIASRIGFKFENNEKKRYLKKNGENV"
     gene            504820..505368
                     /locus_tag="BT0_RS02435"
                     /old_locus_tag="BT0490"
     CDS             504820..505368
                     /locus_tag="BT0_RS02435"
                     /old_locus_tag="BT0490"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S0J3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L5"
                     /protein_id="WP_011772437.1"
                     /db_xref="GI:500096430"
                     /translation="MSYVPALKKHYKDNIIKELVSEFQYKSIMQAPKIEKIIVSMGVG
                     DAVKNKKLLDSAVYELSQITGQRAVKTKAKKAIAGFKIRQGQEIGAKVTLRGNIMYEF
                     LYKLINLALPRVKDFRGVNGNAFDGNGNYSFGIAEQIIFSEIDYDKIERISGLNVTIV
                     TTALNDREGKALLSKFGMPFSN"
     gene            505383..505568
                     /locus_tag="BT0_RS02440"
                     /old_locus_tag="BT0491"
     CDS             505383..505568
                     /locus_tag="BT0_RS02440"
                     /old_locus_tag="BT0491"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O51444.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S14"
                     /protein_id="WP_011772438.1"
                     /db_xref="GI:500096431"
                     /translation="MAKKSMIVKALRKPKYKTRQKNRCKLCGRPKGYMRDFGMCRICF
                     RNHASAGLIPGVSKSSW"
     gene            505578..505976
                     /locus_tag="BT0_RS02445"
                     /old_locus_tag="BT0492"
     CDS             505578..505976
                     /locus_tag="BT0_RS02445"
                     /old_locus_tag="BT0492"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZS8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S8"
                     /protein_id="WP_011772439.1"
                     /db_xref="GI:500096432"
                     /translation="MAVTHSVGDMLTKIRNASRVKHESVDLKMSKINKSILDILKEEG
                     YIKNYNIFDKKGISFIKAILNYDNKRNPAINRIDAISTPGRKVYSSYKNMPRIKNGYG
                     ILIVSSSKGVITGKQAKDNKVGGELICSVW"
     gene            505996..506538
                     /locus_tag="BT0_RS02450"
                     /old_locus_tag="BT0493"
     CDS             505996..506538
                     /locus_tag="BT0_RS02450"
                     /old_locus_tag="BT0493"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RPJ7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L6"
                     /protein_id="WP_011772440.1"
                     /db_xref="GI:500096433"
                     /translation="MSRIGKLPIKIVDSVKVDIKDNIVTVEGKRGKLSQELKSSIKVR
                     VEDSNIIVERSFDDKQTRAFHGLYRSLISNMVKGVSDGFSKSLTISGIGYRVEQQGTS
                     LFFNLGYSTQFEYVIPEGINIRLDGNTKIAVEGIDKCRVGQVAAEIRGLRVPEPYKGK
                     GIKYDNEVIRRKVGKSGVKK"
     gene            506556..506915
                     /locus_tag="BT0_RS02455"
                     /old_locus_tag="BT0494"
     CDS             506556..506915
                     /locus_tag="BT0_RS02455"
                     /old_locus_tag="BT0494"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L18"
                     /protein_id="WP_011772441.1"
                     /db_xref="GI:500096434"
                     /translation="MKKVKEAEKRNIKRKKRIRDRIGFGVADRPRVTVFKSNKYFYVQ
                     VIDDVAGHTLASVSTIEKDLKLNKNIDDIRKLGEVLAKKLKDKNINKLIFDRNGYKYH
                     GLIASFATSLREAGIDV"
     gene            506924..507421
                     /locus_tag="BT0_RS02460"
                     /old_locus_tag="BT0495"
     CDS             506924..507421
                     /locus_tag="BT0_RS02460"
                     /old_locus_tag="BT0495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S5"
                     /protein_id="WP_038447869.1"
                     /db_xref="GI:740662572"
                     /translation="MVESQVHKKQIEKLISLSRVTKVVKGGRRFSFSAFMVVGDGEGQ
                     VGWGFGKANDASDAIKKSLASARKNLRVIPIRKGTLPHMVIGDFKKAKVLIKPATQGT
                     GIIAGGPVRAVMEALGVHDILSKSLGSNNSMNVVKATFKAFDLVLDARKVAEIRGKTL
                     RTLWG"
     gene            507425..507736
                     /locus_tag="BT0_RS02465"
                     /old_locus_tag="BT0496"
     CDS             507425..507736
                     /locus_tag="BT0_RS02465"
                     /old_locus_tag="BT0496"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L30"
                     /protein_id="WP_011772443.1"
                     /db_xref="GI:500096436"
                     /translation="MIKRKLRLQLKKIRFKASRSRLKNKAFIKKMKNNREILIKSDIK
                     IEVELKRSLIGKLDSKVKTLKALGLKRIGDKKVHILNKSLQGMLNSVISMVLLSEVKN
                     D"
     gene            507729..508166
                     /locus_tag="BT0_RS02470"
                     /old_locus_tag="BT0497"
     CDS             507729..508166
                     /locus_tag="BT0_RS02470"
                     /old_locus_tag="BT0497"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L15"
                     /protein_id="WP_011772444.1"
                     /db_xref="GI:500096437"
                     /translation="MIKLRRPLGANKSRKIVGRGPGSGLGKTSGRGQKGQKARNNSPR
                     IGFEGGQTPLYRRLPIRGFSNHDYKVKYEIVGLGDIDRKFEDGDLVNYNTLLQKGLIS
                     KNKKNIKILANGELTKKVNFEVSRISKSAEKLATKIGCSIKLV"
     gene            508179..509483
                     /locus_tag="BT0_RS02475"
                     /old_locus_tag="BT0498"
     CDS             508179..509483
                     /locus_tag="BT0_RS02475"
                     /old_locus_tag="BT0498"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772445.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecY"
                     /protein_id="WP_011772445.1"
                     /db_xref="GI:500096438"
                     /translation="MKGLFFNLFTIKDLRSKFLFTLFILFIFRVGSYLPIPGIDPVAL
                     RSYFKSQSDFSITNYFDFFSGGAFSNFSIFMLSIGPYISASIIIQLLVYSFPSLKKMQ
                     EGDNGRKKIKKYTKYLTIVAAVAQGYATSLYAKSIPGALNMPFYRYIFIAILTVTTGT
                     FVLLWLGEQINQRGIGNGVSLIIFSGIVVRLQAALFNLFQSMRDPSQNINPVFVILVL
                     SVFILVVILIIYEYKAQRRITIHYARANSRNTVSSYLPIKLNPSGVLPVIFASVLITL
                     PLQILSGFAGTSVLSRQILSYLRPNGLYYTLLNVVLIIGFTYFYSKIQLSPKDISNNI
                     RKNGGTIPGIKADEMEGYLDRIMNRTLFSGSIFLSIIAIIPFLVQNIFRFPYDVSRIM
                     GSSSLLIMVGVALDTLIQIDAYLKTQGLSRGPGKKYAFLQKI"
     gene            509493..509606
                     /gene="rpmJ"
                     /locus_tag="BT0_RS02480"
                     /old_locus_tag="BT0499"
     CDS             509493..509606
                     /gene="rpmJ"
                     /locus_tag="BT0_RS02480"
                     /old_locus_tag="BT0499"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008882649.1"
                     /note="smallest protein in the large subunit; similar to
                     what is found with protein L31 and L33 several bacterial
                     genomes contain paralogs which may be regulated by zinc;
                     the protein from Thermus thermophilus has a zinc-binding
                     motif and contains a bound zinc ion; the proteins in this
                     group have the motif; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L36"
                     /protein_id="WP_002557090.1"
                     /db_xref="GI:488620359"
                     /translation="MKVRVSVKPICEKCKVIKRKGVLRIICDNLKHKQRQK"
     gene            509616..509993
                     /locus_tag="BT0_RS02485"
                     /old_locus_tag="BT0500"
     CDS             509616..509993
                     /locus_tag="BT0_RS02485"
                     /old_locus_tag="BT0500"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZT6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S13"
                     /protein_id="WP_011772446.1"
                     /db_xref="GI:500096439"
                     /translation="MARIAGIDLPNNKQLQIALTSIYGIGRARALEICRKTDILPEKR
                     AKDLDNDEVNKLRKIIESDYVVEGKLRSELAMSIKRLMDIACYRGLRHRKGLPLRGQR
                     TKTNARTRKGKRKTVANKKMAAK"
     gene            510024..510413
                     /locus_tag="BT0_RS02490"
                     /old_locus_tag="BT0501"
     CDS             510024..510413
                     /locus_tag="BT0_RS02490"
                     /old_locus_tag="BT0501"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S11"
                     /protein_id="WP_011772447.1"
                     /db_xref="GI:500096440"
                     /translation="MSAKVSTNKKKVKKNIGEGNVYIQATFNNTIVTVSDIRGNTLAW
                     ASAGGMGFKGAKKSTPYAAQMTAESALGKVKDFGINYVHVFVKGPGIGRESAIRTVGS
                     TGIIVKSISDVTPIPHNGCRPKKTRRV"
     gene            510429..511460
                     /locus_tag="BT0_RS02495"
                     /old_locus_tag="BT0502"
     CDS             510429..511460
                     /locus_tag="BT0_RS02495"
                     /old_locus_tag="BT0502"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772448.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit alpha"
                     /protein_id="WP_041178486.1"
                     /db_xref="GI:752506621"
                     /translation="MSLGKLLKDFTIPDRIEFVRGEDDSSYGKFIMYPFEKGFGVTIG
                     NTLRRVLLSSIEGYAISAMRIQSNQGGSLKIVSSEFDLIPGVVEDTLEVIANIKNIHL
                     KLDEGVNSTTISLSVNGKDTNVLKAVHLEREGVEVFNKDLVIATLSSEANLDFEFQIN
                     YGRGYVSSEQNAKYLEEVNTIALDSIFSPIEKVTYSVEDTRVGQRSDYDKLVMEIWTT
                     GVISAKDAIKKAASIVRDFLLPLVNFEDKVVHSVENSELRDSDILSINIEKLNLSVRS
                     LNCLTKENVKTLGELISKSAEDLSKARNFGKKSLEEIIEKLNTYGLFLGMSKAEALKI
                     LNKNDKISH"
     gene            511479..511853
                     /locus_tag="BT0_RS02500"
                     /old_locus_tag="BT0503"
     CDS             511479..511853
                     /locus_tag="BT0_RS02500"
                     /old_locus_tag="BT0503"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZT9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L17"
                     /protein_id="WP_011772449.1"
                     /db_xref="GI:500096442"
                     /translation="MKTKVGFNRLDRKSSHRKALLRNMVISLFRHEKITSTKAKLSEV
                     KRFAEKLITRAKVDSVHNRREVSKFIHDKYILNKLFTRISPIFKERKGGYTRVIKLGQ
                     RYGDAAEMAILELVDKTLEEKQ"
     gene            511925..513466
                     /locus_tag="BT0_RS02505"
                     /old_locus_tag="BT0504"
     CDS             511925..513466
                     /locus_tag="BT0_RS02505"
                     /old_locus_tag="BT0504"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002658998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease"
                     /protein_id="WP_011772450.1"
                     /db_xref="GI:500096443"
                     /translation="MSYITFSSILAGVLGIVLGFLIRIILGRFSLLNLDKKLKKVQEE
                     AIVEIENEKKRVISHAKAQMLKEKNQQDREIRERKNEVFNLERRLLQREETLDKRISA
                     LDKQQSRIDFKLKEFEQKEKIIRDKELSLVKKLENIAGLTKEEAKKIVIEKVENESKR
                     DAQIIINKSEQEAQLLADKVAKDILVSTMQRIVTEVSSEFTVTSVELPNDEMKGRIIG
                     KEGRNIRVLETLIGADIIIDDTPEAVVISCFDPVRKEIAKRTLERLVADGRIHPARIE
                     EIVYSVTNEINNIILEEGEKAVFDLNIHGFDKRLIRGLGRLYFRSSYGQNVLSHSKET
                     AIIGEILAKEMKLDPIVVKRACLLHDIGKGMESISENSEGHAITGAELAQSCGESDIV
                     VNAIAAHHNEIKPESFEAIVVQIADAISASRPGARRESLNNYINRLKRLEEIAYGFEG
                     VQKCYAIQAGREVRIIVDNLLINDEKATMLARDIAKKIEVEMRYPGKIKVTIIRETRV
                     IEYAR"
     gene            513456..514247
                     /locus_tag="BT0_RS02510"
                     /old_locus_tag="BT0505"
     CDS             513456..514247
                     /locus_tag="BT0_RS02510"
                     /old_locus_tag="BT0505"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772451.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoesterase"
                     /protein_id="WP_041178487.1"
                     /db_xref="GI:752506622"
                     /translation="MQDNDVIRALIIGDVIGNGGLKKVFFNLKNLKEKYNIDLTIVNG
                     ENSSGGFGITPEIAENLFKAGVNVITTGNHVYADHSIREYLDKQEYILRPNNFSDLLE
                     GHGYCILNVKNEKVAVINIQGFVGMTFIVKNPFENIKKVVNMIRNKVKTIFVDFHAES
                     NYEKESFGYFLNGLVTGVVGTHTHIMTQDERILDKGTAYISDLGMTGSLNSVIGFNPE
                     ISLKGLLEYVALRTETVEENVIIQGVVITSHLKTGRALKIERIQK"
     gene            514228..515019
                     /locus_tag="BT0_RS02515"
                     /old_locus_tag="BT0506"
     CDS             514228..515019
                     /locus_tag="BT0_RS02515"
                     /old_locus_tag="BT0506"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772452.1"
                     /note="contact hemolysin TlyA-related protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S rRNA methyltransferase"
                     /protein_id="WP_011772452.1"
                     /db_xref="GI:500096445"
                     /translation="MKEYRNSLLNVLCKNYPGLTREELRILILTGRVYVNSHKERNPK
                     VLLLRNSKINLIESESRQFVSRGGHKLFESLETFKITVKDKICIDVGASTGGFTDCLL
                     QEGAKLVYAVDVGFNQLSYKLRVDPRVKVFEKTNIFAIKQFDIQPNLAVIDVSFRSVI
                     SICANLIDKLSDKLIVVLVKPQFELKGLNLDIKDFNGVVGKRYLSKILNKVIKKFYDN
                     NLQIKNILKLATKGRKGNQEFMFLVVKDNSMNLMQSLALLDDINF"
     gene            complement(515016..515774)
                     /locus_tag="BT0_RS02520"
                     /old_locus_tag="BT0507"
     CDS             complement(515016..515774)
                     /locus_tag="BT0_RS02520"
                     /old_locus_tag="BT0507"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="germination protein GerM"
                     /protein_id="WP_011772453.1"
                     /db_xref="GI:500096446"
                     /translation="MIRKKRNSKRKTSSFNQIDIFLVLFAIFLTGLCLLLIIKNSLIK
                     NIFNEQINNNDNFEFSQSKPNKIEAKLENTKNETIKILNNEKFLIKPPEIQKIEEEFK
                     YQEQKYLKNKKEVKLYFIKVTAEGHFLKQWIKRTIQYDKNILKETLKALINGPNEYEL
                     KNNFLSLIPINTKVLNLSINDGIAHINLSKEFYENSFGVEGTINQVKQIILTCLEIQG
                     INGITLKVENNPIILEDLNLDFSGILDNKKLAKY"
     gene            515861..517177
                     /locus_tag="BT0_RS02525"
                     /old_locus_tag="BT0508"
     CDS             515861..517177
                     /locus_tag="BT0_RS02525"
                     /old_locus_tag="BT0508"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772454.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated GTPase EngA"
                     /protein_id="WP_011772454.1"
                     /db_xref="GI:500096447"
                     /translation="MIGSKVQDYKSVLIVGRPNVGKSTLFNKLLSSNRSITDEIYGVT
                     RDLIKEICTVDSYKFYLIDAGGFTLLRDELSRVVVNKVISLLDSIDLILFVLDVNEIL
                     SEDYELIERLRKYSDKIVLVLNKIDSHHKQALTYEFQNLGFQKSFLVSATHGKGVNSL
                     RIFLKNSVGKLAIDDNVDVKIGLIGKPNSGKSTLINFLAGREVSIVSRVAGTTRDFVK
                     ARFQRNGKTFELIDTAGIRRRARVNELIEHYSVSRALRVIDMVDIVFLLVDVKEDLTA
                     QDKKIAHYATKRGKGIIIVFTKWDLVKSKSGYFEALKNRVKFFFPILNFSPILRISAH
                     RREGVDNLFKEAIKLKKQLELKISTADLNKMLSLWIKDYHLNASHKVKYITQISVNPV
                     KFILFANKITNFPNSYYNYLVNNIRKIGYYNIPILIELREKTRDLK"
     gene            517174..518433
                     /locus_tag="BT0_RS02530"
                     /old_locus_tag="BT0509"
     CDS             517174..518433
                     /locus_tag="BT0_RS02530"
                     /old_locus_tag="BT0509"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772455.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772455.1"
                     /db_xref="GI:500096448"
                     /translation="MRYIFLFLIVANLNPFAFENFFYDFSVRANYAKYFNSRNTAFKI
                     KPQKYYISDDYYVEVSNSILGDYAYYSFFNRKNGASYIFPGSYVIKVGRYGIEQIKIF
                     FLNRADTFIRIKAGDVHSSADFYLINTFIYKDIKLPFKISDIATGSFLEIVKYISNFI
                     DFELFRPRSLEAYDNISNIVDSLRAFLKVSPLIFEVHDGAMNELGEMVYIRTGEPQRE
                     PIGFNCSGFGKWVADSIYKAMTGKLLKIKDLKVKHIGIRGNSFTKYYEFSRDPFFGLD
                     WTRNIAYKLKNVDADLDLSRVKELDVNNIGFLKYIENRGYEIDNLEFILYYLAVKEPG
                     HMYFGSLNTTINGFPGKVFHKHVVVLFPFIDRESIFRVSLMEINDETSIKSLRGRYPN
                     SYIHLVRAKVPKNISIVPIPKRINKDK"
     gene            518443..519129
                     /locus_tag="BT0_RS02535"
                     /old_locus_tag="BT0511"
     CDS             518443..519129
                     /locus_tag="BT0_RS02535"
                     /old_locus_tag="BT0511"
                     /EC_number="3.1.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772456.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_011772456.1"
                     /db_xref="GI:500096449"
                     /translation="MIKAVVFDLDGTLYPEININLIMFPEFLKNIKFFLAFKKVRKEI
                     RCLQKGRSIPSSRDELMSIQIKMLAKHLGFDENRCEFLLNKIYYGKSFRNKFRNLKPY
                     FGVHDLIYSLKSKGIKLGVMSDFPIATRVSNLLGIEDSFWDVLYSSEETGYLKPNKIA
                     FLRIMDELGIDSNHILYVGNSYEYDILGASGVCMRTAYLSKKKLLKDMKCDFIFSNYK
                     DLQRYILLNI"
     gene            519149..526036
                     /locus_tag="BT0_RS02540"
                     /old_locus_tag="BT0512"
     CDS             519149..526036
                     /locus_tag="BT0_RS02540"
                     /old_locus_tag="BT0512"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772457.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178488.1"
                     /db_xref="GI:752506623"
                     /translation="MIDFVTVLVNLLLVFVILFIYRQYDRRSRALDKIKKFIDIAKDN
                     LEDFIDEKTKEINNLAVDMEAYQRSSIEIIKKIDEVQRKIKDKSNDFAEVEKKIAYHD
                     SMLKELDDMALKVQDNIQRLQVDGKIVDKLSKTLKNFNTQIDSIDSRLSTVFEKFDKT
                     NKENLETIKIESWDKFDNTIKDFSVRMDNLDRELISYQESLVMIEEKKREILDKGNEK
                     LENEFKEFVFKIESSIDNYNKSMEDSFGIYETKYKSIENSLDLIVEQAKTKINDKEDF
                     ILTRLNEELQIKFDEVFMYVDERSHQMRDKLEGKLVLIDNEISSLSSVFKDNTYSRLN
                     SLEETIRQEMRQYEEQLADILEQFRVQIESSVGDIYKEYDSKINQFDKDIRDRIESSL
                     KDANSRIESVQGGVRTLLDDLEKDSNKIYVEFKDKVKGDIDSFSENVFSRMNDVGSEL
                     ELKLSNISTDIQDRIAKLDSSLYSELKEMNEKFVNDYSCLDGSINLKYETLLEALNLK
                     SGELETQLKDKYKNIADKFERDIDDLTIKCDENFSKISEKSDYDYQNFEITSTKLKES
                     ISSLNDLLVQDFETLKGDFKSKLSKMSVDINDEVFNLKSHYGEDISEFIKQMEADKLQ
                     YEHWQREVGLNLEDIKSHLNKTNEEFLNLIENQRTKGKELSENIFNELSEHIQKKAMD
                     MHTNWKDELIILNKSLLDIKISSEELLLSASSKIDSFEKDVNERLEYVTSKTEDFESS
                     VLDKYKELRDMSYNNSEETLSGIKEFIDNQAEIIHDKIIMMLNGLNEDFSNKEELIKG
                     NIEELDYRLKDFKVGCEDVLNNLRSELDGFIESRMQKVSEIKIDNQKQIDNFLNRISE
                     DILSKRDMLNSEIDNKLNDWQGKLSEISVNIENVLSSGKIDINSIDSEMTLKIKDLKS
                     TFEGLESYYLEKIDEFRNQGNVYADELLKNIMSHFDTDTKDLEESLSKKFATVLERSE
                     EFVKEVDSLLKDKRTDIASFQASIDITIDSLNSRFNDVNREINEKYSKVISDSRGYSE
                     TLANKLENEIGYEIENVNRRLTDKIDILSKNMDENLENFKSSFDVSKYQVENFEIKIK
                     DIIEKEELRLGELLREIERQYRVRWDEAIDYKKAIDSDILQLREQFIGVINELKNNIE
                     DKSEFLNDLYKERFKIIENNFEERYSTFFIESEGAISKIRDEIYKILTDNDEHLRAKI
                     SEMDLNFEIIDGRSKEILELEEDLRKRIQEDSNNIHHQFDVIKSGLEKEIKDHFDMYM
                     MKATAAIDEEIEKYEHGINEKISALKSIENNFEMIEKNLKDKISEYHNKLDETLDVRY
                     AELEGKYDEKHLLVEKKINEKTNSVEELIANKYAELEGKYDEKHLLVEKKINDKVNSV
                     EELIASKYAELEGKYDEKHLLVEKKINDKANSVEELIASKYAELEGKYDEKHLLVEKK
                     INDKANSVEELIASKYAELEGKYDEKHLLVEKKINEKTNSVEELIANKYAEIDSKYSN
                     MHLDMESRFNACISDLGIELARSSEKMDKEIEEQLKNLGELKLSLSNIEGDVLKLKED
                     SYHNVSSHLKLLEEDFFKDLKERSDNLKNSLENFVASSDQRIENLERHIIKNLEDKEI
                     LMKNFRVEIEQELMLNKESFYSEFNKEFDVRKRDTESKIVVMETNVTNRIDEFIKLVD
                     NRQNNVDSWFLKVKDDMINWQENAYKELEERAGITKRNLDEIKSDVSAIESGLEVVKD
                     GVNQRAKEIFDRLQSDIKDFENRSYLNLKNISDEVQSKVLNIEDFMDFKIKSINDKID
                     SHIEELATQVEIKFLSQQKDIEDKIIEANDKLEYEFNSMASRLDEEKQNIVSKFLNDT
                     GGFESQVQLMQDDVLKLTEKVNAYRIDIEKTIRENYDSFSSSIREEYTVFENEVKNSL
                     NYSEEEIQALRDSLKVQVNSIESEFKDKYDLMIKGIDDHVSQLKLKVLNYDGELNHFI
                     DEVKDNLIVYKADLREELDSRYAVMSAKLENFKRLEVELERNNELMKEVYYFKNNLEE
                     LRETLASEINLIQGYKGDFEGITREIGDIKSKSSDIIEVFNDLKVHQMDIEGIKKDLT
                     QFLEFYTSFKERYKKFTESYDEMQIYKTKLKEIKEAQSNILDNYDRISNKDSILKSTL
                     ESVDKNFDLINEIESKMHVLFKESSGFQQSLGELKGIMSELLVNKDLSQEVLNNVQTL
                     KEMLGEIESKLEHTRNIREKVAKSETRLENLNIAAEERIKTLGILVKTESKYKDNVGL
                     NNETVRDSVIKLMRQGWSALEISRATKLSIGEVELILELGIISKSDD"
     gene            526049..527596
                     /gene="pheS"
                     /locus_tag="BT0_RS02545"
                     /old_locus_tag="BT0513"
     CDS             526049..527596
                     /gene="pheS"
                     /locus_tag="BT0_RS02545"
                     /old_locus_tag="BT0513"
                     /EC_number="6.1.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772458.1"
                     /note="catalyzes a two-step reaction, first charging a
                     phenylalanine molecule by linking its carboxyl group to
                     the alpha-phosphate of ATP, followed by transfer of the
                     aminoacyl-adenylate to its tRNA; forms a heterotetramer of
                     alpha(2)beta(2); binds two magnesium ions per tetramer;
                     type 2 subfamily; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit alpha"
                     /protein_id="WP_011772458.1"
                     /db_xref="GI:500096451"
                     /translation="MKNRFEVVRTLHPLEIKVILNYKEGDEIFALRLVADLLYNEGQS
                     NKTIEWLVSKGILRETFRKLNVFYRLTERGVDALANGLVEERIINLVSRKTVLVANLP
                     SELEIDARDAGKAFGNLSKEGVLSLGLGKEILVKDLNRSSYNIVKELLSKAQNSDLLE
                     DDLSQDELLVISNYSKKKGAGDVLFKVIESLDLKFEFSKFGLEVKSELGRSNLTGDEI
                     VKLTPEMLKNKTYENKNFRAYNIHVSSNKTFIGRANPYSEYIAKVKDKLVSLGFEEFD
                     GPLVESEFFNNDALFMPQFHPARDIRDVYYIKEPSSLKSLPEPYFSNVKAVHEDGYTT
                     GSRGWRYDFSESISKRLVLRSQGTVLSAKQLIDAKNPGKYFGIVRCFRYDQVDATHGA
                     DFYQTEGIVIGDVNIKTLLGLLEIFAKELAGATEVKYVPAYFPFTEPSIEVHVKHPVL
                     GWFELGGSGIFRPEVTKPFGIDVPVIAWGIGIDRMALMHLGLSDLRELFTHNIGDVVL
                     RRGKVNA"
     gene            527589..529283
                     /locus_tag="BT0_RS02550"
                     /old_locus_tag="BT0514"
     CDS             527589..529283
                     /locus_tag="BT0_RS02550"
                     /old_locus_tag="BT0514"
                     /EC_number="6.1.1.20"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZU9.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phenylalanyl-tRNA synthetase subunit beta"
                     /protein_id="WP_011772459.1"
                     /db_xref="GI:500096452"
                     /translation="MPKVEIYKSILLEKIGKILTKSELVSVLEMAKAEICEFDTVNDK
                     IKIEFNDTNRPDLWSCAGLARQIKTYLFGHLPLFKFFSMADNLQEFYGEILVSPEVFS
                     IRPFIFGFLAKGVICNERMLETLIQLQEKLCHNYGQKRKRVAMGMYSSDLIEFPLSYT
                     ACNSDYRFIPLGMDREMSIEEINRVHSKGIEYSTILASFNKYPLLLDDKDKVLSYPPV
                     INSHDIGALKVGDTDLFIEVTGTNLEATLLSLSVTACDLHDMGFEILPVKTIFPNETL
                     FGKEIICPYYFQNMLEVNVDNVNKMLGSNFTANNMCLDLKKLGISAYFKELDKFYVIP
                     PVYRNDFLHEVDVIEEIMIGMGLDSFKPELPKDFTLGRLSQIEEFSRKIKNLMIGMGF
                     QEMIYNYLGSRTDFIEKMNIEGDDFLSVANPMTEGYEYIRGSIVSDLLKSESISSNFP
                     YPHKIFEIGKVALKDLNSVDGTITYDNLAFLMADKEFSFNEINSLVSSLFYYLNIEFK
                     LRESSKSLYIDGRGVDILINDTVLGGFGEVSPYILRNFGIMVPCCVLEINLNKLLN"
     gene            529382..530359
                     /locus_tag="BT0_RS02555"
                     /old_locus_tag="BT0515"
     CDS             529382..530359
                     /locus_tag="BT0_RS02555"
                     /old_locus_tag="BT0515"
                     /EC_number="1.8.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin reductase"
                     /protein_id="WP_011772460.1"
                     /db_xref="GI:500096453"
                     /translation="MLKFEVLDIKKSNKKVLRTEMNSIEDVIIVGSGPAGLTAGIYTV
                     MSGYKTVILEGPEPGGQLTTTTEVYNYPGFKNGVNGRELMLNMKDQVINLGAITYLET
                     VTSIEKRDNIFYLFTDNYIYKSKAVIIAAGSVPKKLNTLKNSDLFWNRGISVCAICDG
                     HLFKGKTVAVIGGGNTAISEAIYLSKLSEKVYVIVRKDYLKAIAMLRQNVEKLPNVEI
                     LYNCEAIEVNGDNIVSMVQIIDNKNNSTFELSVNGIFVAIGYKPNTEFVKGFLELDED
                     GYISTQDLVKTSVEGVFSCGDVSNKLYAQAITAAAEGFLASVELRNFLG"
     gene            complement(530388..531122)
                     /locus_tag="BT0_RS02560"
                     /old_locus_tag="BT0516"
     CDS             complement(530388..531122)
                     /locus_tag="BT0_RS02560"
                     /old_locus_tag="BT0516"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rRNA methyltransferase"
                     /protein_id="WP_011772461.1"
                     /db_xref="GI:500096454"
                     /translation="MYITHANSIIESIKNNKGLELYISKISPKSINIEKIAREYNTQI
                     IKVNDLAKIIGNNNHRGFALKLKISKSNNTNKQDKNLEEFLEKFQYKNNVFILILDGI
                     EDPQNFGAILRTSEQFNIDLVITSQRRSAKDNATTLRTSSGASQYVNKLIVPNINNVI
                     KDLKKNGFWIYASDIKGKAINTIKINDTKIALIMGNEGKGIHKLIKENSDFLVKIPTT
                     GKIDSLNVSVSTGILIFEIKRQLNLL"
     gene            complement(531124..532221)
                     /locus_tag="BT0_RS02565"
                     /old_locus_tag="BT0517"
     CDS             complement(531124..532221)
                     /locus_tag="BT0_RS02565"
                     /old_locus_tag="BT0517"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772462.1"
                     /note="chaperone Hsp40; co-chaperone with DnaK;
                     Participates actively in the response to hyperosmotic and
                     heat shock by preventing the aggregation of
                     stress-denatured proteins and by disaggregating proteins,
                     also in an autonomous, dnaK-independent fashion; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_011772462.1"
                     /db_xref="GI:500096455"
                     /translation="MKRDYYEILGLSKGASKDEIKKAYRKIAIKYHPDKNKDNKEAES
                     IFKEATEAYEVLGDDNKRAQYDRFGHTAFEGGGGFSGFSNGFSGFSDIFEDFGDIFDS
                     FFTGRRGQDKNRQNEKGQDITYQIEISLEDAYLGYKNNINIARNMLCESCLGKKSEKG
                     TSPSICNMCNGSGRVMQGGGFFRVTTTCPKCHGNGKIISNPCKSCKGAGSLKYKETIE
                     LKIPAGIDDSQQIKMRGKGSVNPDNQQYGDLYIRVSIKPHRIFKRNGKDLYATLPISF
                     TQAALGKEIKIQTIAEKKIEIKIPKGTENDEQIIIKNEGMPILHTEKFGNLILIIKIK
                     TPKNLSYNAIRLLEDLSKEINDIDKVTLNKI"
     gene            complement(532221..534119)
                     /gene="dnaK"
                     /locus_tag="BT0_RS02570"
                     /old_locus_tag="BT0518"
     CDS             complement(532221..534119)
                     /gene="dnaK"
                     /locus_tag="BT0_RS02570"
                     /old_locus_tag="BT0518"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RM75.1"
                     /note="heat shock protein 70; assists in folding of
                     nascent polypeptide chains; refolding of misfolded
                     proteins; utilizes ATPase activity to help fold;
                     co-chaperones are DnaJ and GrpE; multiple copies in some
                     bacteria; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaK"
                     /protein_id="WP_041178489.1"
                     /db_xref="GI:752506624"
                     /translation="MGKIIGIDLGTTNSCVAIMEHGKPVVIQNSEGGRTTPSIVAYTN
                     KGERLVGQVAKNQMVTNPENTIYSIKRFMGRRFEEVASEIKMVPYKVEKGQNGDARVN
                     ISNIKKQMSPPEISAATLTKMKETAEAYLGETVTEAVITVPAYFNDAQRQATKDAGKI
                     AGLDVKRIVNEPTAAALAYGIEKKNEEIVAVYDLGGGTFDISILELGDGVFEVKSTNG
                     DTHLGGDNFDDEIIKHLITEFKKDSAIDLSNDKMALQRLKEAAEKAKIELSGAQEASI
                     NLPFITADANGPKHLQYTLTRAKFEQMVDHLVQKTKEPCLKAIKDAGLKASDINEVIL
                     VGGSTRIPAIQKIVKEIFGQEPNKGVNPDEAVAIGAAIQGGILTGETKDMVLLDVTPL
                     SLGIETLGGVMTKLIERNTTIPTKKSQVFSTAADNQTSVDIKVLQGEREMASQNRVLG
                     NFILDGIPAAPRGVPQIEVSFDIDANGIVHVSAKDMGTGKEQKIRIESSSGLSEDEIE
                     RMVKDAEAHAEEDKKLKESIEAKNIANSLIYQTEKSLKEYGEKITSEDKEAIENKIKE
                     LKDALEGSDIALIKSKTEELQQASYKIAEMMYKDAQSSSSNQDNAQNNASSESKEADY
                     EVVDEDKK"
     gene            complement(534154..534702)
                     /locus_tag="BT0_RS02575"
                     /old_locus_tag="BT0519"
     CDS             complement(534154..534702)
                     /locus_tag="BT0_RS02575"
                     /old_locus_tag="BT0519"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperone GrpE"
                     /protein_id="WP_011772464.1"
                     /db_xref="GI:500096457"
                     /translation="MKEKEQCEEPEKIKEQKNDILPNEDSPNMESKVTELENEISNLK
                     DLYLRKQAEFENFRKRLEKDKENFIKFANENIMKDIINFLDNLERAIDSSKQSRDFDT
                     LLSGISMIESEVLSSFDKKYNLKKFGKPGETFDPSQHEAISIEEKEGVKIPEIVEVYQ
                     KGYCYNNRVLRTAKVKVAQSKN"
     gene            535271..536821
                     /locus_tag="BT0_RS02580"
                     /old_locus_tag="BT0522"
     CDS             535271..536821
                     /locus_tag="BT0_RS02580"
                     /old_locus_tag="BT0522"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD+ synthetase"
                     /protein_id="WP_041178576.1"
                     /db_xref="GI:752506711"
                     /translation="MKICIAQTKCRVFKFKHILGVFKKNYEYALQNKVDILVFPFIFV
                     GGIEYENLFHRAEYLKKILDGLDFIKDQVDDRLCVVFGHYSFYEGKLLDCVSVVNDHQ
                     FVLTTREVNKPFLFNYKGQSIAVLNLDDDLLFQGLEDKFNGSFSKADYLLVPSKSYFT
                     GEKNNLRLKFFKEVAMKNNLEVVYANLCGVYGSTVFDGLSFFINEYGKIKQAKKFEDD
                     ILFNEGFHDLELDCESKIFDKLIEALISSLREYVDLSGFDKVHLGVSGGIDSAVVAYI
                     ACAALGAHRVVGISMPSRFSSKGSVFDAKELARGLGFKLIDMPIEGMFQFVLEFFNGY
                     FNTKGVTEENLQARLRGLFLMSYSNANKSLLLNTGNKSEIAVGYCTLYGDSCGGIALI
                     GDLFKRDVYNLAKYINLREGRSVISVNILSKEPSAELRPDQKDSDSLPKYEILDEILS
                     RYLLENEPLELLYESFGKEVVAKVLDLYSSSEYKRRQGSMIVKVSRKAFGDDILLPIS
                     KVALTEDE"
     gene            536814..538397
                     /locus_tag="BT0_RS02585"
                     /old_locus_tag="BT0522A"
     CDS             536814..538397
                     /locus_tag="BT0_RS02585"
                     /old_locus_tag="BT0522A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="regulator"
                     /protein_id="WP_011772466.1"
                     /db_xref="GI:500096459"
                     /translation="MNSNNVISILNEFSLKLEDIFLLINTYSYELYKETPRYFYDDIT
                     NCLELTLEIVNKFQGEFEGSQDLSLGKFLIRSMKCDLVSYLYLSLELIDNSMHYSGIR
                     DAGIAFFKAIAYKISSIISYIEIELENVFLSSSLASRQALNKDGHKILIFSCDSIYSK
                     RLTDYLILGDYIVVSADAVDLFNQLLCNDFYDLIILDLSSDEDIQLILNLLKNIKNNG
                     LYEMIPVIVISQISEKDIIQIFIEERVDDYFLKSLDFLVLGIRISSFIEKKKIIEQGQ
                     KYLDFVLRGRKYFESELIEAGNYIENLLPKKMQNEFFNSNWIFVPSKRIGGDFFNYYF
                     VNDDNLIIYLIDISGHGIGSALLSLSVSSVINSYIMNNNDISPSEVLRYVNRYFVKFK
                     SDMFITLWYGVLNVKTRHLRFASAGAPPAVVLNAKDNVYLQTRGAILGIKEMYSCEEN
                     ECILSKFSHLLLFSDGVYEVENEQDVIMAIDDFYKILKDNTYDLDDFILVRLYKKMLN
                     LSRYNAFRDDFSILEFILN"
     gene            complement(538523..538957)
                     /locus_tag="BT0_RS02590"
                     /old_locus_tag="BT0525"
     CDS             complement(538523..538957)
                     /locus_tag="BT0_RS02590"
                     /old_locus_tag="BT0525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772467.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772467.1"
                     /db_xref="GI:500096460"
                     /translation="MKIPKNYIPGTNPYKSLPKKPIIESKKLSKKQEQINAEIMNSQE
                     RILKLYMRRLQKKDQIILQNFIMEGHKVGSKIFNNLSRILKEIITIMNIESLKVLLRN
                     TKNPIKKLYIKFSTWTLNKLLKSINSSNITQDKQTSKKNVKK"
     gene            539075..540883
                     /locus_tag="BT0_RS02595"
                     /old_locus_tag="BT0526"
     CDS             539075..540883
                     /locus_tag="BT0_RS02595"
                     /old_locus_tag="BT0526"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772468.1"
                     /db_xref="GI:500096461"
                     /translation="MNKYCGLSFFYLLIGILFLFLIVFIQFRDLSLNVFLLKDLKLLV
                     NNKVEDSQYVLDSLILSIRGIKINLSKTKPIIIPANGLHLYPISYKVQDNAIHVYFEN
                     NIFLLFSFDSNDNFNVSSNLSKKLLISYEIESDYKVLFDENIIIKGTDGHFEVALGKH
                     SQMNEREISVSPQEVFQIGNLVEESQTSDELISREPSRDIPLDINSPVVYSLIKKVDK
                     SFFDSALLEFRNKAYDAWSHKSNFSVEKGGWRRGNVYSFDEDIFIYLLAESLRRPNYE
                     ATFLNLKSLIDLNEDHLTYLSASYYVNAERLGKFFRYLSVNKTFINSLESDKLLRYLK
                     EDAYLLEKIFLSENISILNGALDILRKPEVILASGFSLTQAYNVLSNYIIFLQFDNDS
                     FVLGRLREELTKFVSTLFSVTSHGEAYVSDNKDDLSWDFEYTLKIAGLLKRLAFQLGD
                     DLILEFAFNAIYYSLLKPDIEKIPYENYYADIVDNDYIPKFSLFPNLGIGHWIYGASK
                     IVNFNFSNAFYSIDFNRNLNSPGYFFFKGISNPTLVKFRNISWFTDPRFYIYSDGWRY
                     YSDNKILVLKITPKKPDDMKILLRFDDIKVLKDIDE"
     gene            540876..541661
                     /locus_tag="BT0_RS02600"
                     /old_locus_tag="BT0527"
     CDS             540876..541661
                     /locus_tag="BT0_RS02600"
                     /old_locus_tag="BT0527"
                     /EC_number="2.7.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772469.1"
                     /note="type III; catalyzes the formation of
                     (R)-4'-phosphopantothenate from (R)-pantothenate in
                     coenzyme A biosynthesis; type III pantothenate kinases are
                     not subject to feedback inhibition from coenzyme A and
                     have a high Km for ATP; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="WP_041178490.1"
                     /db_xref="GI:752506625"
                     /translation="MSKLVASVQLIIDIGNTSISFALYGLDKMQIFCKLSTKRDLSFK
                     ELYEFLKFKFDCKVDQVFVSSVVPVIDKVLINVIVALYKVNPLFIRFDLNYDLSFDLY
                     NTNRFVLGSDVFANLVGAIEYYNINDALVVDLGTACTIFAISRKEGILGGLINGGPFT
                     SLNALIENAYLLTDFDLAVPKKLLGLSTVDSVNSGVIYQYKYLIEGVYHDLMRNYDRK
                     FKLIITGGNSYLVLPLISLDFVSNLYLTLEGIRILGNAFKVVY"
     gene            complement(541950..542756)
                     /locus_tag="BT0_RS02605"
                     /old_locus_tag="BT0530"
     CDS             complement(541950..542756)
                     /locus_tag="BT0_RS02605"
                     /old_locus_tag="BT0530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772470.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772470.1"
                     /db_xref="GI:500096463"
                     /translation="MQKNKDTILDILEWIYNKYNKREFVHPDPLEFLYKYTEKEDIEL
                     AGLISSSLALGRVERILTAIESVLKPLGNKPSKTLKTLKKEELDIIYKDFTYRFFKTE
                     DIVRLLMSFKKVKEKYLTIENLLHNIYKKNKNFISSLDDLITQMENINGHQFGIILPK
                     PSRGSACKRLFLFLRWMIRKDDVDLGIWNKFSPSNLIVPMDTHMTNISSKLFNLKNKK
                     NVSIQRAIEVTKHFAKENKDDPVKYDFSLTRFGINREFNKEELFTNIFKL"
     gene            complement(542743..543354)
                     /locus_tag="BT0_RS02610"
                     /old_locus_tag="BT0531"
     CDS             complement(542743..543354)
                     /locus_tag="BT0_RS02610"
                     /old_locus_tag="BT0531"
                     /EC_number="3.5.1.28"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772471.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucosaminidase"
                     /protein_id="WP_011772471.1"
                     /db_xref="GI:500096464"
                     /translation="MQKKFILLTICLTLLTVKSYCIEEIIEINTEIQKEKYIPFLLSK
                     GISQVEDLVKYTLKMNPYLEAEYVKTIAQTYIDEAIIEGINYDIAYAQMLLETGILKF
                     NGIVSKEQHNFSGIGATDNFTKGSSFSNIKEGIRAHIQHLKAYASRQNIKSNMVDPRF
                     YLVQRGSAPTIYDLTGKWAKDKFYDKKLKKILLGLLESDNAKK"
     gene            complement(543357..544643)
                     /locus_tag="BT0_RS02615"
                     /old_locus_tag="BT0532"
     CDS             complement(543357..544643)
                     /locus_tag="BT0_RS02615"
                     /old_locus_tag="BT0532"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772472.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772472.1"
                     /db_xref="GI:500096465"
                     /translation="MHEQSYETIFLISFSIFLIINFFNFKREFSYEDYFIIFPGIFFI
                     ITLYLIEVRPLMFYTGSIFLFFLITTTMKTIKTIILRRQTKKKDNKLRRIIFTIPFKI
                     MIVLPSIMVVLIATIFSYLGFFTDYQKDVNSTYKIGFTKVKDHKNNLNLSVWYPISLT
                     LGFKSQNPFFYYDFNPFFINEMNYLPKYENVYKDAPISDNQKLYDSILVILPFYSHDS
                     MFKSFVNRLVKKGNIVYLYAPQYRHINTHNFIKNKNAGLLAHISNTTIKYLIEPIKIF
                     SDRKDKISEVTEIQNILELIKSTQKLKFLNLRTDLNQLTLITMGNQANIANEIISKNK
                     QIKKYINIGGKPQSSKIKALQLLIKQDENEWQKTDIDPSSIKVINMNHIGEISDFIFS
                     RSYLESFNFFKDKKLMLPRFDFITNEINQFIEDRGS"
     gene            545035..545793
                     /locus_tag="BT0_RS02620"
                     /old_locus_tag="BT0533"
     CDS             545035..545793
                     /locus_tag="BT0_RS02620"
                     /old_locus_tag="BT0533"
                     /EC_number="3.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-dependent hydrolase"
                     /protein_id="WP_011772473.1"
                     /db_xref="GI:500096466"
                     /translation="MLGIFLGTGSSSGVPMLSCDCRVCSLNFGKNKRLRSSFLINLYG
                     MNLLIDTGPDIREQLLRENIVKLDLVLYTHEHYDHIMGLDDIKFYTRGAPLSIYARES
                     TMQHIRNAFPHNFSSKVSISGKANIIPNLAVDLQQIFFRGIKIMPIPLLHGDIISLGY
                     RINNLAYLTDVKFIPEISYNYLKGLDVLVIDALRLKPHPGHLNFDDAIVEVKKIDPKI
                     AYFTHISHDVMHEEFDYLKRDNIYLAYDGLQIHM"
     gene            545813..546571
                     /locus_tag="BT0_RS02625"
                     /old_locus_tag="BT0534"
     CDS             545813..546571
                     /locus_tag="BT0_RS02625"
                     /old_locus_tag="BT0534"
                     /EC_number="3.1.11.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772474.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease III"
                     /protein_id="WP_011772474.1"
                     /db_xref="GI:500096467"
                     /translation="MNLISWNVNGIRAIFGKGFLEFIEKYNPDVLCLQETKAFKEQLP
                     KELINIEGYYSYFSKSIIKGYSGVGLYSKVKPIKLENMNMEIFDREGRCLIAHYRDFI
                     LINAYFPNSQSLRKRLPYKLEFLMSLESIANMFVTSGKNIVICGDFNIAHTEIDLANP
                     KTSRESAGFYIEETTWMDNFLNGGYVDTFRMFNMDPGNYTWWDYKTRARERNIGWRID
                     YFIVNEFFKSKVKDALILREVMGSDHCPVFLELK"
     gene            546598..547344
                     /locus_tag="BT0_RS02630"
                     /old_locus_tag="BT0535"
     CDS             546598..547344
                     /locus_tag="BT0_RS02630"
                     /old_locus_tag="BT0535"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772475.1"
                     /db_xref="GI:500096468"
                     /translation="MGRYFITILIFFVHGFSFGINLESIDFYRSLEKKDLLFVIHLLD
                     RERYLTQKNELFTYIDLAKQVLSEMGFEVLSGGNELDGIQHINTLQPPENYNSSKFVL
                     KASKALDIFVYFDDNDGFLKTLDGRNVGIQDGKFMILEPVSFKSYDSLSNEHTTIEIY
                     EMSIVNPDFSKFVLDKLKPFVYVGELNKRVYLDDISKLSKGELLFLFYELFPLARLKG
                     VNDWYDFGFSSILKEIKKIYNVKINSRKIK"
     gene            547341..550163
                     /locus_tag="BT0_RS02635"
                     /old_locus_tag="BT0536"
     CDS             547341..550163
                     /locus_tag="BT0_RS02635"
                     /old_locus_tag="BT0536"
                     /EC_number="3.4.99.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772476.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M16"
                     /protein_id="WP_011772476.1"
                     /db_xref="GI:500096469"
                     /translation="MKYEHIDNISILKFIFLILVFLFLSCSSSKLKVDKNLVSGQLKN
                     GLKYYIYGNQLPSKAVHMGILFNVGSLNEEENERGLAHYLEHMAFKGTTDYPGSEGML
                     EVLKKFGMKFGADINAYTSFDKTYYHLDLPDGGNESEIDEALNVLRNWAFQVKFDEVE
                     IDKERNVILEEKKRRENYAGRVAEKIFGVIFNNSKYAVRFPIGLEERILSFKSEDFKK
                     FYKKWYRPDLTSIIIVGDIAPEKIEKKVRERFASLEKPVSEPERVKISLDTIIDKTFV
                     SIEDIETPFPSMNFVVKKKIENNFNTIDDVKRLVEKTLLDELFVNRFYELKIAGTNYF
                     MSFDKFDSQFKSDNNYILINEISFKINPEHFKEAIEGFFYEIERIKRFGFTKGEIDKI
                     KSKLISSAKLNKDNINKRYSSSIAHTLVDVASQGYLMFDMDEYFDIFIDHLSKISLKT
                     ISDFARNEASIDDMAIIYSYSNKSHPNLTFEEMKELRNFALEREIKPYDDVSIQGEFF
                     KKSLERKDIIDEQELLDGISSFILENGVEVYFKHNENKQNVVNFSASSWGGLLSENAE
                     LIPVLSLAPRVVSSSGYGDYSQLQIEKYLSDKIVSLSPTVGDQMTSINGSADIKDLET
                     LFRLIYFTFNEPKIDDVVLQSIIDDIQARIKSRENSSKHLFYSAVERFYNNDDYRLRD
                     IKESDLKNVSKDVLLDFYKKRFTYANNFKFVFVGDVDLETIKNLSSKYLGNLNSKKLN
                     EFRDLDYSYKKSTDRIVIKKGEDSSSLVYILYPFKFNYTPENILNYEALASLLTENLI
                     KTVRREMSSVYSIGVSFEYLLRKHSNSDGFMTVYFTVEPKVLDSVLQVVNEYILEKQK
                     SDFVDKDFDYIKKNIIKNNSIRSESNGYWLSKILGSILWYGALKDTFSDKFIENNLSK
                     DIINMLFKKIDFKQGAEIILLPEKDN"
     gene            complement(550186..551619)
                     /locus_tag="BT0_RS02640"
                     /old_locus_tag="BT0536A"
     CDS             complement(550186..551619)
                     /locus_tag="BT0_RS02640"
                     /old_locus_tag="BT0536A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178491.1"
                     /db_xref="GI:752506626"
                     /translation="MKNILAVLILLTSFYIIYANKKEIKFSISHNNQKKIYYDEDKIN
                     HIVLNLQINENASIEINTQDKNYSYNIPKIINQDKILTIEIKMNNIKSINLNNIIIKN
                     SKNKTARSNPQKFKILINQNEYFIKFNLNNNMFPIIGFKAKEIILSPMITNLCSEKES
                     QKIVLSNFVKYTSLNNKNDEIKSTKNNNMIQISEIGYIDMNAYYDINKPINSDLKFIF
                     NYKKENYRRDSFELFKLIAEPDIYVLKFKNLNDQSLMLKRIAFFIEKKGFRGMLLSNN
                     ELKNKVGWKGHNYRLKDIITFFNVAQKSNIKLNKEEIILKNLIIINKLAHIENNTIKI
                     KDKSRNIAFATYAEDETMSKTAQMTIFMHEILHMYFFTDNNFNKAIFNFWNKNVSSKD
                     KKAWIKFLDNKGYDVKSQYLIINEFFTYTTQISKKDIAKYLTNSKYFSKFGLKRYEKW
                     AITLEELLWKSKGLIAGELLILFEGKI"
     gene            complement(551699..551771)
                     /locus_tag="BT0_RS02645"
                     /old_locus_tag="BTT0014"
     tRNA            complement(551699..551771)
                     /locus_tag="BT0_RS02645"
                     /old_locus_tag="BTT0014"
                     /product="tRNA-Glu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(551735..551737),aa:Glu,seq:ttc)
     gene            complement(551779..551851)
                     /locus_tag="BT0_RS02650"
                     /old_locus_tag="BTT0015"
     tRNA            complement(551779..551851)
                     /locus_tag="BT0_RS02650"
                     /old_locus_tag="BTT0015"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(551816..551818),aa:Lys,seq:ttt)
     gene            complement(551948..552021)
                     /locus_tag="BT0_RS02655"
                     /old_locus_tag="BTT0016"
     tRNA            complement(551948..552021)
                     /locus_tag="BT0_RS02655"
                     /old_locus_tag="BTT0016"
                     /product="tRNA-Lys"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(551985..551987),aa:Lys,seq:ctt)
     gene            complement(552072..552707)
                     /locus_tag="BT0_RS02660"
                     /old_locus_tag="BT0537"
     CDS             complement(552072..552707)
                     /locus_tag="BT0_RS02660"
                     /old_locus_tag="BT0537"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772478.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178492.1"
                     /db_xref="GI:752506627"
                     /translation="MVNKNFCSKIILILLSCLSLLNAQGKEDSLLLYRQGKFQEAILN
                     TQNEIKYNPNNLDARVILIWSLIATGEYKRAELESIKGLEINKHDVRIIQALGEAYFF
                     QGQYKNALKHFQKYIGLEPNGARIAKVYILTADSFYKLERYNEADFAYENALRFLPNN
                     QNILLKLAKARFNAKNTILAKGILTKLLTLNPNHLEAKNLLKKIEKNNHNP"
     gene            complement(552697..553056)
                     /locus_tag="BT0_RS02665"
                     /old_locus_tag="BT0538"
     CDS             complement(552697..553056)
                     /locus_tag="BT0_RS02665"
                     /old_locus_tag="BT0538"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772479.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772479.1"
                     /db_xref="GI:500096472"
                     /translation="MSIDTLEFEENNTQNVIKGNFEFEGYIESNKPIIIEGVLKGIIN
                     STSSIYLREKANVEAEIKCNNFLNHGTMKGNVKALETIKIYKTGNLIGNIKTKELFID
                     SGALFNGNCEMEEKNGK"
     gene            complement(553135..553830)
                     /locus_tag="BT0_RS02670"
                     /old_locus_tag="BT0539"
     CDS             complement(553135..553830)
                     /locus_tag="BT0_RS02670"
                     /old_locus_tag="BT0539"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772480.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772480.1"
                     /db_xref="GI:500096473"
                     /translation="MFELTHEKQEIRIKNKFLAQVFGLMAIGLLISAIFAYTTSENPA
                     MRAIIFTNPMSYIAMILVQFGLVYAISGAIEKISSGTATALFLGYSALTGVTLSSVFM
                     IYTQSSIFYTFGITSLTFLAMSFYGYTTSTDLTKMGSYFIMGLWGIIIASIFNIFFRS
                     SGLNFLISILGVILFTGLTAYDVQNISKMNRMLEDGTEIKSRMAVVASLKLYLDFINL
                     FLYLLRFLGERKD"
     gene            complement(553843..555918)
                     /gene="fusA"
                     /locus_tag="BT0_RS02675"
                     /old_locus_tag="BT0540"
     CDS             complement(553843..555918)
                     /gene="fusA"
                     /locus_tag="BT0_RS02675"
                     /old_locus_tag="BT0540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772481.1"
                     /note="EF-G; promotes GTP-dependent translocation of the
                     ribosome during translation; many organisms have multiple
                     copies of this gene; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_011772481.1"
                     /db_xref="GI:500096474"
                     /translation="MDYKKLRNIGISAHIDSGKTTLTERILFYCNKIHAIHEVKGKDG
                     VGATMDSMELERERGITIASAATHVEWKNHPINIIDTPGHVDFTIEVERSLRVLDGAI
                     LVLDSVAGVQSQSITVDRQLKRYNVPRLAFVNKCDKTGANPNNVKDQLKDKLGLNSVL
                     MQIPIGLEDKHMGVVDLVLMKAYYFEGKDGIEIIEKEIPAELINEAEEKRKIMLDALS
                     DFNDELMELHMEGEDIAVETIYDAIRTGTLALKFCPVFMGSAYKNKGVQLLLDAVNRF
                     LPSPHDIKNVALDLNENEKEIELKTDETLPTVALAFKLEDGQYGQLTYVRIYQGILKK
                     GQELINSRTSKKFKVGRLIRMHANNTEDIEFGSSGDIVALFGIECASGDTFCDPSINY
                     SMTSMYIPEPVISLSIKPKDKKSADNMAKALARFTKEDPTFKTYVDAESKETIIQGMG
                     ELHLEVYIERMRREFKAEVETGMPQVAYRETITDKAEFNYTHKKQSGGAGQFGRVAGF
                     MEPLESEGQTYEFVNLIKGGVIPTEYIPSCDKGFQKAMEKGTLIGFPIVGIKVTINDG
                     QYHVVDSSDIAFQLAAIGAFREAYNKAKPTILEPIMRVTLEGPTEFQGNMFGLLNQRR
                     GIILGSVEEGNFSKVEAEVPLSEMFGFSTVLRSSTQGKAEFSMEFLRYGKVPSTTFNE
                     LCKKFNEQK"
     gene            556331..556558
                     /locus_tag="BT0_RS02680"
                     /old_locus_tag="BT0541"
     CDS             556331..556558
                     /locus_tag="BT0_RS02680"
                     /old_locus_tag="BT0541"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_025375539.1"
                     /db_xref="GI:644922020"
                     /translation="MNTLTISHELSKICQVDYDSALSELSVFFKDGRAYKYFKIEPRH
                     FNIISKLVQEKRSVGKYLTEHIFNKYDQEKL"
     gene            556737..557816
                     /locus_tag="BT0_RS02685"
                     /old_locus_tag="BT0541A"
     CDS             556737..557816
                     /locus_tag="BT0_RS02685"
                     /old_locus_tag="BT0541A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772483.1"
                     /db_xref="GI:500096476"
                     /translation="MKKFLIIIILFLSFSTSYAKFVYFSAGFSTQISLESFSLFNRKT
                     GTVLDKLISFELFTILTNFQNNFLNRLSEFENSAAVLYSSFQNNLNLLIRLFKNRKNS
                     DSQLDNVDDSDLSDLDSLVNSTHDLKKFLRELSKLNNKVTLQKLGETGSSIRKLLVDL
                     EETAKRAIELKEVIFSQLNEFGISNQDDFLRLCEEISTPGTVLNDALRQKLSPLFSTG
                     FQGYFQIGLPIATSNFYYGFELGFGVNLGRMMFPNLNLLKASYPVKLGSGIVPRLFIK
                     YDIYYLAATLFSGFGDRSLVVDPVYTGNLIGNGRVTNPFNVIETGFRLRLAFLSVESS
                     LLFSINDFKYRDLRAGLGFEIPVVI"
     gene            557883..558416
                     /locus_tag="BT0_RS02690"
                     /old_locus_tag="BT0542"
     CDS             557883..558416
                     /locus_tag="BT0_RS02690"
                     /old_locus_tag="BT0542"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772484.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178493.1"
                     /db_xref="GI:752506628"
                     /translation="MYKGLFFFLFYFVLSCKTLAKDYQTISDEYYKLAKLNEELGNNQ
                     ASVELYEQAIKFNSNVNDASTYNFILAYINLKKYDEAGLKLESLLENDQDNILLINLK
                     AYLYFRKENLEEALKLYLKTLEIAPANQEALFNVFYIYHLKKDMETAKKYILKYKELK
                     YSVPSNASEIVSSVLED"
     gene            558510..559142
                     /locus_tag="BT0_RS02695"
                     /old_locus_tag="BT0543"
     CDS             558510..559142
                     /locus_tag="BT0_RS02695"
                     /old_locus_tag="BT0543"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772485.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178577.1"
                     /db_xref="GI:752506712"
                     /translation="MQIKILFLSLLIFITSNAFSDVDFELNLGVGLDFPVSTISNFYN
                     TALYIGEELESNMSDLAREKIVTDFADMVNIAKTGLTYGGYAQMGAKFDDFFSLGFEL
                     GFSFNVLRYVNRKGRLSDIFSFIAAIESRVYTRLDFFIGSVALFTGPRVNMATAFRDS
                     IMDEYDIFGWDLGARSTFAFLVLEGYYCWNIQNNKFSDFKLGIGFEFGVI"
     gene            559320..560540
                     /locus_tag="BT0_RS02700"
                     /old_locus_tag="BT0544"
     CDS             559320..560540
                     /locus_tag="BT0_RS02700"
                     /old_locus_tag="BT0544"
                     /EC_number="2.7.6.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylpyrophosphate synthetase"
                     /protein_id="WP_011772486.1"
                     /db_xref="GI:500096479"
                     /translation="MGLLIKKSIGIIACPGGRVFADKIMEELKKIFLDSESEVIEKIS
                     QTSSCFKEDVLKLEEILSPFLEGLEFSNLRFDESVEIPVNFVKFANGEFKAEILKTIR
                     NKDIFIVQDVSNTYPVNVNNNEKVVMTINDHLMNLMTTIDACMQAKANSVSVIIPSYP
                     YSRQDKKHSREGLTASLFGRFLEELRVKHILTLDIHSKAIENVFRKTYFENLNASYEI
                     FDALAELIDIRDSSLVVVSPDTGAVNRNKFFASNLKRPLALLYKERDYSKVTHNVNDS
                     NISVTKLLGDVEGKNVFMSDDILATGGTLIKAVKLLKSMGAKKIICAISLPFFNGDAI
                     RYFDKAYEEGYFYKIIGTNAVYHDDRLISKPWYYEANVAHLFAGAIFAIHNRVSLQKI
                     LDRSHDIQNLISKS"
     gene            560545..561909
                     /locus_tag="BT0_RS02705"
                     /old_locus_tag="BT0545"
     CDS             560545..561909
                     /locus_tag="BT0_RS02705"
                     /old_locus_tag="BT0545"
                     /EC_number="2.7.1.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772487.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylulokinase"
                     /protein_id="WP_011772487.1"
                     /db_xref="GI:500096480"
                     /translation="MDVLSIDIGTSTLKSALINSHHGVLESFDVNYFDHFNVDFENFD
                     YKIWLFAFKRIISNFKYKKIDCISVSGISPCLIALDSNLVPLEVLHWNSSKVVSNFRG
                     KSSFLPFVLSTVERGVYDKVRYFVSCFEYFIYLLTDNLITSYPSLSYIPFIWNDIEIR
                     KHNLDTNKFPPFLRMGEVAGRVTNSASIEFGIDSGIEVINAGMDYLSVLIGSGAFFSG
                     IVSNRTGTSEGFNFISDAYLSDFSLVYPYFLDNLFVIGRIVPSGYLLQLFKDRLFKKK
                     KSFEEFFEEIPRVYDSGNVYFYLSKRELFSDHILIDSQIRDNLNKGIFGKVDNPLQIG
                     IAILEAAYFSFYNKILQLKSFKRDVLDIFVSGSNSDNLFLNELKSNIIGKDLKIFEFK
                     HAEIIGNAILAFCCLGEFDSLDKAFKKLAKFKQVISFSASMHDVYLEKYHKYVSNFDL
                     FVNS"
     gene            complement(561892..562596)
                     /locus_tag="BT0_RS02710"
                     /old_locus_tag="BT0546"
     CDS             complement(561892..562596)
                     /locus_tag="BT0_RS02710"
                     /old_locus_tag="BT0546"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772488.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sporulation protein"
                     /protein_id="WP_011772488.1"
                     /db_xref="GI:500096481"
                     /translation="MRDFNENNNKGFLVALTSIVTVCTIIFLGIIIFFPNKNLASEIA
                     GKNIILQETKDENVIESENNEDTLAITDKPNEIIIDLTQDIKQDKSFNSSINQNNKKI
                     INKKEPQIINQHQTTNTHTKEEKLQKTQTIAKTKQENKKKQKHNNFENKYDPRKEYYI
                     QFASLADPISADNNIQELMKYKINAKIYSATINDKDTYRVRSGPYKTISEAKLDLNKI
                     SGSSEFKDAYILTINK"
     gene            complement(562597..563193)
                     /locus_tag="BT0_RS02715"
                     /old_locus_tag="BT0547"
     CDS             complement(562597..563193)
                     /locus_tag="BT0_RS02715"
                     /old_locus_tag="BT0547"
                     /EC_number="2.7.1.24"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dephospho-CoA kinase"
                     /protein_id="WP_011772489.1"
                     /db_xref="GI:500096482"
                     /translation="MGRNSSIIGITGRISTGKDTVSKIISSEYGFHEINVDKIGHTAL
                     QAKQDTVVKIFGKQILNNKNEIERIKLRNIVFNDRKKLEKLETITHPLIYKEVEQVIL
                     KKKFDKIIINAALLFKLNLAKFCGHIFITKANDEIIKNRLKSSRNIDENLIINILKCQ
                     KDIFLNKNILNSKIINIINNKSYEYLKNEIRKKMKEVT"
     gene            complement(563172..565931)
                     /locus_tag="BT0_RS02720"
                     /old_locus_tag="BT0548"
     CDS             complement(563172..565931)
                     /locus_tag="BT0_RS02720"
                     /old_locus_tag="BT0548"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase I"
                     /protein_id="WP_011772490.1"
                     /db_xref="GI:500096483"
                     /translation="MKEIYLIDALNIIFRNYHVMKNNPLTNKKGENVNAFIGFFKTLF
                     FIIKEKNPENLIVTFDSETQTFRQQKYPSYKATRDAPPDNLIPQIYWIKESLIKANIP
                     MFEIQGYEADDLIASFAKKAEINNYLTYIISPDKDLLQLMSAKTKILKIENSSFVEMD
                     NDYVMKKFGVNKSQIKDYLSIVGDRSDNIPGIKGIGEKGAAKLLNEFQTLNGIYDNLD
                     SINNKYREILLKERENAFLSYELISLVEDLELPALEKFKLENLKEDILLLFEEYSATT
                     LIKSYKTILKKRYATNQTQKSLFETNINQTDTEILQTTTSHSNALKTIQEENIKYETI
                     LKKEQLDLLIEKLKQANYVAIDTETTSLNVHEAQIIGISVSFKEFESYYIPIETKEKK
                     TIEKAYIIQKFNEFFKAQPKLIGQNYKFDYKILKKHEFNVIPPYFDTMIAAYVIDPNT
                     KVSLDFLAEKYLMHKNIRYEEIVAQNGTLKDIPLEMVSNYAAEDADITFRLFKIFTKK
                     LKEDNLENLMTDIEMPFSNVITEMEENGIYLDKDYLRQYGYELDKELKLIENEIIKSI
                     GIEFNLNSTKQLHTVLFERLNLVLPQNVKQDSTDIKVLETIKEQHESIPKLIQYRQIA
                     KLKNTYTDNLIEFVNEKTNKIHTNFIQTKTATGRISSTSPNLQNIPIKDEKGRKIREA
                     FKPEKGNIFISADYSQIELVILAHLSEDESLIEAFKNKKDIHIKTASQLFKVDEEKVT
                     SSMRRIAKSINFGIIYRMSAFRLSKELSIKREEAQKFIDSYFNLYSKIKTFIQNQIDF
                     VRKNGYSETLLKRRRYIKEINSQNYSERSGAERIAINSTIQGSASDIMKIAMIKVYNE
                     LKSKNLKSKILLQVHDEMLIESPEQECEEVNKIIKTMMENAYPLKIPLKVNIETGKSW
                     GEIHR"
     gene            complement(565928..566326)
                     /locus_tag="BT0_RS02725"
                     /old_locus_tag="BT0549"
     CDS             complement(565928..566326)
                     /locus_tag="BT0_RS02725"
                     /old_locus_tag="BT0549"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772491.1"
                     /db_xref="GI:500096484"
                     /translation="MSTNRILKIYLKDLILELKKLKAILEFENEEINKGMLNILNITN
                     PAKDLILNSINNYYITINSWLKEQEQMQEEIKKLIEDTCLLKEKICIQYHNTHKTLKR
                     LFAQKTTIPKTQLSKTLFKDNNPLLVDVKI"
     gene            complement(566316..566735)
                     /locus_tag="BT0_RS02730"
                     /old_locus_tag="BT0550"
     CDS             complement(566316..566735)
                     /locus_tag="BT0_RS02730"
                     /old_locus_tag="BT0550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772492.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthesis protein FliS"
                     /protein_id="WP_011772492.1"
                     /db_xref="GI:500096485"
                     /translation="MIAKEEIYKKTQINTSSPISILVMLYEKAIQDLELAKEFYKSKD
                     PTSTAKADEKVYHAQDIIIELMSTLNFEDGGDISNNLFSIYSFLNKTLENVILEKNRD
                     NIQEVLKHLKNLHTAWKALLKKDNNIINKKLGINIVN"
     gene            complement(566746..567126)
                     /locus_tag="BT0_RS02735"
                     /old_locus_tag="BT0551"
     CDS             complement(566746..567126)
                     /locus_tag="BT0_RS02735"
                     /old_locus_tag="BT0551"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772493.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_041178494.1"
                     /db_xref="GI:752506629"
                     /translation="MEENKKALIVDDSIFMRKNLIKILKKLGFNEFLEAEDGIQAIKE
                     FEKQEEIHLITLDITMMSMDGITALEKINEVNEKLARKMNVLMVTALGKQELIAKALE
                     LGAKGYITKPFKEEQIAEQIKRLN"
     gene            567342..569348
                     /gene="ligA"
                     /locus_tag="BT0_RS02740"
                     /old_locus_tag="BT0552"
     CDS             567342..569348
                     /gene="ligA"
                     /locus_tag="BT0_RS02740"
                     /old_locus_tag="BT0552"
                     /EC_number="6.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1QZY4.1"
                     /note="this protein catalyzes the formation of
                     phosphodiester linkages between 5'-phosphoryl and
                     3'-hydroxyl groups in double-stranded DNA using NAD as a
                     coenzyme and as the energy source for the reaction;
                     essential for DNA replication and repair of damaged DNA;
                     similar to ligase LigB; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase LigA"
                     /protein_id="WP_041178495.1"
                     /db_xref="GI:752506630"
                     /translation="MIKDIEDEILCLRDNIRKWNKEYYVDSSPSVSDLTYDKALLRLQ
                     DLESKYPEYKTLDSPTLKFGSDLLNNFEEVTHSFPILSLDKAYDIKELLLWIEKMVLE
                     GSSLGSYTGISVEPKIDGCSIVLYYKDGILQKALTRGDGRVGNDVTENVRTIKNVPLS
                     IDEKVELVLRGEIYITKENFLKINHTLKNPYLNARNLASGILRRINSREVASFPLDIF
                     VYDILYSSFGLSTNHDAFDKLKKFGFKINPFCKFFGGKNLEEITNHVKKIEMQRNSLE
                     YEIDGVVLKVDSFILRDILGYTSHHPKWSVAYKFESCTGVSKIVDIVVQVGRSGKITP
                     VAHVEKVFVAGAFITNASLHNQDYIDSIGLNVGDVVAISRRGDVIPAVELVVEKLSIG
                     SFKISSNCPSCKMALIKEGSHLFCVNKHCPYRIIEQIKYFCSKKCMNIVGLSGKTIEF
                     LFEMKFISSEIELYTFNFDRLINLRGFDLKRIDNLKRSISDSKGRPFRKLLLGMGIKE
                     LGANTILVLINNNLNSFDIISTLCKNKEAALAKLLKIKGIGEKIALNIIEAFNDKIIL
                     DKFNFFKELGFKLEEYNTNYVVDDSFLFGKKFCITGSFEGHSRDVLIEKITKKGAIFN
                     RAVTKRLDFLLVGEKPGLKLQKANNLGIKTFGLFDIKDFVDLDN"
     gene            complement(569351..571483)
                     /locus_tag="BT0_RS02745"
                     /old_locus_tag="BT0553"
     CDS             complement(569351..571483)
                     /locus_tag="BT0_RS02745"
                     /old_locus_tag="BT0553"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772495.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772495.1"
                     /db_xref="GI:500096488"
                     /translation="MFMSKKILSMLSKTFMLLSCTLLFGESKKNITHYIMNHSKVYIP
                     KEDLSEDFDNEEEIIYHKKNEISKDNNSNAPSKKSNKFKVSDNRKTRNNILTNEELQY
                     PQSLNTKNFYSEQENIDDWFIKDIDNLKLRIENYEKKIENIENLLSHTNIKSIKNKNE
                     EYEILTKSLKEIIEKIKNLINTKENLFNHAPQSKNNHYNNDQEYEENQNEYISNEEYN
                     YPPEKNTYDMHAQEQEYFNSETQILSELDNKINNNKDTLNNNTHKLSELDNKINNNKD
                     TLNNNTHKLSELDNKINNNKDTLNNNTHKLSELDNKINNNKDTINNNTHKLSELDNKI
                     NNNKDTINNNTHKLSELGDKINNNKDTLNNNTHKLNELGDKINNNKDTLNNNTHKLSE
                     LDDKINNNKDTLNNNTHKLSELDDKINNNKDTLNNNTHKLSELDDKINNNKDTLNNNT
                     HKLSELDDKINNNKDTLNNNTHKLSELDDKINNNKDTLLAFQKELIDLKNNHDTSLKN
                     IENNLSSIEKVINALKDKIDKNAELYEENKDTIQQKQDKINILNEKLMNNENAILTLK
                     EEFTKYKNKDLFTHDNGESQYTKKEFYPNNEKKIHKSSVIKTAEFTIYPDTHSNNYNF
                     KDQSSEFDFKKSNGYYIEIEPTKNLYRAQEIYKLIPKYNVKTHFINPSLKHKEKFFRN
                     LIKIEHANEIGTLYKNLASEFKKIRIIK"
     gene            571758..573623
                     /locus_tag="BT0_RS02750"
                     /old_locus_tag="BT0554"
     CDS             571758..573623
                     /locus_tag="BT0_RS02750"
                     /old_locus_tag="BT0554"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772496.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772496.1"
                     /db_xref="GI:500096489"
                     /translation="MKLKNMEEVWALPVCCNIKNSIIEDFKILDKYKDQVFNISYKDD
                     ITLKVIDAVDSNEFDLKLFDNKINFEGQIPLVLYSDSLDSLVEAEASVVFELKVIEQN
                     GVYFDSGLKELGEFKIYNSYYEFSDCLNYCSDVILVKVCFKDDSLVIDADLDNIALVK
                     QIISDNFCIAKDKIIINPINNNCVNVLFSVSFNAVLQGIIIAKKLGLKVNVLYYKRHF
                     LMAQSLNLKFSAVNYLSSENKLDKIMLDLEINRPLHFLYKFYFDYLRHIFDNLFFDVC
                     IHFNFISTTSNAVFFYDNYFLFGIAVYNFIYSNFYNLAVSLSIEPLSYLLSYVKSEYN
                     VFFKLFKEMDLKNSIMRKSSAISLKNEYNIFDVRRKGIGFAFLNLDPYRDSALLGGNQ
                     TVSMSLHKDKLDVFIPYKIMDINLMNYLRNTLARTFSLSYSNVNFIVSDVFIDDVGLY
                     STLIKESYIIEREVLAIKDVLVMMIGENFRGEYPVVAGQDFVMDIDKKFNVACSLEID
                     IEIYSFNIVFSNVNFFVENGKFDKLRINNKRIFSIFSLAVDYVFGNITYDIVDSVDLE
                     FIEDGEFVFSFRILFIASVCAIKTALIQAFDFNICKTPIDLKDILDNWSIRIDTN"
     gene            573610..574071
                     /locus_tag="BT0_RS02755"
                     /old_locus_tag="BT0555"
     CDS             573610..574071
                     /locus_tag="BT0_RS02755"
                     /old_locus_tag="BT0555"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772497.1"
                     /db_xref="GI:500096490"
                     /translation="MILISFNLNGETLSKSIKLPLSTKELLISIFYSGNQSFIENMNK
                     KFSLVLLDLKPVYSSLVSAFMLNGRSIITVEGLQNTTFYETLVKVLLENDFGFCTNCF
                     SSNALLFYYLLKRKVIIRADILGYYNTLKCNCLDVNTFLDLYLRLEELERK"
     gene            574068..574931
                     /locus_tag="BT0_RS02760"
                     /old_locus_tag="BT0556"
     CDS             574068..574931
                     /locus_tag="BT0_RS02760"
                     /old_locus_tag="BT0556"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772498.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="consevred protein"
                     /protein_id="WP_011772498.1"
                     /db_xref="GI:500096491"
                     /translation="MRGVKVYYPENFNTLVNLFKEDSNNYIVYNEIDFHKNAEIFMKN
                     EISDNFFIINNFERFNKVSLKSNFLEMGPCVTYDTILQFGERNIPRLFYEFISRLNDR
                     IYLNSINIANGFYYKNTVFDLYPLLLSLDAQLEFKNILTKKTYTYNAYSINRDDYIQS
                     RHTLFLSKLKFPITNLWNKSFCSRIFVDTFSFDILEEANIIFICVLLNIKRDIISDFL
                     MKIFYNDKVITLRDFQVLLLNKSLPLSLIEIEDSLKMLDKNIRDVKNFSLGERSLRLI
                     KNFYFDILSSF"
     gene            575092..575352
                     /locus_tag="BT0_RS02765"
                     /old_locus_tag="BT0557"
     CDS             575092..575352
                     /locus_tag="BT0_RS02765"
                     /old_locus_tag="BT0557"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS sugar transporter"
                     /protein_id="WP_011772499.1"
                     /db_xref="GI:500096492"
                     /translation="MVKKEATINAVNGLHVRPASTFVKKAKEYASDITIEADGKSVSG
                     KSLFRLQTLELSSGKKLVVCADGDDEEKAVTELVELIESFKE"
     gene            575368..577089
                     /locus_tag="BT0_RS02770"
                     /old_locus_tag="BT0558"
     CDS             575368..577089
                     /locus_tag="BT0_RS02770"
                     /old_locus_tag="BT0558"
                     /EC_number="2.7.3.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate-protein phosphotransferase"
                     /protein_id="WP_011772500.1"
                     /db_xref="GI:500096493"
                     /translation="MTLSGKRISKGIGVGEALFIKKDFDKFIDKSKIASLQIDDEIKK
                     FNDAKSKAISALKELTKKAVAQLGADKEGIFEGQILVIEDDELSDSVTSFIKNENYCA
                     AYAVYMSFKELIASVEEYTDAYLKERASDFKDIRNRLISNILDQVTDLSEVKRDVVLI
                     TEELTPSDTMQVDLSYVKGFVTTVGGETSHAAILARTMGLPALVMTPLDIAKIKEGEQ
                     LIIDGLSSIIIGNPSSSELDKYAHKILEYNEYERELFALKNQDAKTKDGIKISLKANI
                     GTPTDVFYVNKYGLDGIGLFRTEFLYMESVKPPTEDEQFEAYKRVVDTIEKKGVVTIR
                     TLDIGGDKEIPYFKFPKEDNPFLGYRALRMYMDYEDLIQSQFNAIFRASHYGKIRIMV
                     PMLTRYEELDIVNYFINKAKTNLKSRNLPFDENLEVGCMIEVPSAALMASDFADKLDF
                     FSIGTNDLTQYTLAVDRGNQKISNLYDKYNPAVLRLIKNVLDAGNNFDIDVSVCGELG
                     GDEAGALILIGLGFRSLSMVPSASLRIKYLLSKYTMSDLSELASKVLNSKSELETLKF
                     LDKYIGD"
     gene            577093..577662
                     /locus_tag="BT0_RS02775"
                     /old_locus_tag="BT0559"
     CDS             577093..577662
                     /locus_tag="BT0_RS02775"
                     /old_locus_tag="BT0559"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS glucose transporter subunit IIA"
                     /protein_id="WP_011772501.1"
                     /db_xref="GI:500096494"
                     /translation="MGFLGFFKKSATLDLIAPVSGKVVSIDKVPDEAFAEKIVGDGIA
                     IMPTGSELVAPCDGNIGKIFKTNHAFSLETKEGVEIFVHFGINTLNLNGKGFTRVAEE
                     GMSVKQGDVIIRLDLEYLKAHAESVVTPVVIANSDEVSSIEYVFGKLDDGSEYIVPSS
                     TTLTEDIKTKISQTNPVEAGKDLVLRVKK"
     gene            complement(577696..579543)
                     /locus_tag="BT0_RS02780"
                     /old_locus_tag="BT0560"
     CDS             complement(577696..579543)
                     /locus_tag="BT0_RS02780"
                     /old_locus_tag="BT0560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein Hsp90"
                     /protein_id="WP_011772502.1"
                     /db_xref="GI:500096495"
                     /translation="MKKQFDTEVNDLLYLIIHSLYSHKEIFLRELISNASDAIDKLKF
                     LNLTNEKFKDIKLDPKIEISFDEKLIKIKDNGIGMNREDLINHLGTIAKSGTKEFIKN
                     LKKDEKNTASLIGQFGVGFYSAFIVANKVELVTKKALEDTAYLWSSDGKTGYEINKAE
                     KDEYGTEITLYLNEEGIEYTNKWKIQEIIKKYSNHISYPIFIKYKEPLMKDGKQEGFE
                     EKEDKLNDTTAIWIKNKNEITDEEYNEFYKNLTFDYENPLIHIHTKAEGSIEYTNLFY
                     VPSKAPYDLYYPNTKPGVKLFINRIFITDSADSLLPNYLRFIKGIIDCQDLPLNVSRE
                     ILQQNKILAKIKASSVKKILSELEKLSESDNSKFNEFSKEFGRCLKEGVYSDFDNRSK
                     LISLIRFKSSHVDGLVSLREYKERMPEEQKSIYYITGGKENILKINPIVTAYKEKGYE
                     TLIMDDELDEAILNFITEYDGIKLKAINKNETSDELKDENFKQMEEEFKDILLKVKTI
                     LKNHVKDVSLSATLTQEPSAIIIDSADPTYQMQRIMISMGQEVKEIKPILELNPNNKI
                     IQNLKNLDDINLEKISIILFEEAMITSGLQSKNPRQFINIINEMLEQNI"
     gene            579664..581058
                     /locus_tag="BT0_RS02785"
                     /old_locus_tag="BT0561"
     CDS             579664..581058
                     /locus_tag="BT0_RS02785"
                     /old_locus_tag="BT0561"
                     /EC_number="1.1.1.44"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772503.1"
                     /note="catalyzes the formation of D-ribulose 5-phosphate
                     from 6-phospho-D-gluconate; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphogluconate dehydrogenase"
                     /protein_id="WP_011772503.1"
                     /db_xref="GI:500096496"
                     /translation="MDIGIYGLGVMGSNLALNIADSGFNVSVYNRDNDKTEVFLVNDA
                     HKKINGFKNIEDFIGSLKKPRKIILMISSSAVDEVIEQILPLVEKFDIIIDGGNSHYK
                     DTIKREKELSSKDVYFVGLGISGGEKGARFGPSLMYGGSKKAYGLIEPILNKIAAKTN
                     MGDICSAYVGESGAGHYVKMVHNGIEYADMQLICESYFFMKRAFNLDNLKISEVFDKW
                     GEGDLSSYLIEITSKILKYKENNEYLLDKILDVANQKGTGKWVSIEALQLNVPANLIF
                     ESVFARFLSGLKHERVIASDILKMDVDSVEFDLSDWILDLYYALLVSKILAYAQGFMM
                     LKSASVNYSWDLNLGKISLIWREGCIIKSVFLEKIKLAYDKNPHLINLIFDDYFLDII
                     RNYHKSLRRIVSRASEIGIPLPAFYASLSFLDSYSTNYLPANLIQAQRDFFGAHSFER
                     IDSKRGEFFHSTWE"
     gene            complement(581073..581612)
                     /locus_tag="BT0_RS02790"
                     /old_locus_tag="BT0562"
     CDS             complement(581073..581612)
                     /locus_tag="BT0_RS02790"
                     /old_locus_tag="BT0562"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772504.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772504.1"
                     /db_xref="GI:500096497"
                     /translation="MQKLVLIAILTLNIWGGAFGKSSYSDRKIGFGGSIGNPIFNYIM
                     SFPFIDLEIGYGGTNGINLSEDKLKSKKYDFNIFVLSALDLILTIPLIEKLSIGTGIG
                     GNIHISSNKSNFINMEIGFGFRIPIAIFYDLTEQIEVGLKIAPSIEFVSNAKSIAYHY
                     LYAGLKTNIIGGIFIKYYI"
     gene            complement(581742..582257)
                     /locus_tag="BT0_RS02795"
                     /old_locus_tag="BT0562A"
     CDS             complement(581742..582257)
                     /locus_tag="BT0_RS02795"
                     /old_locus_tag="BT0562A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772505.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772505.1"
                     /db_xref="GI:500096498"
                     /translation="MKKIILILLLINYFNVSAKESHTNKGYFGIGILGPLSNAFQLVL
                     GKNITIEIGIYNGLKNLFNNFNTLFASLEFTALSSDSSEQSKAIDASLGIGIYGLWWI
                     PEWQNTRKTYNSTNIGIRISLTLNLPIIKKNFDIFLKTGPGINIWGIGGGNPKQKWEA
                     FAGLGMRLWFA"
     gene            582380..582631
                     /locus_tag="BT0_RS02800"
     CDS             582380..582631
                     /locus_tag="BT0_RS02800"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178496.1"
                     /db_xref="GI:752506631"
                     /translation="MICERFVKYCSNVNNLYNFSLVLSYEMKFVIDDFQYTYYLNRVW
                     FWDNISFLGVGSFDVFEHMLKFYFDILLNLSREILKYFS"
     gene            complement(582650..583165)
                     /locus_tag="BT0_RS02805"
                     /old_locus_tag="BT0563"
     CDS             complement(582650..583165)
                     /locus_tag="BT0_RS02805"
                     /old_locus_tag="BT0563"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772506.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772506.1"
                     /db_xref="GI:500096499"
                     /translation="MKTKNMLALMFMLVSISAFANSTSTARNKFGMGILLPFPIALEF
                     NIGNFDIDLGAYSGTNNFFKDWKTLFLAIDYIFYIHTFAGADNMLDFAVGGGGYGTIW
                     FSRWSNNKINSGPMSLGARLPLILNLAIARKKFDIFLKVAPGLGLNIWSRGVGFRWEV
                     FAGLGMRLWFA"
     gene            583650..584186
                     /locus_tag="BT0_RS02810"
                     /old_locus_tag="BT0565"
     CDS             583650..584186
                     /locus_tag="BT0_RS02810"
                     /old_locus_tag="BT0565"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772507.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="WP_011772507.1"
                     /db_xref="GI:500096500"
                     /translation="MELETDLQGTLNQYLLFSLDELYAIEIKYVVEVLEYTKISKIPR
                     TPDYMAGIINNRGKIVPVIDIRKQFGMQDRKVSDDGLKKKDVDISNIIILNLIYEGDE
                     LNLGILVDYVNEVLELNLSDIDEAPKIGTGFNSRFISGIGKRNNKFIIILDVENLFDI
                     KELSSFKNTTIYDPDCDQ"
     gene            584201..584512
                     /locus_tag="BT0_RS02815"
                     /old_locus_tag="BT0566"
     CDS             584201..584512
                     /locus_tag="BT0_RS02815"
                     /old_locus_tag="BT0566"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772508.1"
                     /db_xref="GI:500096501"
                     /translation="MIYNPEGELVVNSIFKVKEDLLNILKEMKEEETLVMNLSNVEKI
                     DVTFIQILYASNKYAKDRNLFIKIEYPSDEVLSSLIYGGFLNDIEDIDHLDLGLSLIE
                     F"
     gene            584536..586689
                     /locus_tag="BT0_RS02820"
                     /old_locus_tag="BT0567"
     CDS             584536..586689
                     /locus_tag="BT0_RS02820"
                     /old_locus_tag="BT0567"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772509.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="WP_011772509.1"
                     /db_xref="GI:500096502"
                     /translation="MNSSDMIDKFKDSFKEESIENISDIEHALLNIEFESGKEVVNSI
                     FRNFHTIKGSAGMFGFNLTASLVHEIETVLDPIKEGSDEFNQDTVDATLMAVDFIREL
                     IEGDEAIDESAYKNREKILIDTIKKGFGLGVDVGLNTDSVLSSTGGDQISLSNDLDSQ
                     GAFLDASLEQGKFEDEALNVETKIYKILFSPSRGILFHGHKPINFLKKLLNLGNGQVR
                     ARVKNIPDLELMSPDNVYVEWEVKLETEESKSSIEDIFMFLDGQSKFVVEEVDSSYDM
                     PEAFELDSLVNNLDKGVDEVCSKEKQNSSKTEEIFNKTALKGGANFNDDTAKSKVNIA
                     SIKVDSKKLDHLVNLVGELVTIQSKLAKEAESSNNNILNSISAEFSLLINELRDYTTG
                     LRTVPIEILFVKFQRIVKDLSAQLGKSIRYHSQGGDTVLDKSIIERLNEPLVHLIRNA
                     IDHGIEPAEERIEAGKDPQGVIKLSAHQSGDSVIIIIEDDGRGLNKRKIIKRAIERYI
                     ISDAVSRTLSDVDIYNLIFEPGFSTADVVTNVSGRGVGMDVVKKQVESLRGNVILESE
                     FGKYTRIKLIFPLTLAIIEGWLVRVRDEHFIVPLSSVESCLEADKLMSKVCGFENNSN
                     VMNYRGSMISFIRLREFFEISDEESDSEHVVVVNANSGKIGIVVDEVLGQHQTVIKTL
                     GKIYSKVEGVSGATILGDGSLALVVDIDTITKVIR"
     gene            586738..587889
                     /locus_tag="BT0_RS02825"
                     /old_locus_tag="BT0568"
     CDS             586738..587889
                     /locus_tag="BT0_RS02825"
                     /old_locus_tag="BT0568"
                     /EC_number="3.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein-glutamate methylesterase"
                     /protein_id="WP_011772510.1"
                     /db_xref="GI:500096503"
                     /translation="MKILIIDIQGLIRQVFVRAFSKDLNVEILNPGSNSLNLINVFLQ
                     KFPDLVIVDENSAKSHFGNALNNVLNNISLPVIFIAEDEVYPQFGFLESKRDKIKLII
                     NKLNFKLTVNLFRSDYLDLIKSEIKKLAGNKFIVSFETKRIKAPDSFVKSESKKSEGS
                     ISGITRSYKVADVINVAPKNDPDVILKYQGVINKNKTGKVIFVGSSTGGTEALRVFLK
                     FFKRDSPPIVIVQHMPGGFTTSFAKSLNNELEIDVKEAEDGDILRPGLVIIANGHYHL
                     IVKYANGNYFVNLLDGPLVSRHKPSVNVLFRSAAMYAGENAIGVMLTGMGDDGACCML
                     EMKKSGAYNIAQDQVTSVVFGMPMEAIKIGAVDKVLPLNKISEYILRRS"
     gene            587889..589661
                     /locus_tag="BT0_RS02830"
                     /old_locus_tag="BT0569"
     CDS             587889..589661
                     /locus_tag="BT0_RS02830"
                     /old_locus_tag="BT0569"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772511.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772511.1"
                     /db_xref="GI:500096504"
                     /translation="MEDDGKFLDINPHINKLFVELEAFDSRSRQVYASLSKSIPKLIE
                     KLSKDIKDLSFNIGFISNLDIDNDYSLNNFISKVIRVLNDFVSYFNSSTELLEAQFGV
                     IRDKVKDIEILEDVIEKMKKSSIDMEIMSINTLTVAMRAGRAGGAFSYITNEIKTLTQ
                     SMIKQADQLTSRGRDIKVGLDRAKDQVLENNTAENKILEEFKDNLIKNIDEFSGGIGE
                     VIAFYDNILGILSEFKFKFVNAVSYLQFQDRLTQSLYHLNIMYSSIDVFKFRDTSEVQ
                     KLKVLSVFTNSSKMIVGDVIAKLDENLRAFEEFIDTSISSIQVINDLKSDNSSYIDIS
                     RSVESFSVILSNLLKRIDDVEKNNSNFLNLYYEQIKLVKSLELMFSNISAISSRFQNI
                     NIASKIEVVKRVELEDMEGNISEMSKIISDIELNITKGREFLSQIIFFFEKVVKDCDN
                     RFYLERNYFNKFKKLFMEIKNNIFEIKKIALDQVLSYEIFPVDFLEIFEEVKLGIHNI
                     KNLRMDLLNLEKTLMEMDNDINSTLDLELLKNGLKCVEIEDKEFIRRIANRFTLFIHK
                     KYLLSLIEDEKDVHSFDEGSVILF"
     gene            589699..590073
                     /locus_tag="BT0_RS02835"
                     /old_locus_tag="BT0570"
     CDS             589699..590073
                     /locus_tag="BT0_RS02835"
                     /old_locus_tag="BT0570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011772512.1"
                     /db_xref="GI:500096505"
                     /translation="MQKRILVIDDNRAIRQSVAYILEQNGFGVSEAQDGLEGVSKFKE
                     AVGQSDKDFDLIITDINMPNLDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAG
                     ATGWLVKPFNPDTLMRTISKIF"
     gene            590120..591463
                     /locus_tag="BT0_RS02840"
                     /old_locus_tag="BT0570A"
     CDS             590120..591463
                     /locus_tag="BT0_RS02840"
                     /old_locus_tag="BT0570A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772513.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Xaa-His dipeptidase"
                     /protein_id="WP_041178497.1"
                     /db_xref="GI:752506632"
                     /translation="MDFKLEKQFYFHLGELIKFNSVNASALKNRPFGEQIDLCLDKVL
                     EIAKNIGFKVYRDRDGYYGFADIGQGDELIGILAHIDIVDAGNVSNWNSNPFKLDFRD
                     GKIYARGILDDKGPLMAVLYAFKLLVLEGIFFNKRFRIIFGTDEEVAWRCIEQYKIKE
                     EIPDFAFTPDGDFPVVNAEKGLLQFDIISDEKFFMDFEIGTGYNVIPDECSFELGDFN
                     KDDFRILLDSFGGKIRYKFFENSVLIHGISAHASLPELGVNVAPYALKIIKSLGVKAN
                     FINFFEDRISFTINGEKLFGKVLEDSKSGQLTLCLTKVKLSKTSNQILSFDMRYPVSC
                     RREELVDLIKRTLNVYSLDYHEVSFLDPLYVDSDSKFIESLIEVYKAFTGESNVSPIA
                     IGGATYSRALKNCVAFGPLFKGSDNTAHKTNEYIDESELMNLVLIYKDAIKRLNT"
     gene            complement(591596..591679)
                     /locus_tag="BT0_RS02845"
                     /old_locus_tag="BTT0017"
     tRNA            complement(591596..591679)
                     /locus_tag="BT0_RS02845"
                     /old_locus_tag="BTT0017"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(591643..591645),aa:Leu,seq:caa)
     gene            complement(591688..592377)
                     /locus_tag="BT0_RS02850"
                     /old_locus_tag="BT0571"
     CDS             complement(591688..592377)
                     /locus_tag="BT0_RS02850"
                     /old_locus_tag="BT0571"
                     /EC_number="2.7.4.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772514.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uridylate kinase"
                     /protein_id="WP_011772514.1"
                     /db_xref="GI:500096507"
                     /translation="MLKIISLGGGIINPDKINIEYIKNLKNLIFKWVQEDNRRKIILI
                     TGGGKTAREYQDAYKQINPKFKNHELDEIGIMATKLNAKLISKAMQPLCIDNIVSDPT
                     QDFHFKGQIVIASGWKAGFSTDYITVKFAEKFKADEIINLTNVNQIYDKDPKKFDDAK
                     GLSNITWNELQNIVGKNWEPGSNLPFDPIATKLALKLGIKAYILNGTDLQNLKKVFDK
                     NDDFLGTIVVK"
     gene            592598..593662
                     /locus_tag="BT0_RS02855"
                     /old_locus_tag="BT0572"
     CDS             592598..593662
                     /locus_tag="BT0_RS02855"
                     /old_locus_tag="BT0572"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772515.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase"
                     /protein_id="WP_041178498.1"
                     /db_xref="GI:752506633"
                     /translation="MCKYKVSVIICFFNSDSTLEVMIKSALNQTLRDKEIILVNDGSY
                     DNSLKIAQKYADQYDCVKIINQKNLGIAASRNNGLEKAEGEYIIYWDSDDSVENTMLE
                     VLYNRAKADNSDVVCSQFYVYFIARNIKRRSALPFPNYPITGEEAFKNLLLTVFASFS
                     KKNFVVGTLWDKLIRRDLIVKNDIIVNDIILEDIVFMLHVFLKADKVSFVNNYFYTNF
                     QWMRSASSSINVISKVSLSFKVVESFLKEEGIFEKYFEYYKRFYLQLYYYISFKQIYI
                     IGWHIKDRLVYKAHKAKLISVLNEVQNSKEFQIYYASLKGARFSEIQILPKIMLKVWH
                     LSARLYVNFSLFIYKSFLKN"
     gene            593724..594542
                     /locus_tag="BT0_RS02860"
                     /old_locus_tag="BT0573"
     CDS             593724..594542
                     /locus_tag="BT0_RS02860"
                     /old_locus_tag="BT0573"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772516.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_011772516.1"
                     /db_xref="GI:500096509"
                     /translation="MKIEFIDVSFSYRKIKVYLDLNLAFSKPQTYLILGKNGMGKTTL
                     LKLISGLLNPLKGEVLFNSLKVFPRNPLNLVNLFFVPEEFDLPSVSLNDYYRSLCKFY
                     PNFSEKDFKEYLLKFEIDINLKFGSSSYGQRKKSIIAFSLATDVPILIFDEPTNGLDI
                     ASKNVFRDIISNFKNKIVFVTGHNVRDLVDIVDHLTIIGNNNILFSNSVSYINNSYKV
                     KIVDKLEGEELYYEKVKGGFKALYFESGFCDDNVDLEFFFLYITSNKLKDLANV"
     gene            594535..595392
                     /locus_tag="BT0_RS02865"
                     /old_locus_tag="BT0574"
     CDS             594535..595392
                     /locus_tag="BT0_RS02865"
                     /old_locus_tag="BT0574"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_011772517.1"
                     /db_xref="GI:500096510"
                     /translation="MFSLKRFFLLFNFDFVYHRKLYLYFVFSIFLVFPLIYFFLKIYG
                     FTNLINFVFINSKLFFFVLFCIVYIVSIYNMFDHYKPIHDLLKDVFYLSLPVSTLERY
                     LFVLVKFLFILPLFLIICCYISLNLTVLLDKNFFVGNQINYLSLYFVFSFFKETCVIY
                     FVGFPIFLLSRIIFKNYPFFRAIVIGSLFFTLLVVFFYFVIFFVNTYLFKVGNDFGGW
                     GEYYFIKFICMLFAGFIYFCAYFILKNLGNLNTKVNLSILAGVISFFAVLFFFLLAFL
                     TIFVYVFRF"
     gene            595679..597289
                     /gene="pyrG"
                     /locus_tag="BT0_RS02870"
                     /old_locus_tag="BT0575"
     CDS             595679..597289
                     /gene="pyrG"
                     /locus_tag="BT0_RS02870"
                     /old_locus_tag="BT0575"
                     /EC_number="6.3.4.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772518.1"
                     /note="CTP synthase; cytidine triphosphate synthetase;
                     catalyzes the ATP-dependent amination of UTP to CTP with
                     either L-glutamine or ammonia as the source of nitrogen;
                     in Escherichia coli this enzyme forms a homotetramer;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CTP synthase"
                     /protein_id="WP_011772518.1"
                     /db_xref="GI:500096511"
                     /translation="MIDNLKILVVTGGVISGIGKGVTSASIARLFKDNLKITPIKCDG
                     YLNTDPGTINPVEHGEVFVLDDGGEVDMDFGHYERFLNLNSKSNWNITMGKIYKNILE
                     NERHGKYLGRTVQLIPHVTDEIRETIFKIAKEESSELLVIEIGGTVGDMENILFIETM
                     RQIRYEIGSDNIAFVHLTYIPSPVGINEQKSKPTQQSVKTLNKAGIFPDLIIARSSQL
                     LTKQMRQKIAMFCNVDTLSIIDNTDVSTIYEIPISFYKQGLHEILGSKLKINVKPKVD
                     GLERLVGIIKRNLVSPQRIVNIAICGKYTELGDSYASIFESLTHVSANLDILVKTTVI
                     DSTNFDERMLKGIDGIVVPGGFGGRGYAGKIRAIKYARENDIPFLGICLGMQLAVIEF
                     ARNVCGIFDADTEEILSEGNSICSSITPVIHLLPEQKEFTDKGATMRLGGYSVLLKKD
                     TLAFKLYGSEMIVERFRHRYEVNNDYLDSFNNHGLIVSGFSEDFRIVKIMEIPKNKFF
                     VGCQFHPELITRLENPSKLFVGLVKACL"
     gene            597391..597978
                     /locus_tag="BT0_RS02875"
                     /old_locus_tag="BT0577"
     CDS             597391..597978
                     /locus_tag="BT0_RS02875"
                     /old_locus_tag="BT0577"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772519.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772519.1"
                     /db_xref="GI:500096512"
                     /translation="MKESDIKKAISMKRLVKYFFDELEYRMKIPCLRPNSRSMSKKYI
                     LLNLLRKIANLPFNKQYEIEEQFPLDISGKGILTDAVLIKRLDYERCVITGIIEARAE
                     HVDLEYELKRFVIRSGKVNVLFWQPKRTILKQDGDLIILDADDIFKLDNDFYLPVIKE
                     KLENFINIFMKFFSYEDVLFEYNKLHGKYSLVKNK"
     gene            598175..599356
                     /locus_tag="BT0_RS02880"
                     /old_locus_tag="BT0578"
     CDS             598175..599356
                     /locus_tag="BT0_RS02880"
                     /old_locus_tag="BT0578"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011772520.1"
                     /db_xref="GI:500096513"
                     /translation="MYKFSFFGKKKSDMSNSFKNESLKNIENDNQSLNMCEYKVPVKE
                     MIQGFYHARSSISNVLVRIEFLYKNLFFNFENIGKIFESLIEKTNNARSQVSVIFEDI
                     EKNNEEKLKRVSAVIVGVQGSLETINSFLGATNMISLNAKLEAARAKEYGKGFSVVAD
                     EIKRLSDQAKSVMSMISVKEIEQVSKDLISKNIKELQLDIDNFFSNLIGELISLGDLF
                     KHFISQQNEFSTLIGELENVEASVSYLARNCDSLSSSEIFMYSNDEFLKELEFSISEQ
                     MSWMSIVRAIVENQKRMPIQTDPMKHGFGLFYKGLIPRASKVRAVWEDIYSCYLNIHK
                     LVVEIVKVFAQDSSDDIDLRRAKDFLVQAEGLSDEIVSKLESVKKIVVECENQGISIF
                     E"
     gene            599501..602953
                     /locus_tag="BT0_RS02885"
                     /old_locus_tag="BT0579"
     CDS             599501..602953
                     /locus_tag="BT0_RS02885"
                     /old_locus_tag="BT0579"
                     /EC_number="2.7.7.7"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772521.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit alpha"
                     /protein_id="WP_011772521.1"
                     /db_xref="GI:500096514"
                     /translation="MDLKVKFVHLHVHSDYSLLDGAAKITDIVAKAKKCNMSHIALTD
                     HGNLFGAMKFYREAKGAGIKPIIGMEAYMSSTSKHIKKNDELGRPYYHLIFLAKNELG
                     YKNLLKLTSVSYLEGFYYRPRIDKEDIEKYSEGLICTSACIGGIIPQLILANKFDDAK
                     NEILWFKSVFGDDFYLELQRHGIKQQDIVNEKLVAYSRELNVSLSVSNDSHYVNKEDA
                     TAQDIIVCIGTGAKRSDPNRLKMETDEFYLKTQEEMCKLFRDLPEALANTLKIAEKCN
                     EFEIKFPGPIFPEYQVPSEFDTLSQYLEYLTLEGLKFRYANVTDSIKDRAFYELSTII
                     KMGFEAYFLIVWDFIKFAHDNGIPVGPGRGSGAGSIVAYALRITDIDPLKYNLLFERF
                     LNPERVSMPDFDIDFCFEGRDEVIKYVTRKYGEDKVAQIITFGTLKPKAVFKDVGRVL
                     DIPFTESNELTKLIPDGPKVSLREVFKDKALKAYLNKGVVYNELMEAALVLEGMNRYV
                     STHAAGIVIARTPLTDYVPLYKDYKQNTVSTQYTMDLLEDCGLVKMDFLGLKTLTLIK
                     NAENLIRITNPNFSIANISDSDVKTFKMLSEGRSASVFQFESEGMQQVLREAKPDSIE
                     DLIALNALYRPGPMQFIPQFIAAKTGTKRIRYPHPDLKEVLKPTYGVIVYQEQVMEVA
                     RIIGGFSLGKADILRRAMGKKKEDEMNKMKVDFIKGALSKGYDETLANDIFELLKPFA
                     GYGFNKSHAAAYSLIAYQTAYLKANYPENFMAANLTNEINNTEKLSYYIEEAKSMGIN
                     VLKPDINQSFKEFSVVGLNISYGLNGIKNIGGLIVDLIITERQENGEYKSFEDFIRRV
                     DDKVINKKFLEAAIKSGLFDSLGQNRKTLFENLDKLIDFVIKDRNDKKLGQNSLFGSI
                     GSQDAIQQSFNYHVFEEYSYPELLRFERELLGFYVSGHPLDHYKPELERFTNFNVLED
                     LAVKKDTTVKFAGSLNVVRVIRTKRNNARMAFGVIEDFKGEMDIIVFAASYEKYNHLL
                     IEGDVIGVIGKLRFERDKFSIIVEKVLSIEEISVNNENKINNLHIKFSNERLGDSHLL
                     YSLKDKIFNLEDHTGFSHVYLYLKNDDKSLKLKMDLTLNFKPDEFKLNELRCHEIVED
                     IWFD"
     gene            602965..603537
                     /locus_tag="BT0_RS02890"
                     /old_locus_tag="BT0580"
     CDS             602965..603537
                     /locus_tag="BT0_RS02890"
                     /old_locus_tag="BT0580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772522.1"
                     /db_xref="GI:500096515"
                     /translation="MIIETLILFLNIYRILILIRIFLSWLVSSGINTSAFFRFIYNST
                     EPFLSIFRRIRFFRFGIYDFSPIAALITLSIVERMLSYGDYKLSTFVILFIIEVWGIL
                     RSVFFALIFFFVLRFIFLFLHLFDGTDFMRSVDSFLMPLSVKISNMVTDKNMSYTINL
                     IVAGALLLAFIIICEQAIWAISILGFYLPF"
     gene            603547..605610
                     /locus_tag="BT0_RS02895"
                     /old_locus_tag="BT0581"
     CDS             603547..605610
                     /locus_tag="BT0_RS02895"
                     /old_locus_tag="BT0581"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase RecG"
                     /protein_id="WP_041178499.1"
                     /db_xref="GI:752506634"
                     /translation="MFLHEFQYDLQGISGLGNKGIDRLHNLNITNIKELIEYFPKKYE
                     DRQNIKTFPDPLEVRSCELMTVFVVLEHRNFGSNSKKNLKIIAQSENDEIFEILLFNR
                     GFLEGVFKVGQKFYIYSKFNYSDYTQMWSCSNFDSEVFSYNPERFKKIMPVYSLGEGL
                     TSKKISSYVKEALIYFLKFGKSDIPDFLINKYSLLSLHDALNEIHFPTSLEMLDRAKK
                     TLIYREIFLLQFFSRGKSSLVFLRKEKHLPMNLLDQVVLKLPFRLTKDQEVVISEIID
                     DLKSNKPMNRLLQGDVGSGKTLVAFLSSIPLIEAGYQVALMVPTDLLARQHYNNLSNM
                     LKDFNISIALLTGSLKTKNRNDVLEKIQSGTYSLVIGTHAIFSQRTKFKKLAYVIIDE
                     QHKFGVEQREKLKNKGEEVDMLLMSATPIPRSLALTLFGDLEVSLIKRGPAGRRPVTT
                     YLAKHGNEDKVYEFLNNELGKGHQVYFVYPLISSSEKFNLKDVTSMCLNLKNIFVEYS
                     VAMIHSKLESHVKEEIMRDFYLKKIDILVSTSVIEVGIDCLNATCIVVEHAERFGLSA
                     LHQIRGRVGRGSLKSFLFLLYKEPLTEAGKFRLKTIKENIDGFKIAEEDLKLRGPGNL
                     FGLEQTGYLKLKIADFVEDKEVISLIREELTMFFLNKAFYDKADIELLDSLLVSYLRF
                     VGKEN"
     gene            complement(605613..606407)
                     /locus_tag="BT0_RS02900"
                     /old_locus_tag="BT0582"
     CDS             complement(605613..606407)
                     /locus_tag="BT0_RS02900"
                     /old_locus_tag="BT0582"
                     /EC_number="3.4.16.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanyl-D-alanine carboxypeptidase"
                     /protein_id="WP_011772524.1"
                     /db_xref="GI:500096517"
                     /translation="MRSLNIFSLILLVNNLTLQANTISRKDFKSLFKIIKILDKSYQK
                     QIKEKPIQFIKELKPLLEAEKNDLLILVNKKIPIPKGYNPTDLVYLKDFKELKNIGKK
                     NLKLRKILIDDLTNLVKAGRENGLQIKIVSAYRTREYQKFLFEHNVKTYGLKLAKIQS
                     AIPDHSQHQLGTTIDFIQIDDNLLNTKAGKWLYENSFKHGFSLSYPKDHEIETGYKSE
                     PWHYMYIGKQACILQKKYFNNLQYKLFKFWHEHKKELSTLIQKYTN"
     gene            606494..607843
                     /locus_tag="BT0_RS02905"
                     /old_locus_tag="BT0583"
     CDS             606494..607843
                     /locus_tag="BT0_RS02905"
                     /old_locus_tag="BT0583"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772525.1"
                     /db_xref="GI:500096518"
                     /translation="MLTKFNKYRSILRELLVLAIPTVFESFLFQLVTFFDNYMIAYLG
                     SAQVTGTSLANRITFLCFIVIFALGTTLSAYASQAFSKGKFTHVKQAFAYALIIGITI
                     GIIFFCMSFVFSKELIKLFIEENESLNFGMDYLKIVSISYIFMSYSFLSAMGFKSIKD
                     IKVPLVVTIFVVLMNIILNYIFIFGFNMGIRGAAYATLLARISEFVFYFFYNFLNVKS
                     YYHLKISDFFVSNSVKVAYLKILIPVFLHEICWVLSITILHAFYARLGSSEYASFAVA
                     SNILDLYFVVMHGMGVATGVIIGHLMVNDKEQVRALGIFLSVIGFILGFFVAFILCLT
                     SKIVPIIFSNLDSPELVSTFISIFASIVVFKGFTAQTLVGVFRASGIPNICFYIEAGV
                     IVFYTLPVAYFLVFFTNFRLPLIVFIVNLEEIFKNIFILIEFFKNNWIKDIHYEELT"
     gene            608027..609370
                     /locus_tag="BT0_RS02910"
                     /old_locus_tag="BT0584"
     CDS             608027..609370
                     /locus_tag="BT0_RS02910"
                     /old_locus_tag="BT0584"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772526.1"
                     /db_xref="GI:500096519"
                     /translation="MYSLSKSKKNSVYQDILNIAVPTAIEFFLFNVVAFTDNIMVSYL
                     GDYPVVGVSLANKLFELFSTIAFTVMGAYNILATRQYAQGDIDNFKNTFFISILILLF
                     FSFLFIVISLFYSYFFLGLLSDDPVAIFYGVSYLNIAVYSFIFAVVKGIIANSLKVVK
                     ITKIQIATSVISVVLNVVFNYLFIFVLNMGVVGAAIATTLVRLIELVFYLLYTVFNIN
                     SHFYLKIKNLKINPVIFSELIKVFVPIFLNDFIWYLGYFGLIAIFSRIDTAKYAAYSI
                     TFSTYFIGLNITYAFCFAVNIVMGHEMNNDKREIMSVAVYLGKIGFVLAFLTSLIIFA
                     LSFIVPHIFYKLEHADLMGVMLRYYAISAFFTSLAFQYLFGFFRAGAAPNFGAIMECS
                     VTFIYTIPVAYFLANYTQTPFELIVFIPTLEDVIKFGISLPYFYSTKWIKSIKTG"
     gene            609395..610750
                     /locus_tag="BT0_RS02915"
                     /old_locus_tag="BT0585"
     CDS             609395..610750
                     /locus_tag="BT0_RS02915"
                     /old_locus_tag="BT0585"
                     /EC_number="6.3.2.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
                     /protein_id="WP_011772527.1"
                     /db_xref="GI:500096520"
                     /translation="MYLDEIRGKNFLIMGLGLHGGGLAVAKFLLKHGGNLVITDLKNE
                     LELIPSIEALKQFRDKIRYVLGYHDEDDFKRADIVIKNPGVSFDNKYLKLAKRVETDI
                     SLFLMFNQNPIIAITGTKGKSTLASLLHKVLVIKYPNSKLGGNIGVSPLSFLDELDGV
                     SPIILELSSWQLHDLRNLCPIISIITNIYSDHQNYYSNFDSYIEDKSRIFINQNSGIL
                     ISQDQAYYNYFSRFKSKLKSILFSEAVPLNFENDVFYFKKGKIYLNNKVVGTLSESRI
                     VLLISKMITIFIASYLGLDLSVVSKIVTDFDGIEHRLEFVREFEGVKYYNDTASTIPD
                     STILSVKSLRAYGGLINLITGGTDKELDFAIFGEILSIVKTWILLKGSATLKIIKFLE
                     DNNINYFIFSSLEECVCYAKKISVQNDIVLFSPASASFELFKNEFDRGLQFKNLVSIM
                     A"
     gene            complement(610747..611796)
                     /locus_tag="BT0_RS02920"
                     /old_locus_tag="BT0586"
     CDS             complement(610747..611796)
                     /locus_tag="BT0_RS02920"
                     /old_locus_tag="BT0586"
                     /EC_number="2.3.2.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772528.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidoglycan bridge formation protein FemAB"
                     /protein_id="WP_011772528.1"
                     /db_xref="GI:500096521"
                     /translation="MNIKKIEIENLNENYLQSKLWTTVKKVSSNKSPWKAIAFSNNHF
                     NKILVMQRKIFGKFYLSYIAHPEFSNKKIEEINVDEINIQIKKFSENIRQYLHKNTIF
                     VRYDLMFYTSRGLKEDYIPLKLKFKNLQKSFDDIQPANTTILNLNDSLDAIKAKMKKK
                     TRYNINLSSKKNIKVIIDDDFKYFDEFYALHKETAQRDKFAIHSKDYIRNLIKAFRED
                     KNSKIKLIIALYNEQLISGIIVGIYKDKATYLYGASSRENRNLMPNYAVQFKTIQMLQ
                     SLSIKEYDLLGIPPNADTKHPLFGLFQFKTGFGGKLIHRIGCYDFVYKKFSYKVYSIL
                     EILRYIYYKIIKKRF"
     gene            complement(611818..613998)
                     /locus_tag="BT0_RS02925"
                     /old_locus_tag="BT0587"
     CDS             complement(611818..613998)
                     /locus_tag="BT0_RS02925"
                     /old_locus_tag="BT0587"
                     /EC_number="6.1.1.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA synthetase"
                     /protein_id="WP_011772529.1"
                     /db_xref="GI:500096522"
                     /translation="MKKKNLITAALPYVNNIPHLGNLVQVLSADAFARYSRMMDIDTL
                     YVCGTDEYGTATETKALIEKTTPEELCNRYYAIHKSIYEWFNIKFDIFGRTTNKSHKQ
                     TVQDLFLKLEKNGYITDKESEQFFCQQDQMFLADRYVTGECPNCGNNAKGDQCENCSK
                     LLAPIDLINPKCIICKNIPIIKTTKHLYINLPKIKNELIHWMQTTEHNTNWNTNAIKT
                     TNAFLRDGLKERAITRDLKWGIPVPKKEYENKVFYVWFDAPIGYISITKEISKDWESW
                     WKNNKETNLVQFIGKDNILFHTVIFPAIKLGSKENWTMLGKLASSEYLNYEHLKFSKS
                     AGIGIFGNDVITTGISADIWRFYIYYNRPEKSDFQFMWDDFMERINSELIGNFSNLVN
                     RVLTFYKKFFGDKIDTIEIKEDFWKEINLKYDKTLNFFKQIELKSALKEILDISRIGN
                     KIFQDKEPWKTKDSTPKKTKELLLNLIYLIRDLSILISPFIPHTSDKIRRFFGESYEI
                     SNKFLGTNLGLNTIQFTEVLFTKLEKELIDSLKLKYSGGKNMQDEQTENPINLFSEKV
                     CLKVVQIKTIERNPDAEKLFILKLDDGTPDGKQIVSSLADYYKEEKLIGKHIIIVDNL
                     KPAKFRGIKSEGMLIATEDENKNFKVIIVEDFKDNPIPGERIILESDSDKKLKLPSKI
                     SIDKFLKTQIVAENGELKVNGINLILEHSKEKILSREIPNGKVY"
     gene            614125..615171
                     /locus_tag="BT0_RS02930"
                     /old_locus_tag="BT0589"
     CDS             614125..615171
                     /locus_tag="BT0_RS02930"
                     /old_locus_tag="BT0589"
                     /EC_number="2.3.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772530.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate acetyltransferase"
                     /protein_id="WP_011772530.1"
                     /db_xref="GI:500096523"
                     /translation="MGSFNFKNYVCDRAKKIVREKGDKASIVFPESTDVRILEATIDL
                     LKKKLAGLVVLIGRRDEVFRRLKEQSGSRDDILEMVKVVDPSSFKDFNRYLDEYFSLQ
                     HNRKLTLKQAREELLDEIAFSMMMVRLGEVKTCVCGALVSSAKVLRSVFKILPKLKET
                     NFISSFMIMDTGNDLGRAETCFGYEGILMFADCAVIINPNALQLAEIAIQSANSFKNI
                     FNAEPKIALLSFSTKGSANSIEVDKVKGALELVKSKCSDLLIDGELQIDAALVKGVAE
                     KKCGDSLVAGAANVLIFPSLESGNIGYKLVERLAFANAYGPFLQGLKNPVSDLSRGCS
                     LDDIVLTSALMIGS"
     gene            complement(615142..615978)
                     /locus_tag="BT0_RS02935"
                     /old_locus_tag="BT0590"
     CDS             complement(615142..615978)
                     /locus_tag="BT0_RS02935"
                     /old_locus_tag="BT0590"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772531.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethyladenosine transferase"
                     /protein_id="WP_011772531.1"
                     /db_xref="GI:500096524"
                     /translation="MNINYNSINSIKSALASKNIAPRKIWGQNYLINEHIREKIVDTL
                     EIKENENIWEIGPGLGAMTIILLKKTNFLTVFEIDPKYSEILNEQFGQFKNFKLIKGD
                     FLKTYKQERQNINKIFSNLPYNIASKVISMLIEDGILTHMVFTVQKELADRMLAKEGN
                     KNYSSFTVLVQSHFNVIKIMDIDKKNFYPIPKVKSTTLKLIPCKRVIKDFKAFNKLVR
                     TVFISRRKKLKNTIINFTKDGSILEEDFLKRFLDKRPEEISVKEFITISNKLTTNHQG
                     TR"
     gene            complement(616006..617283)
                     /locus_tag="BT0_RS02940"
                     /old_locus_tag="BT0591"
     CDS             complement(616006..617283)
                     /locus_tag="BT0_RS02940"
                     /old_locus_tag="BT0591"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="competence protein"
                     /protein_id="WP_011772532.1"
                     /db_xref="GI:500096525"
                     /translation="MILLFIVSALNLLTRYYLRLNPIYLNLILMSIFLIKRNAHLSLT
                     FMISTSLLVIFEISLNFKRLEDNFYQITNITYFAKYSNTKIESIDGFGKKYKFIFKNI
                     ENKYKIGDIVKIQNNKMQLIKKPLLVNIREKYNKLINRFLNSISTKYSHFSKAILTNN
                     KSDITKYESNLFQKAGISHILVVSGLHFYLIYIIFYYLLLIIKNEKLKYLILSTILLN
                     YLILTGFSPSTLRAFIMIKTLIIYKSTYGKINLLSTLAISFIINAIILPHTLNSIGFK
                     LSYLAVLGISISLALNQRYNLNKLIYPIFTTLMIQVSTAPIFYVNDLNLQPISILSNL
                     IVTPLMLVFLIITILSLGSYIINAHLFLLLDLMNTYIFKAIKETAIIFSKFPVIQNYN
                     VKIFLVLSILTILYIIYKLEQEKRYLNKNIKHQ"
     gene            617398..618102
                     /locus_tag="BT0_RS02945"
                     /old_locus_tag="BT0592"
     CDS             617398..618102
                     /locus_tag="BT0_RS02945"
                     /old_locus_tag="BT0592"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772533.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CAAX amino terminal protease"
                     /protein_id="WP_011772533.1"
                     /db_xref="GI:500096526"
                     /translation="MTLLNKYPLRYVFLEVLLSYFIVTRISPFDSIDVDLWNFDKNHY
                     YYWLYSTFLILFVVYFSKLTSSYNFRDEFFIPEFNPIFIWQAFLIFVKLLICIFLLLI
                     IFCFILYCLPESVRVWVEVGNSGFMWNIGSKQSLYLMVITSLFTGGVEELFYRAFIIT
                     KLKQIGITSLIAALLSSFIFAYGHFYYGFVGFLFALIFGGILSYIYLIHKNIYYSIFV
                     HSFYNIFVSVLLFLLN"
     gene            618116..620047
                     /locus_tag="BT0_RS02950"
                     /old_locus_tag="BT0593"
     CDS             618116..620047
                     /locus_tag="BT0_RS02950"
                     /old_locus_tag="BT0593"
                     /EC_number="6.2.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012539019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="long-chain fatty acid--CoA ligase"
                     /protein_id="WP_011772534.1"
                     /db_xref="GI:500096527"
                     /translation="MLDTIPKRFNEVVRLYGDLDIFIYKENESKDFKRQIYSDFWNEV
                     KSIGSGLLHYRIKKGDRVALISDSRKEWIIIDIAVMSLGCIDVPKGNDSSEDELVYII
                     NHSESSFVFVENAKQLQKIISKKHELKFVKHVVVIDDDKLYEDKLGNITIISYKKLLS
                     LGYDYLKDNPKMFDSELEKVSGKDIATIIYTSGTTGLPKGVVLRHESFIFQVDRIGDY
                     LPTIKPGKIMISILPLWHSFERTCEYIVALNGMAIAYSKPIGPVLLKDFAALNPHAII
                     SVPRIWEGIRIGIMKRVSESFFKRFLFNFFLKIGILYIKLKEKFLGLVPVYKRSNFLV
                     SIFIKVACLTGLIFILPFKFLGHVLVFRKIKKALGKRFEFGVSGGGALVNYVDYFFKA
                     VGIMVLEGYGLTETGPVLSVRRFKSPVANTVGPLFPDIEYRVVGNDGNFLSPGEKGEL
                     WVRSPQVMSGYFKDDTTTREVLTRDGWFKTGDLVCATINNEISIVGRSKDTIVLRGGE
                     NIEPESIERALSKSLFIENVVVVGQDQKFLGAIIVPNFEVLEKWAGSNEIIFDSHDDL
                     LSNESVNKLYSKCISDIVNLKSGFKSFERIVGFVLLKDSFVVGEELTNTLKLKRYYIF
                     EKYHKKIMSIFNKDDCELL"
     gene            complement(620078..621832)
                     /locus_tag="BT0_RS02955"
                     /old_locus_tag="BT0594"
     CDS             complement(620078..621832)
                     /locus_tag="BT0_RS02955"
                     /old_locus_tag="BT0594"
                     /EC_number="6.1.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginyl-tRNA synthetase"
                     /protein_id="WP_011772535.1"
                     /db_xref="GI:500096528"
                     /translation="MISKIKKDLENKISKTIKELALKQNITLDKINIIMKKPPKSELG
                     DLSILIFEFSKILKLSTSVIIEEIIKQIGKKYTTKSMGAYLNIKFNRKEYIKDIIKKV
                     NEQKEKYGINNVLKNKRIIIEFSSPNTNKPLHVGHLRNDIIGESLSRILKASGGQVTK
                     INLINDRGTHICKTMLAYKKFGNNTTPELSLKKGDHLIGDFYVKYNEYAKNNKMAEDE
                     IQQLLCKWEEGDEETVKLWKKLNKWAIEGIKETYKLTNITFDKIYLESEIFKIGREII
                     LQGLEKGLCYKREDGAICINIPIETNEMTDQKFKQKVLLRANGTSIYLTQDLGNILTR
                     KNEFDFDEMIYVVGSEQIHHFKTLFYVADKLGITKENNLVHLSYGMVNLPTGKMKSRE
                     GHVIDADNLIHDLSESTMIEIKKRHSNEQDSKKIALNISLGAIHYYLLKTAIHKDILF
                     NKEESLSFTGNSGPYIQYVGARINSILDKYDELNLPSKNINFDLLINENEWAIIKIIS
                     EFEEYIIKAAKDRNPSIIVNYSYLLAKSFSAYYQDTKIIDKDNPELTHARTDLSKAVL
                     QTIKNCMHLLNIPYMKKM"
     gene            complement(621822..622415)
                     /locus_tag="BT0_RS02960"
                     /old_locus_tag="BT0595"
     CDS             complement(621822..622415)
                     /locus_tag="BT0_RS02960"
                     /old_locus_tag="BT0595"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772536.1"
                     /db_xref="GI:500096529"
                     /translation="MNNKTFYITDRYLKTSLMLFPIFAYTKNFLEGTIISIWISLCIL
                     LPAIIIKQIELRNQILGIYLLIIGIVVSLTYLFMYYITPILYENLRFSIPILTVIIIS
                     FHKNEPFKSVKDSLSILQYSKLPIITFISLSATISLFREILNTGGLQLFNIKLSIIKD
                     GNIIKTPVYSSNIFLAASLIFLLINILINIKGKKNDQ"
     gene            complement(622431..624647)
                     /locus_tag="BT0_RS02965"
                     /old_locus_tag="BT0596"
     CDS             complement(622431..624647)
                     /locus_tag="BT0_RS02965"
                     /old_locus_tag="BT0596"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422351.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_041178500.1"
                     /db_xref="GI:752506635"
                     /translation="MKRNHSSSTLFYKFNIVIVIYTMIIATTIFLLLDHGYRKIITKE
                     LQSFTKFVNNIMIKSFSRDTRNMLIAIDDFVKNYNQNLNTQKSDHLNNVISIDQLSLF
                     PSYIKIIEYTNKNGKILYSSDERRLNTYINLQEMKTDSNIDNYHTVILNQDLTIINNK
                     SYIPMLYKIPQQDQNDLYNTSNANIKSEKNMSINHDGYVVLYADILEQIKQLRKNIFM
                     LLERSLLEKGNQHKSSHYFKIYAINSQGDIFGEQDEETLKPIKLSLNSLFENNPKITT
                     PLLNAIAQRKSNYNTSYNNNIISITRLTSSSWYLAIQMNYNNIFSNELNNIKLMSIST
                     IILLVIIFILIMIITIKKLIISKIEKLNKIIPKVKEGDLTIKIESKGKDSISATINYF
                     GYFIENLKNVINSLQGRVKLLKENGDLLFNEINKAYDTITNSNKYIEKTQGEIEKQVE
                     FISNTTNTIENLSKNIASLDNSIETQAASVEESSSAIEEMIGSIQSVTEITQKAAKST
                     EELKLFSDDGRKKQEEIIMQIKDIYKNSTRLQEANALISSIASQTNLLSMNAAIEASH
                     AGEAGKGFAIVAEEIKDLAEQVTSQSESVAASINEIMDSINQTVKTSELTNKAFNQIF
                     NSINLVVQVIEEINHTMQEQSIGSQEILKALNTMREITYEVKIGSNEMFRGNKEIINT
                     VSVLEEINVTVSNSMKGLKEEIKKLIEAVESIKTFGTTNSNHITEINTDTNQFKTK"
     gene            624857..627055
                     /locus_tag="BT0_RS02970"
                     /old_locus_tag="BT0597"
     CDS             624857..627055
                     /locus_tag="BT0_RS02970"
                     /old_locus_tag="BT0597"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011772538.1"
                     /db_xref="GI:500096531"
                     /translation="MNEDLVNVKLKNMSFLLYFILFIFICFGLLFLGQAYLNYKSGYL
                     ERVESDFKLFSNNVAFQIKNKYDGAVGVLKNLVENDRVLNVLHNVSNSFIASVDLRFI
                     DLDTSIALFLSSKGFNEVSKIFQHIPLEENSLEGIFYIPVGQNVLISNKNFSFLGINN
                     IIEDPIYFVPAKKHVTYYSSYKRIKNRLYSVVSIPVMNDSSAILGVICFLVCFDNLFI
                     DIANQFDSYLKFSNKNYEFFMIDREFNPLLMSLNDLSTDNFAENYASSVLSRVISHVK
                     DNPNISRDILKHKTSSYVLSTAQIDGSVVQGIILNMDYLPFKFQSNAIFFLGFIFFAY
                     LIIFYLYNRFILPFIGDFRMLLKYKKEREDILSLDPILEVQYKSFIFSYISAEFDNFF
                     SKTTNIVDSIKVYVRNLRKCLTEINIPEENIEKVHNSLTTYDKIGDAFSKFEKSIVNI
                     LKDFESISNPISDHNKNILDIATQFEENANAFYGIDKNLEIFSKVVALNSTSIDDVKN
                     KVFELNSIFENVNKNFSELLSQTNSLQSANKLLVLISAQTNMLAMNAAIEAAKAGDAG
                     KSFAVVAEEIRKLAINSGKYSTTIKDELKMVNNIISVVSSEIDAIYKDFIDIQENIHN
                     NAVQHERINITLAKHVKEIEEFKDKYLSYDIKIKDTKNMCKEIFNSYFVISGKFNNLN
                     NDLSEFEVSKMSLDALEPLREHVSLVNECREKVAKMKDVVENINNEFWDK"
     gene            complement(627057..627974)
                     /locus_tag="BT0_RS02975"
                     /old_locus_tag="BT0598"
     CDS             complement(627057..627974)
                     /locus_tag="BT0_RS02975"
                     /old_locus_tag="BT0598"
                     /EC_number="1.1.1.158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772539.1"
                     /note="catalyzes the reduction of UDP-N-acetylglucosamine
                     enolpyruvate to form UDP-N-acetylmuramate in peptidoglycan
                     biosynthesis; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
                     /protein_id="WP_011772539.1"
                     /db_xref="GI:500096532"
                     /translation="MLKNINNFLEKINIKPKTENLANHTTYKIGGISKLFLTPKTIKD
                     AEHIFKVAIKEKVKIFILGGGSNLLINDEVEIDFPIIYTGHLNKIELQNNQITAECGT
                     NFDDLCHFALQNELSGLEFIYGLPGTLGGAIWMNARCFGSEISEILDRVIFVDENGQT
                     ICKKLEKSEFSYKISPFQNKNTVILKATLNLTKGNKKHIEEIMKQNKQKRIDKGHYLS
                     PSSGSTFKNNKKFLKPTGQIIEECNLKGLNIGGATVSHYHGNFIINKNNASSKEIKTL
                     IEKVKTEVQIKTGFLLEEEVIYIGFNDKN"
     gene            628182..629627
                     /gene="cysS"
                     /locus_tag="BT0_RS02980"
                     /old_locus_tag="BT0599"
     CDS             628182..629627
                     /gene="cysS"
                     /locus_tag="BT0_RS02980"
                     /old_locus_tag="BT0599"
                     /EC_number="6.1.1.16"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R030.1"
                     /note="catalyzes a two-step reaction; charges a cysteine
                     by linking its carboxyl group to the alpha-phosphate of
                     ATP then transfers the aminoacyl-adenylate to its tRNA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteinyl-tRNA synthetase"
                     /protein_id="WP_011772540.1"
                     /db_xref="GI:500096533"
                     /translation="MLLRLYNTKTKSLSEVKNFSDIKVYACGPTVYNYAHIGNFRTYI
                     FEDLLIKSLRLLKYNVNYAMNITDIGHLTGEFDEGEDKVVKAARERGLTVYEISRFFT
                     EAFFCDCEKLNIVRPDKVLIASEYIASMIEVIKVLEQNGFTYFVNGNVYFDTSLFKSY
                     GQMAGINLNDFEFSSVSRVEVDPSKKNKSDFVLWFTNSKFKDQEMKWDSPWGFGYPSW
                     HLECAAMNLDCFRSTLDIHLGGVDHIGVHHINEIAIAECYLNRMWCDIFVHGEFLIME
                     DEKMSKSNNNFITIQDLETNGFSPLDFRYFCLTAHYRTQLKFTFNNLRACKVARKNML
                     NKLTAVFSSLNQFDLLLLSKNYENIESVLEKRYYDSFLEKIAFDLSIPQALALLWDII
                     KDDNLSALSKLRLTFKFDEVLSLGLKEGVFREIEKDRINIDDAMNSLLEERRLAKIRK
                     DFKRADEIREYFYSKGFVLIDTEEGTKVKRG"
     gene            629631..631181
                     /locus_tag="BT0_RS02985"
                     /old_locus_tag="BT0600"
     CDS             629631..631181
                     /locus_tag="BT0_RS02985"
                     /old_locus_tag="BT0600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772541.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011772541.1"
                     /db_xref="GI:500096534"
                     /translation="MAVFFKSQYFVLSLVFLIFLSLFIFSGFLFYLKPVIYEISPMPA
                     SHENVIVIKGRNLGDKIGEININDHYLMKSSIVSWSNEKIVFKITDEINSGLVFIKSE
                     KGISNELFLVISRQVPIKLEKKNKPFLFVTDELVLMTNVPVILRGKNLVSNFAGVEIF
                     IQTKHELYKVLPRDILKLSEEEIKFIPPKTLHIDGEIFLQVDGVESNKIPFNFNINFF
                     KWNLKRTRNFKISHEIYFVQAYSKDLSLTSDDINFNVFYLNPIENERQKIKFSDNNGA
                     ILDLDNLFFKSLKSNTYHLKFEVETCKLDLDIFDRKALESIKVNTDSNMYEFKTYVLN
                     KRDRYLSYDSLDLSSINLNVNNKDSAYELAKSIIDALILHFTVIDNDLTLDESIKVRE
                     ISADNLILLTNLLFLRNNIPLRNAVGLYFDTRSSSLKEHTWCEFFLEHIGFIYFDIVN
                     AVLFRDSSNYFLSMSENYIQYGYKEDYDDLLFDDYFDLLLLKYKSLTNSNYSLNYRIT
                     LEENINDR"
     gene            631171..632424
                     /gene="glyA"
                     /locus_tag="BT0_RS02990"
                     /old_locus_tag="BT0601"
     CDS             631171..632424
                     /gene="glyA"
                     /locus_tag="BT0_RS02990"
                     /old_locus_tag="BT0601"
                     /EC_number="2.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R032.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_011772542.1"
                     /db_xref="GI:500096535"
                     /translation="MIDSILFDLIEREAKRERENIELIASENFVSLGVRQAVGSILTN
                     KYAEGYPSKRYYGGCFVVDDIENLAISRAKELFGASYANVQPHSGSQANMAAIMALIK
                     PGDKILGMELSHGGHLTHGSKVSFSGMLFDAYSYGVSRDSEIIDYDDVRRIARECRPN
                     LIIAGASSYSREIDFKKFREIADEVSAYLLCDIAHTAGLVVTGFHNSPIDVAHLTTST
                     THKTLRGPRGGLILAGKESSMIVNFNNKERTLENAVNSCVFPGTQGGPLMHVIAGKAV
                     AFGEALMDEFKDYISSVIENTKAMAEYFVSEGFRIVSGGTDNHLFLVDLGILGITGAD
                     AEKVLESVNIILNKNIIPFDSKNPSVASGIRIGGAAITSRGLNRDDSIEVARFIIRAL
                     KTKSDYELKKIKCEVVEFISSFNMP"
     gene            632451..633200
                     /locus_tag="BT0_RS02995"
                     /old_locus_tag="BT0602"
     CDS             632451..633200
                     /locus_tag="BT0_RS02995"
                     /old_locus_tag="BT0602"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_011772543.1"
                     /db_xref="GI:500096536"
                     /translation="MSNLFQIFFLLLSFILIFSPFILSMFFIFFVFFIITSILGGFRT
                     YTTRDYFYSKSRELEFYKLSCLLMAKLISILGSMTGEQLNYINFIINSLNLSEKHKTE
                     LYNVFHFSVTQNRNADKILYTLKLGYFQHRDLFVWLVSVLKEINNLARYGNLEGDKFI
                     RYVSAFLEIDFENHDAYKNINIEIVNPYEVLGLRYNASDDDIKKAYKKLVIQYHPDRF
                     ASEPIKQREANEKFIKIQDAYEKICKERNLK"
     gene            complement(633305..635098)
                     /locus_tag="BT0_RS03000"
                     /old_locus_tag="BT0603"
     CDS             complement(633305..635098)
                     /locus_tag="BT0_RS03000"
                     /old_locus_tag="BT0603"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772544.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772544.1"
                     /db_xref="GI:500096537"
                     /translation="MNKTILLCIFIFILTTVTVFADDTDKDISKSNPWSPKLTFENSS
                     EFRFDMDESIPGLENKSQLGIKFVPYETHNEIGKHDPFSAYIKVEDLVLKAKGKKDAI
                     LKLDVGSITTQINIYDFYLKIESMTDFDFNQESLFSFAPMTSIQSEYYGFPSDDCATR
                     RTILARSTAKTIGTLQFGYTFPQLELVLAIGATGTGNRNYKKNANDSEEDKKKKDETP
                     YNNTYQGILYGTKVKWTPMKNELAQYSSDVIAEIPFELHFGLSGAIGNSTFNHSSITY
                     GLKDKSVVGSDLVSPTLSNASIMASIGFTYKLGLTKINDKNTYLLIQTGSDVGIDPFA
                     SDFSILGHISRKANTDDKDQFNPTENKLKFDNKRSTNFAFSVGTGIGLAWNTDDGEQE
                     SWSISGDNSYNTRIFGTQNKKSGIGLGITYGKNLYKPTSSNKIIQDIAAKSFQTFNAE
                     ISTYEDNTKGIIPGLGWIASLGIYDLLKEQPQSNDIITILTPKTNTQTQTQTVAFTEA
                     TKIGGALYIDYAIPVESISPTTHIIPYVGTHILGSFKGSDKSIYLKAGVELDNLIKLT
                     KISLGWDSNNLFATKDQMGSVFLQFAVAFNE"
     gene            complement(635298..636800)
                     /locus_tag="BT0_RS03005"
                     /old_locus_tag="BT0604"
     CDS             complement(635298..636800)
                     /locus_tag="BT0_RS03005"
                     /old_locus_tag="BT0604"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422359.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate permease"
                     /protein_id="WP_041178501.1"
                     /db_xref="GI:752506636"
                     /translation="MNFYDFIKALVPITLIIIGLGIIKKPAYYVIPICLIVTIAITLF
                     DKNLGIINTSLAIFEGTIMGIWPIVIVIIAAIFTYKMAESQNDMKIIKAMLSNVSSDK
                     RIIVLLVVWGFGNFLEGVAGYGTAVAIPVSILMAMGFEPFFACLICLIMDTSSTAYGS
                     VGIPIISLSQATGLDVNMLSYDVSLQLILPTLIIPFVLVMLVGGGIKGLKGGMFILTL
                     LSGASIAISQVYVSKTLGPELPAILGSIPAMAITIIYAKLFANKDTINNNIKVSAMQG
                     FLACLPYILIVSLIIIVSPLFYGINKYLSNFKTTLSIYPGANPLQFKWLTSPGPLIIL
                     ATVVSYSIRGVPIIEQLKTFVLTIKKMALSSFVIICIVSISRLMTHSGMIKDLADGIS
                     TLTGTLYPLFSPLIGALGTFLTGSDTVSNVLFGPLQTQIAANIDVNPYWLSAANTTGA
                     TGGKMISPQNITIATTTAGLIGQEGKLLSKTIVYALGYIFISGILVYFLL"
     gene            636885..637823
                     /locus_tag="BT0_RS03010"
                     /old_locus_tag="BT0605"
     CDS             636885..637823
                     /locus_tag="BT0_RS03010"
                     /old_locus_tag="BT0605"
                     /EC_number="3.4.16.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772546.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine-type D-Ala-D-Ala carboxypeptidase"
                     /protein_id="WP_011772546.1"
                     /db_xref="GI:500096539"
                     /translation="MKIIPVILNILILSSVFGELFSIDLLEIKKVTEDAKSVVLIDYD
                     TKCILYSKNPGLVFPPASLTKLVTIYTALVEARKKNIDLKTTVPISSAASYYNLPLDS
                     SLMFLEEGHKVNFEELLKGLIISSGNDAAIAIAEFIVGKNLSDFVDLMNINVLNLGLI
                     NMSFVDTSGYSSDNKITALEMALFARTYIEEFEFILDIHSLKDFIYPRSENLGNTSSL
                     KMLNFKQKNKNVLIFNYPYADGLKTGYIKTSGLNLVATAKKDDIRLIAVVLGVNKGVD
                     NVGERKRALIAQKLFEYGFGNYAQFSFIGKIKRKDL"
     gene            638079..638570
                     /locus_tag="BT0_RS03015"
                     /old_locus_tag="BT0606"
     CDS             638079..638570
                     /locus_tag="BT0_RS03015"
                     /old_locus_tag="BT0606"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R037.1"
                     /note="catalyzes the conversion of glutamine residues to
                     glutamate on methyl-accepting chemotaxis receptors;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheD"
                     /protein_id="WP_011772547.1"
                     /db_xref="GI:500096540"
                     /translation="MLNHFNFKLKRDVTIIVPGEAFVSNDRVISTILGSCVSVVLYDG
                     VRRLIGVNHYVLVKSDSVVDVLQKGRYGVYAIPMLIDAMIENGASKSNLKAKLFGGAN
                     FMAKGTIRVGVENSEFAVNSLTKYGIPVVAQDFDQSKSRKIFVFPENFKVVVEYPDGA
                     KIF"
     gene            638846..640267
                     /locus_tag="BT0_RS03020"
                     /old_locus_tag="BT0608"
     CDS             638846..640267
                     /locus_tag="BT0_RS03020"
                     /old_locus_tag="BT0608"
                     /EC_number="3.4.13.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772548.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoacyl-histidine dipeptidase"
                     /protein_id="WP_011772548.1"
                     /db_xref="GI:500096541"
                     /translation="MENVVIRYFRAISQIPRCSQNLKGISNFIKEEARKFGYSFKEDS
                     IGNIVVEIKANGCSNMFPIILQAHTDMVCEKNESVVHDFEKDPINIIEDNGYFVASGT
                     TLGADDGIGVAMMLAIMSESSTFKHPALELLFTVDEEIGLIGAIGLDPNLCSGKMLIN
                     LDGEEEGYFLVGCAGSRLVHINFEPQYRQNRKKTGIEILFTGLKGGHSGADIHIDLAN
                     SLKLMFFALSTLRANMEFEIGYISGGDKSNAIPREAKALILIEAEHYVLLEKELKSFK
                     RHMQEMYTFDSDFEIILRRVNFSGDVLDDMDQDKLLNMGMAFLHGVQKVENYGEKLIR
                     TSLNFASLLKVGNEYQFVFTIRSLLDIEKEYVFNHLKAISSLSGANFKIVYDYSSWKP
                     AENSKLLNHLKNVYKNMYLEEAKTVVIHAGLETGIISAKFGGIDSVTIGPWINAPHTP
                     REQVDIASTIRVYNFLKKSLETL"
     gene            640368..640441
                     /locus_tag="BT0_RS03025"
                     /old_locus_tag="BTT0018"
     tRNA            640368..640441
                     /locus_tag="BT0_RS03025"
                     /old_locus_tag="BTT0018"
                     /product="tRNA-His"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:640402..640404,aa:His,seq:gtg)
     gene            640460..640533
                     /locus_tag="BT0_RS03030"
                     /old_locus_tag="BTT0019"
     tRNA            640460..640533
                     /locus_tag="BT0_RS03030"
                     /old_locus_tag="BTT0019"
                     /product="tRNA-Arg"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:640494..640496,aa:Arg,seq:tcg)
     gene            640591..640671
                     /locus_tag="BT0_RS03035"
                     /old_locus_tag="BTT0020"
     tRNA            640591..640671
                     /locus_tag="BT0_RS03035"
                     /old_locus_tag="BTT0020"
                     /product="tRNA-Leu"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:640625..640627,aa:Leu,seq:tag)
     gene            640678..640749
                     /locus_tag="BT0_RS03040"
                     /old_locus_tag="BTT0021"
     tRNA            640678..640749
                     /locus_tag="BT0_RS03040"
                     /old_locus_tag="BTT0021"
                     /product="tRNA-Gly"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:640710..640712,aa:Gly,seq:gcc)
     gene            640798..642144
                     /locus_tag="BT0_RS03045"
                     /old_locus_tag="BT0610"
     CDS             640798..642144
                     /locus_tag="BT0_RS03045"
                     /old_locus_tag="BT0610"
                     /EC_number="5.2.1.8"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="trigger factor"
                     /protein_id="WP_011772549.1"
                     /db_xref="GI:500096542"
                     /translation="MILNNDVKLIPGSKVEAVIRISKKFVKSKYNEILQDYSSRLKVK
                     GFRIGKVPFSIIEGKYSDNIRALTIEKLIHKSLEEFFKSATYKPLGYAVPKILDEKLE
                     IDFSKDFEFTVVYEAYPEFELPDISNVEVEIPEVFVSDSDVEEELKLLQLENAIVVED
                     SGDVKSGSIVRVDFVELDDSLSEILTTKRQDFVFTVGESNNYYGFDNDIIGMKKDEEK
                     IVEKNYGMDYKFSELANSFKRLKISLKDIKRRDIPKLDDDFAKDIKDSFNTLEDLKEH
                     IRENMLRLVKERSESLKLSKLLSDIAEKLNIEIPSSMFEAEFKNVLNEFSHQNKINLE
                     QLSNSSTGLEGINDVFKENVLKKLKSKLIFQKIVDNDLTEVTDSDLEDELVKQAEDAK
                     MKLADIKKFYQEKNLLEILKDEIKRQKVKDKILKNVKEINPKKVAFRDFINYKTGE"
     gene            642144..642743
                     /locus_tag="BT0_RS03050"
                     /old_locus_tag="BT0611"
     CDS             642144..642743
                     /locus_tag="BT0_RS03050"
                     /old_locus_tag="BT0611"
                     /EC_number="3.4.21.92"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772550.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Clp protease proteolytic subunit ClpP"
                     /protein_id="WP_011772550.1"
                     /db_xref="GI:500096543"
                     /translation="MIREYMHNLVPTVVEHTGNYERVFDIYSRLLRDRIIFLSGEIND
                     VRADTVIAQLLFLESEDSKKDIYVYINSPGGSITAGLAIYDTMQYIKPDVRTICIGQA
                     ASMAAFLLAGGAIGKRESLSYSRIMIHQPWGGIGGQASDISIQANEIIRLKRLIIDIM
                     SDKIGVSKEKLSLDIERDYFMTPKDALDYGIIDGILVRN"
     gene            642767..644056
                     /locus_tag="BT0_RS03055"
                     /old_locus_tag="BT0612"
     CDS             642767..644056
                     /locus_tag="BT0_RS03055"
                     /old_locus_tag="BT0612"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent protease"
                     /protein_id="WP_041178502.1"
                     /db_xref="GI:752506637"
                     /translation="MARSKSQKIEGCSFCGRTKAEAEGRIISAKSVAICFECSKICHN
                     LFKEETEKPVRPKSSRGLPTPKQLKSHLDKYIIGQEDAKKVLSVAVYNHYKRIFKGNK
                     RDNGVELEKSNILLVGPTGSGKTLLAKKLAAEMNVPFAMADATTLTEAGYVGEDVENI
                     LLKLIHAADGDVSFAERGIIYIDEIDKIAKKGENVSITRDVSGEGVQQSLLKIIEGTI
                     ANVPPKGGRKHPYECTIEINTQNILFICGGAFVGLENIIKKRINKSSIGFSSAGRKDS
                     GEINSLKYLEMEDLVKFGLIPEFVGRLPVHSYLEKLEKEDLIKILIEPENSIVKQYCH
                     MFKMDNVDLLFERDALDAIAEEAMLKNTGARGLRSILEELLKDVMFEIPSTKQIKKVI
                     VTKESVLSSNIEPLILTGRHANKPWAKELYEINSQSN"
     gene            644031..646436
                     /locus_tag="BT0_RS03060"
                     /old_locus_tag="BT0613"
     CDS             644031..646436
                     /locus_tag="BT0_RS03060"
                     /old_locus_tag="BT0613"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Lon protease"
                     /protein_id="WP_041178503.1"
                     /db_xref="GI:752506638"
                     /translation="MKSILNLISSKKDDLPVIVLRQNVFFPNVTLWVNCDDSISINAI
                     YQSMLEGRLILFFCVNDLNSDNSSKISLENLYSIGIYAKIIQVVKVTEILIKILVTFQ
                     DRVIIKSIVKKNNYFRAKVDFISDKCEFNNELFTYSKFLREAYDTYRSYLPVKKLDND
                     ESNDFFDSPAKLVDVIASNVNLEYKVKVELLQELDVKLRIEKLIINLNIETELLILKK
                     DIKAKVKTKLDKGQKEYFLNEQIKEIQKRLGRDETDYLERLNSKNIPENIKSRIEKEI
                     SRLTRVNTNSPDANIVRNYVELLLDLPWDENTVMKNSLREIELILRNSHYGMYETKEK
                     IMNFLSVYHINSKVQAPILCLVGPPGTGKTSVALSIAKSLSREFTKISLGGLRDETEI
                     RGHRRSYVGALPGVFINAIKVAGKSNPVILLDEIDKINSTYKGNPEAALLEVLDSEQN
                     SRFVDHYLEIPYDLSNVLFVATANSLHEVSRPLLDRMEIIKIEGYSCVEKLEIAKNFL
                     IPNIIKDSCLNNVYIKIEDDVVLHIIRNCTMESGVRNLKRVLTNLFRMVVRELLYVYS
                     REDIIKGNFYFPSSLMHGNNLLFTHDPDIPGIYKIINMNNFHFYVNCEYKFNLIRIDS
                     SGFVYGLAWTSYGGAVLPVEAIKFDKKGDIILTGSLGSVMKESAQLAYSVVKTYSSEL
                     NFDINEIPEIHLHFPEGATPKDGPSAGITIATAIASVLSDKRVPLDLAMTGEVTLKGS
                     ILPVGGIKEKVLAAYRNGINKIIIPKDNEKDYVKLPEDIRDNIDVKYVSNLGEVFNYL
                     NII"
     gene            complement(646652..647278)
                     /locus_tag="BT0_RS03065"
                     /old_locus_tag="BT0615"
     CDS             complement(646652..647278)
                     /locus_tag="BT0_RS03065"
                     /old_locus_tag="BT0615"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S4"
                     /protein_id="WP_011772553.1"
                     /db_xref="GI:500096546"
                     /translation="MNRKNIAKGKLVRRFGVNIFEQPKYDKLLKKKPNAPGMHGRSRR
                     AKITEYGKQLIEKQKVKFTYGVSERQLTNIFKESRRQHGVTGDNLLALLERRIDNVVY
                     RAGFAISRAHARQIVSHGIIMLNGRRVTIPSITLRANDMIQVKEKDRLKKLVRSNIEK
                     TSTLRKLPTWIEVNADDLNVKITRPPSRDEIPTLANEQMIVEYYSKRA"
     gene            complement(647299..647372)
                     /locus_tag="BT0_RS03070"
                     /old_locus_tag="BTT0022"
     tRNA            complement(647299..647372)
                     /locus_tag="BT0_RS03070"
                     /old_locus_tag="BTT0022"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(647336..647338),aa:Met,seq:cat)
     gene            complement(647428..648726)
                     /locus_tag="BT0_RS03075"
                     /old_locus_tag="BT0616"
     CDS             complement(647428..648726)
                     /locus_tag="BT0_RS03075"
                     /old_locus_tag="BT0616"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772554.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772554.1"
                     /db_xref="GI:500096547"
                     /translation="MIKIINNKNINKCTNLKLASLKKDEIYIIYTENNVEMVSYLKAK
                     IQNKEIKINNFYIDPNFKAEGIERVLIHNLIYYGKKNKLQKILCKINDIKEELKNLGF
                     ENNNNIYEKDLTYETKKNTLIIRIGLISVLAEVASITSKLTVGILFNSFALIADALHV
                     TSDFILSTITYFSLKITNRPETIYYPYGYKKMENLIAFIIGLIIIISGFTMFLGTTGL
                     NKLMNFRNESGLHIHNHGYDHQEYDHYHEDKKNILEIFSNNSLKKSIWIPLIPFIFFL
                     VKIIEYLVKFQIGKRYNNYLLLALSSSDKNCIFSHGGTTLSLLLANYVWTGFDKIISI
                     CISFIMIKEGLHVIINNANKLLSKQDIDLKRKIKNTLKNINVNFKELNLFHQGNDLSL
                     HVKLDLSYENDLKSLIQKKEKIKYTIKKYHKEICEIYILI"
     gene            648842..649210
                     /locus_tag="BT0_RS03080"
                     /old_locus_tag="BT0617"
     CDS             648842..649210
                     /locus_tag="BT0_RS03080"
                     /old_locus_tag="BT0617"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772555.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178504.1"
                     /db_xref="GI:752506639"
                     /translation="MLQSQFFVKRCKRAISKEEVLINNVKNVEHVFYNFFKIFDEKAL
                     KSVFDYYYENFDFDEGIYAFIDKFIPIINFLSLEVLDYEFSIDEKKLILEVFDSSACT
                     LKDDTLSEFARAIVSLGILD"
     gene            complement(649244..649699)
                     /locus_tag="BT0_RS03085"
                     /old_locus_tag="BT0618"
     CDS             complement(649244..649699)
                     /locus_tag="BT0_RS03085"
                     /old_locus_tag="BT0618"
                     /EC_number="3.5.4.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772556.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine deaminase"
                     /protein_id="WP_011772556.1"
                     /db_xref="GI:500096549"
                     /translation="MKDNEQNAIVKAFQLAETARNNAYSPYSKFKVGACIKTKDNLFF
                     QGSNVENASFGATRCAEQAAIMNMISSVGIQKIDFMLITTTPASVPCAICRQVMSEFF
                     EENTKILMTDPNQFNATKTISQTYTLKDLLKIPFNKEELSRIFKANQET"
     gene            649830..650789
                     /locus_tag="BT0_RS03090"
                     /old_locus_tag="BT0619"
     CDS             649830..650789
                     /locus_tag="BT0_RS03090"
                     /old_locus_tag="BT0619"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="delta(24)-sterol C-methyltransferase"
                     /protein_id="WP_011772557.1"
                     /db_xref="GI:500096550"
                     /translation="MIDVIEFIKKYNNFIIIGHKDPDFDCIGSSLALASFLSRIGKRV
                     IMLNEGPFVRKEIIPFKDKFLSKWPDIDSSDYAVIILDCSIFDRIGDEFGFYVKDMPI
                     LVIDHHASGDKLDVPGYIDSFAPSTTFLIEKLIRKFGYEVTKEEAWYILVGFCTDTGF
                     FRFISRSDPEPFEMVARLVSKGLSLKDVYNYIESVKSLTSIDMLSVMLNNLKAYFDGK
                     VLLTILPFNSKKDNNVSGVNELFYALLSNVENNEILIILKETEDGSILVGLRSREYFD
                     VGELAKYFGGGGHKHASGFKIKNSSLNLLESQIISYIKDAIKA"
     gene            complement(650779..652344)
                     /locus_tag="BT0_RS03095"
                     /old_locus_tag="BT0620"
     CDS             complement(650779..652344)
                     /locus_tag="BT0_RS03095"
                     /old_locus_tag="BT0620"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-glucosidase"
                     /protein_id="WP_041178578.1"
                     /db_xref="GI:752506713"
                     /translation="MDNIVSQMDDKELLGQMFMISYPKEQITKFVLNFIKEKNLGGIK
                     IFGWNAKNLHTLIESINKAQSMSQNNRFKIPLFIATDQEGGWTQHIKLKTSKTIGNLG
                     ITATLSPNDSYLTGYHIANELRQLGINLNFAPITDIYSNEENFTIGPRTYSNNPQIVS
                     LFALAFYKGQKQAGIISTAKHFPGHGNTIVDSHIKMPIINSNLKEMQSNELLPYKILI
                     QENIPMIMSGHLAYPMLTNGKEIPASSSIKIIKELLRKKLKYDNLIITDDLLMNAVRY
                     NNESIYDTIERIIRTETDILLISLNENIQNNAYNKLLSLMQKDSEIRENIIKSNKRIL
                     RIKLEYLKERKNETEIYSNHKKVQAIPTKEAKNFFEQSTLRGITKIKLSKQVSKHKKT
                     LLISPYNTMIKEGKKIFQNSSGYYYDYYPLNNMNPTKLKEIKKLIEKHEQVIFNLSTP
                     ASQQYIENLKEYKDKISIIVSLTPQYIKNLDWIQNIVIVYGTTILSFKSGFLTLTEDF
                     NPKGKSPLINFKP"
     gene            652770..652843
                     /locus_tag="BT0_RS03100"
                     /old_locus_tag="BTT0023"
     tRNA            652770..652843
                     /locus_tag="BT0_RS03100"
                     /old_locus_tag="BTT0023"
                     /product="tRNA-Met"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:652804..652806,aa:Met,seq:cat)
     gene            652860..653405
                     /locus_tag="BT0_RS03105"
                     /old_locus_tag="BT0621"
     CDS             652860..653405
                     /locus_tag="BT0_RS03105"
                     /old_locus_tag="BT0621"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-methyl-5(B-hydroxyethyl)-thiazole
                     monophosphate biosynthesis protein"
                     /protein_id="WP_011772559.1"
                     /db_xref="GI:500096552"
                     /translation="MRVAIVLANGFEEIEAIIPMDILKRGGVDLKVISLSDDKVVSSS
                     RGFTFYADEKISDYSEDHFDLIILPGGMPGAVNLFESKDLDKILRNMNLQGKLIAAIC
                     ASPAIVLSAKGLLGANKFTCYPGFENDITDGEFVDEDVVISNNFITSKGVGTALEFAF
                     TLLKIVKGERVLEDVKKQVLL"
     gene            complement(653552..654766)
                     /locus_tag="BT0_RS03110"
                     /old_locus_tag="BT0622"
     CDS             complement(653552..654766)
                     /locus_tag="BT0_RS03110"
                     /old_locus_tag="BT0622"
                     /EC_number="2.7.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetate kinase"
                     /protein_id="WP_011772560.1"
                     /db_xref="GI:500096553"
                     /translation="MKILTINTGSSSLKFTLYKHKNTQILVSGTIEKIKTKKSIIKIK
                     TKNGLLEKTDKHIKSHKEALKQLIRILTNKKLKIIENPDEIQGIGHRIVHGGPSFKNS
                     TILNTNTLSELKKISKLAPLHNPIAIKVIEITLKIFPNAKQVLCFDTSWHKTMNENAF
                     LYATPYSWYKDYNIRKYGFHGLSYSYITKRVATILNKPKEDLNLIILHLGNGSSINAV
                     KKGLSYDTSMGLTPLEGLVMGTRSGDIDPAIIPLMSKLLNKTPKKIEEILNKQSGMLG
                     ISLKSNDLRDIWEGVKNNEYNSKLAVEIMAYRIKKYIGSYLAVLDFNIDAIIFTAGIG
                     VTDYGIRELSLKGFEKIGIEIDPQKNNLARDKHTESDISSEKSKTKILVIPTNEELTI
                     LEDTYNLITKPS"
     gene            complement(654783..658151)
                     /locus_tag="BT0_RS03115"
                     /old_locus_tag="BT0623"
     CDS             complement(654783..658151)
                     /locus_tag="BT0_RS03115"
                     /old_locus_tag="BT0623"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription-repair coupling factor"
                     /protein_id="WP_011772561.1"
                     /db_xref="GI:500096554"
                     /translation="MNIEKELTARLNDNQNLKKIQQLIEKNLPFTIVGHEGFFKAFLI
                     NKIKEYSSSNKIILIVKNESISDELKDDLMQITDNIYELNYFSPLIYKDIGSKSKVFI
                     KRVKFLINFYENNPGIYIVSLKSLLSKIPTKENLFKNIYKIQTDTIINIENLESKLIK
                     LGYEKTMRVTLPGEFTIKSEIIDIHSFNKTEPIRISVKVDKIKEIKYFNPLTQLKKGT
                     PISEFAIIPKKEIIWNNENINKLKHHLKENEYKKLFEQIETKYNARAEEIFYPLIGDT
                     YLSQEINEDIPIINLEIPNLQEEIKKIYKEYEKLYSQAIESGKKTIAPKEIFINLSDL
                     KLKTNIFIVQTPANIKTKELIEFNIESERKFFSNITLAKEEIQNWLNNGFKVIIAAES
                     NSQKEKLKYIFKDLTKIKIEILKISSSLIINKEKIAIILESDIFNRRQKTNKAFESSK
                     TKTIDSFIEVEKNSHVVHINHGIGIFRQIKRIKTSLLEKDYIEIEYADNEKLFIPIEQ
                     THLIQRYIGNETQNIKLDKISSKTWEKKKAYAKKRIDAIADKLVELYVQRESSKGFQY
                     PQDNEWQLLFESEFPYDETPDQLTAISEIKQDMMSLKVMDRLLCGDVGFGKTEVAMRA
                     AFKAVMGKKQVAILSPTTILTEQHFNTFKQRFKNFPINIAMMSRFIKKSKERDIIKKL
                     ETGEIDIIIGTHKILSKKIIYKNLGLIIIDEEQRFGVKEKEKLKEIKISVDCLALSAT
                     PIPRSLHMSLIKLRDISVLKTPPQNRIKIETYVEEFSELLIKHAIENELSRDGQVFFV
                     HHNIQELDLIKAMLEKMVPYARIATIHARLQGDQIENIMHDFINKSYQVLLATTIIEN
                     GIDIENANTIIINNANRFGLAQLYQLRGRVGRSSQKAFAYFLYKENSSLNESAIERLR
                     AISEFSELGTGFQIAMKDMEIRGVGNLLGREQHGEIESIGLDYYLTMLNKAIEKRMGK
                     NSKEDEITIEINYNGFIPDSYINNEQDKISIYKKISKVQNKEENNKIRTEIYDQFGPI
                     PKELNNLLILSELKLLAKKLNITSLKEKNELLEIEYLNTKSIPAEKIMQIIKDNPTIL
                     KINPEYKNSVFLNLKHIKKSEKINCIYKNLNLLL"
     gene            658249..659211
                     /locus_tag="BT0_RS03120"
                     /old_locus_tag="BT0624"
     CDS             658249..659211
                     /locus_tag="BT0_RS03120"
                     /old_locus_tag="BT0624"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772562.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772562.1"
                     /db_xref="GI:500096555"
                     /translation="MKFRNLLFVISLMVVPFMLFPRDYKGLDFKIKFFNQSIYRVNSN
                     VSIEVSLSNSSDDLLVLEIGDVNTFGFDFDVTDTTNIKVKRSLEYVKDRAKNVAIPVR
                     TLSLRPNERFSVVMSLNQFVQFDKDGVYFVKGMFFPDISDPQKRVESNVITLFLKPKM
                     DDVAGKFDFSNLSSNREIQSILKRENLSPDKVVEYLFSALRLGEREKFFLYIDIESLI
                     LSDQNKSYLYKQELKSGSNNMLEEYKDYLWNDSNSAISKVPSKFSIIETTYTDSTGKV
                     VSDVYFEDGHFYVAKRYTFFLKKYDYYWIIYDYTVQNTGIKEKY"
     gene            659168..661216
                     /locus_tag="BT0_RS03125"
                     /old_locus_tag="BT0625"
     CDS             659168..661216
                     /locus_tag="BT0_RS03125"
                     /old_locus_tag="BT0625"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772563.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_041178579.1"
                     /db_xref="GI:752506714"
                     /translation="MIILFKILGLRRNTRPFIFKIKGLSIVLWIVSYFSLYADFKHEV
                     VKGDTLYSISLKYKIPIKELKSANNLKSEHIRVGRILVIPNSSKVNKIITKKNNRKPK
                     LSKLDAKIHVVKVGDTIEDISKQYGIKEKELLAWNNLSSKLLKVGSKLNLDEPSFLKP
                     YIVKKGDSLSKLSVDFDISIEDIIRFNSLENKSLIIGQKLYLKRTSGNVNFHYVKRGE
                     TLGKIAYIYGVTARHLVRLNGSKAINLKADSILDVSKVIEEDLPSSKSLQLKSENRSS
                     ETFISHKVSVGETLYSIARKYGVLLEDLKSWNNLNGNSIFHNQELKIYDKSKGPVVAN
                     KELKEFVDKTSKTTVKAIANIVSAKSKKLNLNFSNVLDNRDVFDISALVVLEPKIPIF
                     EANGVFYYWYKPKKGSQPSEFYSEDWYSPLNAYKKASQLFKSFESLVQSRPVKNNSLK
                     NKLIIIDPGHGGLDPGAIVKARDGLKNEIFVVEDEYVYDIALRLYVYLKEYGANVELT
                     ILSPDHLIRDSVSANNTFVNVKNEVYNDYDLNKTDTVDSWINGTQEGLRKRLAVVKKF
                     INKYKNVKEQDVLYISLHSDNSVGAPRCMGFYYQSEDGKGFDAHSKSMIEKMTKGFKR
                     TPYIKGQNLYVLKNNVVKTKLLVEVRNLAFDEEAWAIRSSKLRDRDSKILADAILKVL
                     "
     gene            661293..661364
                     /locus_tag="BT0_RS03130"
                     /old_locus_tag="BTT0024"
     tRNA            661293..661364
                     /locus_tag="BT0_RS03130"
                     /old_locus_tag="BTT0024"
                     /product="tRNA-Asn"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:661325..661327,aa:Asn,seq:gtt)
     gene            complement(661368..661904)
                     /locus_tag="BT0_RS03135"
     CDS             complement(661368..661904)
                     /locus_tag="BT0_RS03135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014023841.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease M5"
                     /protein_id="WP_041178505.1"
                     /db_xref="GI:752506640"
                     /translation="MEQIKEIIVVEGKDDAKRIKELFKCTIVETGGLYLKKSTINVLK
                     KAIETNGIIIFTDSDKAGDLIRKQILKKVGYLDQGKIKHAHLNNKNQEVEMSSKIEIT
                     TILKKIGTFYNEKQKEGLNLNDLIELGITGSQSKKKREQIQKHFNLGNGNNKKLLERL
                     NYFKIKREDIEKIILTKE"
     gene            complement(661908..663176)
                     /locus_tag="BT0_RS03140"
                     /old_locus_tag="BT0627"
     CDS             complement(661908..663176)
                     /locus_tag="BT0_RS03140"
                     /old_locus_tag="BT0627"
                     /EC_number="3.4.11.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminopeptidase"
                     /protein_id="WP_011772564.1"
                     /db_xref="GI:500096557"
                     /translation="MHDQTLDISHFQKLLDKSLTPYHLINYIEQKLVYYLNAKELKLD
                     DKWTLETGYYYVKKEGTSLIAFNINTNTIHEPFLIAAAHSDSPGLKLKIESRKYKDNV
                     FSHHIETYGSPIISTWTDRDLSLSGVVYFNKDEIINSELITIENIGIIPNVAIHLNRN
                     VNEGFAYDTHENIVIITSFKKSIKEKILEKLQISEKDFLSCDLIFTASEPAKIIGSEG
                     EFLASKNLDNKSGCHAIMNAFVHTNNNKNKVAVFFDNEEIGSLTSRGADSTLLTEVLE
                     RIDHVLNLGKEEHLIKLNKSFNISMDGAHGVHPGYICKHDPNYQISLGKGVTIKNNAN
                     FKYSTTAHGCAKLKALAMKNNIKIQEIIMKANTNAGTTIGPISNSQTGIETIDIGTPM
                     WGMHSLRETIAISDHIEAIKLLRTFFENWN"
     gene            663276..664001
                     /locus_tag="BT0_RS03145"
                     /old_locus_tag="BT0628"
     CDS             663276..664001
                     /locus_tag="BT0_RS03145"
                     /old_locus_tag="BT0628"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772565.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772565.1"
                     /db_xref="GI:500096558"
                     /translation="MDRFYSLMLVLLIFIACTTISEVNLQDDASGTVLLIFNVDKEFE
                     KIRKELVATLVGEEIAKMPLFPIDKIKQYFGDEGKKLGLNLLNIKSNGDSLNLIVQFD
                     NLVKVLKDYLAKETMPIFKIANKNGKNILDIDFNLKTVTKIINESKDQVNDALAALLP
                     SEEIPMSEKEYKDVLVYFLSDFTSRANELIDNSNVTLKIKTSRKIQEQFGFKQLNSNN
                     LELKLDMIRTLSLETPIKLRLVY"
     gene            complement(664035..665882)
                     /locus_tag="BT0_RS03150"
                     /old_locus_tag="BT0629"
     CDS             complement(664035..665882)
                     /locus_tag="BT0_RS03150"
                     /old_locus_tag="BT0629"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS fructose transporter subunit IIA"
                     /protein_id="WP_011772566.1"
                     /db_xref="GI:500096559"
                     /translation="MQDLFSKKLILLNYEAKSKDDVIEKMADMLNENEYLNNKEDFIK
                     EIKKREEISGTGLEEYIAMPHAKGNFVKKHGIAILRIKGEGFDFNASDLRPSKLFFMI
                     AVPEKTTGNTHIKTISYLNNIFNNEILRQEIMSTNDINRFLEILLNSNTDVIMNDTGS
                     KNFILAVTACPTGIAHTYMAAESLKRAAAELNVEIKVETNGSSGVDNLIEEEEIERAK
                     GIIIAAGKTVDKDRFNGKPLIEVGVKDGIHKAKELIQNILDNKAKIYKRKTVQGESNT
                     TRKPGGAYKHLMNGVSFMLPFVVSGGIIIAISFMFGIKAFDPNDPSYNKIADILMQIG
                     GGNAFFLMLPILAGYISFSIAERPGLAPGMITGLMMSKGNAGFLGGILAGFIAGYVTL
                     AIKSISKKIIPPKISGINPVLTYPLFSVLISGSLTYFLLAPIAYINTSITNMLNSLSG
                     TNMALLGALLGGMMAIDMGGPVNKAAYAFGIAMITAGNYIPHASVMVGGMTPPLGIAL
                     ATSIFNNRFSQEEREAGKVCYFLGACFITEGVIPFAASDPLKVIPACIIGSSIGGFLS
                     ALSKVELMAPHGGIFILPIITNPLMWIISILIGALITGLLIGFMKRDKK"
     gene            666013..666921
                     /locus_tag="BT0_RS03155"
                     /old_locus_tag="BT0630"
     CDS             666013..666921
                     /locus_tag="BT0_RS03155"
                     /old_locus_tag="BT0630"
                     /EC_number="2.7.1.56"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="1-phosphofructokinase"
                     /protein_id="WP_011772567.1"
                     /db_xref="GI:500096560"
                     /translation="MVYTLTLNPAIDYKIVVEGFQTGCLNHVVRNNFFAGGKGINVSN
                     VLKNFETESIALGFLGGFTGDYIRGYLDLMGIKHDFISISDNTRINIKMMSDGKETEI
                     NGRSPVILESDFQSLILKLKNLDKDMLIMSGSVPSSLGYQAYNEIAKSIASNVKLIID
                     TSGPALQEIIGLRPFLIKPNINELKELLGMNLTSSKDLINAGCELMERGVQNIIVSMG
                     SEGAVFINNKDACLASVPQINSLSTIGAGDSVVAGFVYAHQNGNSLLDSFRFGVASGT
                     ATALRGQLCSLDDVKDIFDKVKLEHL"
     gene            complement(667084..667157)
                     /locus_tag="BT0_RS03160"
                     /old_locus_tag="BTT0025"
     tRNA            complement(667084..667157)
                     /locus_tag="BT0_RS03160"
                     /old_locus_tag="BTT0025"
                     /product="tRNA-Asp"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(667121..667123),aa:Asp,seq:gtc)
     gene            complement(667205..669031)
                     /locus_tag="BT0_RS03165"
                     /old_locus_tag="BT0632"
     CDS             complement(667205..669031)
                     /locus_tag="BT0_RS03165"
                     /old_locus_tag="BT0632"
                     /EC_number="3.1.11.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit alpha"
                     /protein_id="WP_011772568.1"
                     /db_xref="GI:500096561"
                     /translation="MRNFLVLREFLKDHKRNYLNPELKIYEIIETLNINIENYYKAHL
                     LTKKIKDKKYEEITIFLIFLFNYLSKGHLRANINLLIKDIQNTIDCAFLEIKDEDQSY
                     QKSINILEELAKITQATKIHEIILHLKENNIMKDLNQNERIITPLILENNIHIYTQKN
                     FREEEELIKKIDQRLKDNKSEITTQRIQNIMNNLNTKDLSEEQINSIKKSLKSNFFIL
                     SGGPGTGKTTTINYILKAIDMHLNVKQKVALVAPTGKASQKLKSSLKESFTNLETEYS
                     TVQKLLKMSFINKGNKYDEANPLEFEIIIIDEASMIDLSTFLKLLKAVKRNTKLIITG
                     DKNQLPSIAGGNVYSSLTQIKEISDENVEILKKNFRSNDEINLLAKAIYQEDTNLIDI
                     QLNANKNIILKDINKVNIENELLNHTKDLYKKISNFDLNSLNNKEIESIINALLSNVI
                     LCSRNFGKFGTKRINEIIKLYLKKTYGNLIGQIILITQNDYKNDLFNGERGILFRENS
                     KIYALFKREDEKYKRINFNLINKYELSFATTIHKSQGSEYQHVQIIIEDHPFLTKELL
                     YTAITRAKESIKIISSKDIIKNVSLKTIKRDSKISDHIDALK"
     gene            complement(669041..672484)
                     /locus_tag="BT0_RS03170"
                     /old_locus_tag="BT0633"
     CDS             complement(669041..672484)
                     /locus_tag="BT0_RS03170"
                     /old_locus_tag="BT0633"
                     /EC_number="3.1.11.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772569.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit beta"
                     /protein_id="WP_011772569.1"
                     /db_xref="GI:500096562"
                     /translation="MKEIIDKIKYNEKILIEASAGTGKTYILENTITNLLINKTYSPS
                     EILVLTFTKKATEEMHIRILKSIENAYQNSQTDKSLKKIYEQSNKIFISTINKFALHS
                     LNNFQIETEHFVRYSVKENFTSEIDEIVYEFLRKADSLKKELTIKDDEFEIFKSKFKT
                     TKDMIQYIRQGYKRDKTQELGDWIKTQTIFKKMLTNQDRLIHEYNSIVEALNKMTMEE
                     KRTFLNKHNQGIKISEIKYSNEKDIVKITDILANNKFFSKIIESNLKKNVTLLPKELK
                     IQTALRELSHKTNTNKEDKNTLKRFINLKIEYKILKYIEKELANIINATNTIDQKHIM
                     LNFKKHLESRDNKLLNSIKNRYKIILIDEAQDLNLIQIEIFKLLNSCGIKLIFIADPK
                     QIIYTFRNADISYYNQGIKDQIKDNAKITLLTNYRSNKKLVEPLNIMFDNIYNKTHTA
                     KIEQIEFTKSKTESKNDENKIFINDQEIEAINIIETESEDENILQKTAITIKYLLTNG
                     KIYDNNKLRQIKESDIKVLCRTSKEIDLIDKELKNQNIKTNKIEESFFKTKEFSEIFY
                     LIKCFDRKQNFQTLNYILTSKIINLPWELYLSLLEKNEIKHIEAAISDIIYLLENQEI
                     TLIKAIDEIISKKDLWLNLAKFFNNTTFTEFAQSKKSYRETLINEKKFEELKNYEISL
                     DFISKIYYEDKTIESLICTLEDLILNKDTEQDEEQITTQGDQSIEILTIHKSKGLSIN
                     IVFLIGDIQHNDNLMKKSDTFYKFCLENRIKYDFLKLKENQQSAKHKILNEEKNIFYV
                     GTTRSRFALFIINKGTIINKMLDLAKIKTIDKINLDFNVYNLIKTHKFNKLEKNDNKE
                     IKLIPPTPINKHLFRREYTHSYTSLASSYKSTYHANQETRDDETYDNDANCTEETLPK
                     GKDIGNILHVIMKDINFSDAKDDFNNFQKINIALIQKRIEHFNSKLNTPKIQEMLIKM
                     IYNILNTKIRFIDARLCDIQELQKEMEFLIKIDTKIYEQKSLFKNYNKLDLTFNEGYI
                     KGIIDLIFKINNKVYILDYKTNYLGANLKDYNLTNLKKKMKQEKYDLQYKIYALGTKK
                     ILFKNPEEYNKYFGGVIYLFTRAFQKNIKEQSKTQNGIYFTIPNFKELDLEQIYLQLK
                     Y"
     gene            complement(672495..675710)
                     /locus_tag="BT0_RS03175"
                     /old_locus_tag="BT0634"
     CDS             complement(672495..675710)
                     /locus_tag="BT0_RS03175"
                     /old_locus_tag="BT0634"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772570.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="exodeoxyribonuclease V subunit gamma"
                     /protein_id="WP_041178506.1"
                     /db_xref="GI:752506641"
                     /translation="MYKIYKTNKVSKIYNKIKELIKNDDIFKKETIIILKSNILSEEI
                     KKYIATLNEVSYNLNVKQNIIKMIYNLSMENHNIKKFLENNTLLLYSETEKFILYHML
                     KDNKIKNIKQFKSTNNRYIFASKIITLFHKYYSKFPNLIDHWRQNKFLFEDQNKIHYE
                     SMQKEMFEKLFENQINLFNLHEKIEQEITEPKQSIETKRIIIIGETREIDRKILHCLQ
                     KIFDITVYELILEDTTQIKSAFIDELVPVKIKKCNSSTQIEEETDIQLFEEKNFLASF
                     KNNIIKGTPLLNLDNSFKIIEAKTKKREVEILVNNILHSTQNNHLKINDIVITYLPKD
                     MDIYLPYIEEFLNKYELEFTILDSKDVSKSKSVIALKQLMQLFISNRGTISNFNRKEI
                     IEFLSNTKVMNKFNISISELEYLIKFNDAVNINFGMNDTHKESLSYDKNFLNSWENGF
                     DRFLTSTMFNEKYECNNCQESISFQDPDSIVRLISIIKSLYEDIMYFREQEYTIYEWA
                     EIMDIFIDKYIKLEDNNKIDEYINTRIQYLKNFSRDFNENLYKDYMTKVKDRKVDFAL
                     FKIMFEESIEQKAYQSNNQNIGILVASSDKIEYLQKSEIHFLGIHQLNSNIHFDNMNL
                     LNEYYDYVNLEQENISNLIKIIFAASNKFYFYYSLSESLNPDINKPKVINKIINYIKD
                     MGQELKIEIHPSENYDFEYFKYEKANYLINYDTEAFNIAKSLQQGKHPNFKQKRLKLK
                     KQITLRIEDINKAITNPYKYFYEEILNVYIKDISQIGDIKKKQEEQIIDIDNFNYKLM
                     NNLIPIHEYIKNETNEYILEKIDNIIENQIQKGIIPMNIKKTTIKEEFIEKFNEIKNN
                     IVINFQEFFKMQETDITLNKSIFINFEGETIEFKLNGKLKNIYKIDNRYFYVNLEKKD
                     YGQDKIIRKINLYIIGLMLKSSIANIESIQEIRITYKTSKLSLENQYTNETINYLDLT
                     NLLKQIAYISSYPTPIYKDLIQKSLIKIKDINEFPTVLKTQIKYPQKSININKDMEFI
                     LQQKDITWCPYYNRFKDTHDLNINDNLEKLLQDFYTKFIKV"
     gene            complement(675735..677180)
                     /locus_tag="BT0_RS03180"
                     /old_locus_tag="BT0635"
     CDS             complement(675735..677180)
                     /locus_tag="BT0_RS03180"
                     /old_locus_tag="BT0635"
                     /EC_number="2.4.2.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772571.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nicotinate phosphoribosyltransferase"
                     /protein_id="WP_011772571.1"
                     /db_xref="GI:500096564"
                     /translation="MKNLSLFTDFYELSMMNAYFIKNINPKVKFEMFFRKTPFKNGYI
                     ILAGIHTLINALKELHFRDEEIEYLDSLQYFDKKFLKYLKTFRLNIKISSIEEGRIVF
                     PHEPILIIEGNLIELLLIEGLVLNTINFESLIATKTARIKEAGAKNLAEFGLRRAQGI
                     NGALSASKAAYIGGADFTSNVLAGYKYNIPVIGTMAHSWIMSFKNEEEAFWEYAKIYP
                     NNVSLLIDTYDTLNSGLKNAIKVFKALKSKGSKNFSVRIDSGDLEYLSKQVRKTLNEN
                     GLSEVKIIISNELDEEIIMYLNSIHAPIDFWGVGTNLVTAKGESNLSGVYKMTSIQQN
                     GKFIPKMKMSNNINKATLPSQKGVVRIYSNEQMIFDLIFLKEEEEEIKKMLSLKKEFT
                     IFHPIQDNTFKEIKTYESFEFLINTVFENNKICQTCELSLEHIRARVQSDLKNIDHTH
                     KRLINPHIYKVSITEKLKNLRNKLIKENKKL"
     gene            677376..678809
                     /locus_tag="BT0_RS03185"
                     /old_locus_tag="BT0636"
     CDS             677376..678809
                     /locus_tag="BT0_RS03185"
                     /old_locus_tag="BT0636"
                     /EC_number="1.1.1.49"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772572.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate 1-dehydrogenase"
                     /protein_id="WP_011772572.1"
                     /db_xref="GI:500096565"
                     /translation="MSEKNVSNFDVIIFGVTGNLSRRKLIPSLFNLYKDGHINNFRII
                     GFARRNFTDYELKVYIKDSLWQEESTALIDDFLKFFVYLSGDFREKDAYVKLSSLLDN
                     RDRIYYLSTSPEFYEAIIENLKPYSFSNTSYLSKIILEKPFGSSLDTARCLNTLLYSV
                     FSEEQVYRIDHYLGKETVQNIFTFRFGNSIFENIWNNRYVDFIQITVAEEAGIDGRAE
                     YYDSVGALRDMVQNHILQLLSLIAMEPPIGFSADFIHDEKVKVLKSLRKLSRDTMQNH
                     IVKGQYICSQVQGILKKGYREEANFLSISDTETYLAMKLFIDNWRWSGVPFYIRTGKA
                     LVRKFSEIYIQFKKSDFTIFNTGLINLSNALIFRIQPRDGIEIKFNTKRPGYNYDIQE
                     ANMEFSYHASFNKFFSESYERLLFDAFLGDKTLYARNDEIDSSWEFVSDILDKWEDIK
                     NWDYCYGSEGPVEANMILEKDHFWRKM"
     gene            679439..679645
                     /locus_tag="BT0_RS03190"
     CDS             679439..679645
                     /locus_tag="BT0_RS03190"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178507.1"
                     /db_xref="GI:752506642"
                     /translation="MYYEKNLVREKVEMLNFFLDTEMVNFFVVIIMKNIMKNKWLGLI
                     VKIENLMRRWEFYRFDSYISSCHS"
     gene            679989..681329
                     /locus_tag="BT0_RS03195"
                     /old_locus_tag="BT0638"
     CDS             679989..681329
                     /locus_tag="BT0_RS03195"
                     /old_locus_tag="BT0638"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772573.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proton antiporter"
                     /protein_id="WP_011772573.1"
                     /db_xref="GI:500096566"
                     /translation="MNKVSHVQPNFLGLVPFLVFIVVYVGTGVVLEIQGVEMAFYQMP
                     PIIAMLLAVVTAFLLFKGSFIDKMNDFIEGCSQTDIIFISFIFMISGAFSAVCKEIGS
                     IETVATIGLRYIPANLLIAGIFLICLFLSTATGSFLGTVVAITPIGFEIADKSGIPLP
                     MVAGAVLGGGAFGDSMSLISDTTIIASRTQGVKIIDVFRNGAFFTFPASILSTVAFAV
                     LGSYIGGIGVNVELGEISYLKVIPYLFVIIFAFLGVDVFLVLFFGILIAGGIGIVNGD
                     LTLLLMFKNINAGLLDLSEMLILVIFTGGVSYMTIRHGGFEWILTKLKYFAKCRRSAE
                     FTITFLIIMVTGFLSNSGLAILVNGTVTKGISEANSVCPKRCAALLSISSCALIGALP
                     YGMHMISLINIAKGTISPLDIMPFLFYQVFLGVIIIVSIAFFGLKNQFLNSAKV"
     gene            complement(681373..682422)
                     /locus_tag="BT0_RS03200"
                     /old_locus_tag="BT0639"
     CDS             complement(681373..682422)
                     /locus_tag="BT0_RS03200"
                     /old_locus_tag="BT0639"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772574.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_011772574.1"
                     /db_xref="GI:500096567"
                     /translation="MKKFLILAIILIVTSCSSQKTQSTLNVLNWAEYIDEKLLAQFER
                     ENNIKINYECFNNNEEMMAKFNNTKGYYDIIVPSEYLIGELISESKIEKLDYSKLQNV
                     KNNILDKLYNLEHDFGNFYSVPLFWGVMGILYNKTKVDINDMNEFDILFNEKYKQEIA
                     MLDSPKENIGVALKKLGYSFNEHNISIIKRAEELLKKQSPLVIGYFSDIAAKSLILNG
                     ESSIQLTWSGEALDAMLKDPNLDFYVPNSTNIWVDVMVIPSDAPHKELAYKFINFLYE
                     NEASYANFKETKYNSPNKNVLNRLQEEAKENPEINIYLEEKFLPTNFSNHEVFKTVPK
                     EVKEEQMRIYVELSS"
     gene            complement(682440..683231)
                     /locus_tag="BT0_RS03205"
                     /old_locus_tag="BT0640"
     CDS             complement(682440..683231)
                     /locus_tag="BT0_RS03205"
                     /old_locus_tag="BT0640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter permease"
                     /protein_id="WP_011772575.1"
                     /db_xref="GI:500096568"
                     /translation="MLKILKNTFLFLTLGFVYAPILILIIYSFNAGNNGFFFQGFSLK
                     WYKEVFASQQIKIVIYNTLLIAIVSSLISIVIGVLGAYSIYKTKNKKIKTILLSINKI
                     PIINPDIVTGISLMTFFSLIKIQLGFSTMLMSHIIFSTPYIIIIILPKLYSLSENVID
                     AARDLGASEIQIFKNIIYPEIIGSVVTGGLIAFTLSIDDFLISFFTTGQGFNNLSILI
                     NSLTKRGIKPIINAISSILFFVILSLLFIINKCVGIKKLTVDTEI"
     gene            complement(683247..684044)
                     /locus_tag="BT0_RS03210"
                     /old_locus_tag="BT0641"
     CDS             complement(683247..684044)
                     /locus_tag="BT0_RS03210"
                     /old_locus_tag="BT0641"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772576.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_041178508.1"
                     /db_xref="GI:752506643"
                     /translation="MNRIILILYTLFLSIFIIFPLVIIIGLGFFNEQNELTFANFIKL
                     LEPSYLRIFSRSINFALITTIFCMLIGYPTAWFISMSKKSVQNMLIIMIILPMWINTL
                     LRTYAWIRILGKNGIINNLLKAMGLETIELLYNEKAVIIGMVYNFLPFMVLPIYIGLS
                     KIKYEYIEAARDLGARMWQVLLYIKLPLTLSYLATGIIMVFIPSITVLIISDLLGGAK
                     QILIGNLIEKQFLFVEDWHTGAAISFIVMIVILIFNLIILKLMQKTT"
     gene            complement(684050..685093)
                     /locus_tag="BT0_RS03215"
                     /old_locus_tag="BT0642"
     CDS             complement(684050..685093)
                     /locus_tag="BT0_RS03215"
                     /old_locus_tag="BT0642"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772577.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine/putrescine ABC transporter
                     ATP-binding protein"
                     /protein_id="WP_011772577.1"
                     /db_xref="GI:500096570"
                     /translation="MNNYILEIKDLSHYYTDSNNKTLDTINLKIKKNEFITLLGPSGC
                     GKTTLIKIIGGFLNQNKGEIHFLSKEISKITPNKREINTVFQNYALFPHMNVFDNISF
                     GLRMKKVNKNLIQEKVKAALSLIGMQKYAYRNINELSGGQKQRVAIARAIIMEPKLLL
                     LDEPLSALDLKMRQEMQKELKKIQRKLGITFIYVTHDQEEALTMSDRIVVMNEGIILQ
                     IGTPEEIYNEPKTRFVASFIGESNIFEGTYEKEFIVKMFGKDFKCLDKGFKNKEPVDL
                     VIRPEDVKILPKGQGHLSGIITSAVFQGVHYEMTLEIQKSHWLVQSTKLTKVGEEVDI
                     SLGPDDIHVMCKE"
     gene            complement(685165..686031)
                     /locus_tag="BT0_RS03220"
                     /old_locus_tag="BT0643"
     CDS             complement(685165..686031)
                     /locus_tag="BT0_RS03220"
                     /old_locus_tag="BT0643"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772578.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase"
                     /protein_id="WP_041178509.1"
                     /db_xref="GI:752506644"
                     /translation="MSNKINWFPGHMKRALDLIQENLQRTNIVLEILDARAPLSSQNP
                     LTEKIIKNSNRNKIILLNKSDLAQEEEILKWREYFETLGNNVLITNIYKKGMKKQIID
                     NIIKIANVKKIKTYEEKIKVLVIGVPNVGKSSIINLLVGKKSTSVANKPGHTKNIQIL
                     KINERINIFDMPGILWHNLEDQEIAKKLAILDMIKNEIIDNTELALYLLKKMHINNKT
                     KLLNKYNIISTNSLEILEEFAKTRGFINKKHKIDIERASKILIKEYREGKFGKIILDV
                     KRHNNNKYKSFT"
     gene            686174..686881
                     /locus_tag="BT0_RS03225"
                     /old_locus_tag="BT0644"
     CDS             686174..686881
                     /locus_tag="BT0_RS03225"
                     /old_locus_tag="BT0644"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmannosamine-6-phosphate 2-epimerase"
                     /protein_id="WP_041178510.1"
                     /db_xref="GI:752506645"
                     /translation="MIEKIKKGLIVSCQALEGEPLHSSFIMSKMALAAKMGGAVGIRA
                     NSVLDIHQIKSEIDLPIIGIVKRVYNDSPVFITPTIKEVDELCSEGVDVIALDATLRK
                     RPDGLLLSEFFNKIKEKYPSQLLMADIASLEEAVNADRLGFDFIGTTLHGYTKDTEGC
                     NIADNDFAFLKNLLKCNFKSKLIVEGKIDTPLKAKRSFELGVSLVVVGGAITRPMEIT
                     KKFVDKINEVKEIWEYL"
     gene            686922..688466
                     /locus_tag="BT0_RS03230"
                     /old_locus_tag="BT0645"
     CDS             686922..688466
                     /locus_tag="BT0_RS03230"
                     /old_locus_tag="BT0645"
                     /EC_number="2.7.1.69"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772580.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PTS glucose transporter subunit IIB"
                     /protein_id="WP_011772580.1"
                     /db_xref="GI:500096573"
                     /translation="MGKFFENAQKFGRSFMLPIAILPAAGLFLGIGGALSNPATVNTY
                     SFLNVFFLQSVFNIMRTAGAIIFVNLPPIFAIGVAVGLAKSDKGTAGLAAFIGYLVLN
                     STIGILVDMFSNSEELSKGAVGLILGIRTLETGVFGGIIVGILTYYLHNKFNKIEFPK
                     VLGFFSGSRFIPIIVSFSNIFLAVCMFIFWPYMQAGISKMGVLVDATGYVGTLIYGIF
                     LRMLGPFGLHHIFYLPFWTTGLGGSEIINGKLVEGTQNIFFAELASHSTDKFFIGTSR
                     FMSGRFITMMFGLPGAALALYRLAKPNQKTKVFGLLFSSALTSFLTGITEPLEFSFLF
                     VAPVLYVLHAVFDGFAFMFAHILQITIGQTFSGGFIDFILFGILQGNARTNWVLVPLV
                     GVCWFFLYYFSFAFLISKFNYKTPGREDTINSNDTFLSDATVKGDNVASQVIMGLGGS
                     DNIIELDCCATRLRVTVKDSLKVLKNTLENTGAKGILIKNSGVQVIYGPGVSVLKNEI
                     EEILGN"
     gene            complement(688508..689491)
                     /locus_tag="BT0_RS03235"
                     /old_locus_tag="BT0646"
     CDS             complement(688508..689491)
                     /locus_tag="BT0_RS03235"
                     /old_locus_tag="BT0646"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772581.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylesterase"
                     /protein_id="WP_041178580.1"
                     /db_xref="GI:752506715"
                     /translation="MNIKNTIFILIFLLLLIVVGPRMKFRNEFEETKIPNKLGEIDQY
                     LLTEESKFNLEANTKKEIIWNGDQKRTEYAVIYIHGFGASKNEIYPIPNNIAKALNAN
                     IFFTRLKGHGINDKNAFKDVKTKDWLRDIDEAIQIGQSIGEKLILIGTSNGGACAIWA
                     LKNYPDKIYSAVLISPNIYPKDKRTSLIYYPWGRQIAYLITGGYNELEIRQNKRIEHE
                     EITPFHSPIRQVDSIIAMMGLVKLINNNGFNEIKTPLTIAYSPNDPTVDSQTINKFIS
                     EYGGYKKTIPIILVESFHSHVPAGNHSYRSAQNTSYLTKHAVDFIKNIKSK"
     gene            complement(689505..690023)
                     /locus_tag="BT0_RS03240"
                     /old_locus_tag="BT0647"
     CDS             complement(689505..690023)
                     /locus_tag="BT0_RS03240"
                     /old_locus_tag="BT0647"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772582.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fur family transcriptional regulator"
                     /protein_id="WP_011772582.1"
                     /db_xref="GI:500096575"
                     /translation="MNNNTIEVHSTLEKVGITNDPILLKSLTTELGMKASHSRNRIIL
                     HIASNPKEYFTAKEIYNKLIKEIPSLSKATVYNTLNILKERNILKDIKTTDQKETRFY
                     LSLTSTIAHFKCNKCNQVYPIQLDDIKDILKDKLGEEWKTKSIEIIYSGSCNNCYQQS
                     KKEKSNIDYENN"
     gene            complement(690115..691803)
                     /locus_tag="BT0_RS03245"
                     /old_locus_tag="BT0648"
     CDS             complement(690115..691803)
                     /locus_tag="BT0_RS03245"
                     /old_locus_tag="BT0648"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772583.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_041178581.1"
                     /db_xref="GI:752506716"
                     /translation="MFRKFRNSRTYIVIISITAFAESKLYSILSNTKYLIENKNLSYK
                     IHWIFPTYFFEILKLNPELNEWFFNRLKNNEDIYIPSTYSGSPHEYMLHDEIHVDLYW
                     SLKNPFKSGYKDLFKDNPHTFYVYNMEKLRKRVLELYRKLNFNYIEGIRIAKNNKKYL
                     VFYKNNCQFLSEIQEPETQKQNIDTLIYFHEIKDIYNNQELKNFLLSLKGLDANFYSI
                     KIQNLEGKKITTELLEIPEFNSLKEQAIILQFQNKRLKEYQINEISLKEFLVNKNFEY
                     HSTNLEPITSKNIEYNMEGNFTLSHEKYHVKFEEGKLNKIKYKERKAEFLDSCRTYIK
                     ILSQKDIIIEPTIESSFSFSNEKIVGIRQYLNFNTKEKSIIDFFLDENLASFFISIKI
                     AWPSVITCNNKSLKLSNTNYLLEYSSLEIPIFEVEKGTNLKITAKYNDFDTYEKIIET
                     KKDIKGYINGTEFLISKGNDQNSNFFISFLNIEKHIIYTINYKIAKRGFKRWFILNIG
                     GSYNTIKAEDLKNYSLSLNLLLLPINNNFDNKIKINSKIKTLLFYPNIKKNENK"
     gene            692025..693659
                     /gene="groEL"
                     /locus_tag="BT0_RS03250"
                     /old_locus_tag="BT0649"
     CDS             692025..693659
                     /gene="groEL"
                     /locus_tag="BT0_RS03250"
                     /old_locus_tag="BT0649"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696477.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_011772584.1"
                     /db_xref="GI:500096577"
                     /translation="MAKDIYFNEDARKSLLSGIEKLSNAVKVTLGPKGRNVLIDKKFG
                     SPTVTKDGVSVAREIELDNALENMGAQLLKEVAIKTNDLAGDGTTTATVLAYAIAREG
                     LKNVSSGINPIGIKKGIEHAVTLASEKIRKSAKKITTKEEIAQVASISANNDTSIGEK
                     IAEAMDRVGKDGVITVEESKTFDTTISYVEGMQFDRGYLSPYFSTNKENMSVSFDDAY
                     ILICEKKISTIKELLPVLEKVLNTNKPLLIIAEDIEGDALAALVLNSVRGALKVCAIK
                     APGFGDRRKAMLEDIAILTGGVFVSEELGLTLENVELEQLGQAKSVKVDKDNTTIINT
                     GNKEQIKERAELIKKQIEETSSEYDKEKLQERLAKLVGGVAVINVGAVTELELKEKKH
                     RVEDALSATRAAVEEGVVPGGGSTLIEVAMYLDTVDTSKLSYEEKQGFEIVKRSLEEP
                     MRQIIANAGFESSIYIHQIKTDKKGLGFDAASFKWVNMIESGIIDPAKVTRSALQNAA
                     SIAGLLLTTECAITEVKEEKSNAGGGYPMDPGMGMM"
     gene            693718..694014
                     /locus_tag="BT0_RS03255"
                     /old_locus_tag="BT0650"
     CDS             693718..694014
                     /locus_tag="BT0_RS03255"
                     /old_locus_tag="BT0650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772585.1"
                     /db_xref="GI:500096578"
                     /translation="MSENEFVFCIGYDGSKAIVDKELLSQHKDKSVEELCELGFYRSA
                     FSKALYKNDDTLIEYLIDRYNKISKSSYSKREELELLFGVVYPGNIASIKVTYV"
     gene            694030..694338
                     /locus_tag="BT0_RS03260"
                     /old_locus_tag="BT0651"
     CDS             694030..694338
                     /locus_tag="BT0_RS03260"
                     /old_locus_tag="BT0651"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772586.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178582.1"
                     /db_xref="GI:752506717"
                     /translation="MFLLQDFSHSSSFFRSLLVFIPVIAIFWFLVISPQRKEEKKKKD
                     MIKNLKKGDKVLTIGGIFGIVKKVNDSEVILELSPTSEVRFIKNSVERVILDEIKDKN
                     "
     gene            694429..696192
                     /locus_tag="BT0_RS03265"
                     /old_locus_tag="BT0652"
     CDS             694429..696192
                     /locus_tag="BT0_RS03265"
                     /old_locus_tag="BT0652"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecD"
                     /protein_id="WP_041178511.1"
                     /db_xref="GI:752506646"
                     /translation="MNKVSKFILILCVTSFAYLLIFPTLKWYFFTNDEDKKISLYSKE
                     ALRDYSKNKALSSLIELKKLYQKNPNAQIPDDLKYLIPIAQNNYKIYGKEFPKSFDNV
                     KVLRDGFLTDADIEELSLEIYRYYEEIKRNKNRIIQLGLDLSGGMSVTISLDYSGLEQ
                     KLGRTLSFQEKEEAFDRTMQILKDRVDTFGLTEPKITREASGNKIFLDVPGERDEKRV
                     DSLLSGRGNLLFYVVDNEATSVLNTKILEAGPLYSISDIKNSMGLGENKKIFPWYVKD
                     SYGIDDESTVRYYVVDSSVESSFDGSHISDAGVLNDHKTGRDVVTFNLDNEGSEKFFE
                     ITKKNIGKALAVVMEGKIKSVANISHAIAGGNVSIQGDSFDKREASELALVFKTAAFP
                     VEIKIDDLRVIGPTIGEKTVKLGIKASLLALVLVFLFMLAYYKISGFVAGFSLVIYNL
                     FLILAILSAFNFTLTLTSIAGLVLTMGMAVDINIIIYERIKEEIRNGRKFERAFDDGF
                     KKAFWAIMDSNITTFIAVLFLTLLGTGTIQGFAWTLSIGIVASLFSSLIFSRFILEFI
                     MSFSKSKCLSISWSSNYAKGV"
     gene            696176..697075
                     /locus_tag="BT0_RS03270"
                     /old_locus_tag="BT0653"
     CDS             696176..697075
                     /locus_tag="BT0_RS03270"
                     /old_locus_tag="BT0653"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772588.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecF"
                     /protein_id="WP_011772588.1"
                     /db_xref="GI:500096581"
                     /translation="MQKVFNFLKYGNKVIIVSFCMILSGFIYTFMYHGGYNWGIDFSS
                     GVNINFVIDKSGIKDYDIQRILSSVYKTFDVNKIISSDESKSQFSIIVKSDITDYALK
                     KEIHSTLIDKLNTEFGANVEILDSYFIDSNFSSILRTKSMLLVCLTFTLILFYVALRF
                     RLSYAVASIFATIHDILFVVAFLGIFRIEINSSIIVSILTIIGYSLNDTIIIFDRIRE
                     NSRNMTDTLFLNILNVSIKQTLSRTILTSMTTFVAVLSIYVFTEGAIKDFSLIFMVGV
                     VVGTYSSIFIASPILLSCYKKIK"
     gene            697099..698250
                     /locus_tag="BT0_RS03275"
                     /old_locus_tag="BT0654"
     CDS             697099..698250
                     /locus_tag="BT0_RS03275"
                     /old_locus_tag="BT0654"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772589.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772589.1"
                     /db_xref="GI:500096582"
                     /translation="MKFLDFGSLGFYRFFDFQKHLNFSIFRYSLINYYSYKEQSSLIN
                     DANLLKSKIIFLDKVHKDIARVASTSSKLNDSLNINKKIFCDALVIIKNLIKKYYPSS
                     EFLNLEYDVLLSNEDTFNKFLDKLRYLNFRVDLKKKIEEFDRKNKTPYSCIKIATFFI
                     KEEFLERLANTIDFFSNEANNSSLDLINKEIDEYCEKVEQVKVSEYIKDTHKKFVIEY
                     AKERISKIMKDHSLDISKLLVKISLLDITIQCFESYYLNLLETLNILLSISNIIEIGL
                     DELPGAIFNEWNEFIYLRRKEFQKLVLISDCVFQKRIISIINSGGWKFTFFSLSPRQG
                     DIIQFSVDVNKNFNNIEDGIKEYELKINRFNDFKLDWEKSLKNFEHLFV"
     gene            complement(698256..699095)
                     /locus_tag="BT0_RS03280"
                     /old_locus_tag="BT0655"
     CDS             complement(698256..699095)
                     /locus_tag="BT0_RS03280"
                     /old_locus_tag="BT0655"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone DnaJ"
                     /protein_id="WP_011772590.1"
                     /db_xref="GI:500096583"
                     /translation="MSKDYYNILGIHKNATTEEIKKAYKKLAIKYHPDKNKGNKFAEE
                     KFKEINEAYEILSSPQKKANYDNFGSANFNNNFNTEGFSKGFKNTDFHNFESFDLFSD
                     IFGGATRGTLKDTEITIKISLYDAYMGGKKSILINNEKIDINIPKGTIETTKLKFNGK
                     GNINPISGKRSNLIIKFEISSYKNFTLKERNLETKINVYPWEIALGSEKVFETIEGKK
                     IKIKIPKDTKNEEILSLKGLGMPALGNTNKGDLRVKLIVDVPKIINDEVKKIYERLKE
                     IYN"
     gene            699216..700355
                     /locus_tag="BT0_RS03285"
                     /old_locus_tag="BT0656"
     CDS             699216..700355
                     /locus_tag="BT0_RS03285"
                     /old_locus_tag="BT0656"
                     /EC_number="1.-.-.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772591.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="coproporphyrinogen oxidase"
                     /protein_id="WP_011772591.1"
                     /db_xref="GI:500096584"
                     /translation="MNFLRLTDLSIYIDLTKCFSYVFFDKILQELSYYLKVLGSPQIK
                     TLYIKYETSGLGNDSDLESFLTSLSQNFDFLTLDEFTFELHPLEITLSLLAILNDFSV
                     SRISIDIKSFSSKLLKVMGVYEISVAEINNAVNGIRKFDFDLNIDLNVNIPYQEKMHL
                     RNDLVKLVACAPEHICLSEILVDGENCIIDFFKDVSSNYNEAKAEDFWFYAFDFLESN
                     GYMNYEISNFALKGHESKHNLRYWELKPYLGLGVNSVSLLVISKGDGLKAVIKMDDNF
                     LGVGKSTAAFEILSDLDFFICHFITNLGTKKGLEVSVLKRRFIYNQEDFCNFINYLLR
                     LSKGVVFSNDILYLDGHERFKLDFYLRLIREYLVSNSFKVNFKFL"
     gene            complement(700342..701028)
                     /locus_tag="BT0_RS03290"
                     /old_locus_tag="BT0657"
     CDS             complement(700342..701028)
                     /locus_tag="BT0_RS03290"
                     /old_locus_tag="BT0657"
                     /EC_number="5.3.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772592.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 5-phosphate isomerase"
                     /protein_id="WP_011772592.1"
                     /db_xref="GI:500096585"
                     /translation="MEEQKKLVSQYAIDHYVKSNMHLGIGTGTTVFYAIKYLSKKIKS
                     GDLKNLKLYPTSSDTKYLLARENITYESKFTKLSKNIDITIDGADEILLETKALIKGG
                     GAAHLMEKIVAYNSHQLLIIADETKIVQTLGTRASVPIEIVPDALAFITANLANMNFN
                     PVLRTCKSKSGPIITDNNNYILDVKMNVENPKGAEKYFKLLPGILEIGIFNHQNTKII
                     YYQNGQIKET"
     gene            701256..702002
                     /gene="gpmA"
                     /locus_tag="BT0_RS03295"
                     /old_locus_tag="BT0658"
     CDS             701256..702002
                     /gene="gpmA"
                     /locus_tag="BT0_RS03295"
                     /old_locus_tag="BT0658"
                     /EC_number="5.4.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S101.1"
                     /note="2,3-bisphosphoglycerate-dependent; catalyzes the
                     interconversion of 2-phosphoglycerate to
                     3-phosphoglycerate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="WP_011772593.1"
                     /db_xref="GI:500096586"
                     /translation="MYKLVLVRHGESEWNKENLFTGWTDVKLSEKGISEALEGGRVLK
                     QEGYSFDIAFSSVLVRANDTLNIILRELGQSYIDVEKSWRLNERHYGALQGLNKAETA
                     EKYGEDKVLMWRRSYDIPPMPLEESDKRHPIHDLRYRGIPKSELPSTECLKDTVARVI
                     PYWTDKIARAIIEGKKVIIAAHGNSLRALVKYLDNMSDDDILKLNIPTGIPLVYELDR
                     DLRPIKHYYLGDEDKIKAAMESVANQGKKK"
     gene            complement(702090..703652)
                     /locus_tag="BT0_RS03300"
                     /old_locus_tag="BT0659"
     CDS             complement(702090..703652)
                     /locus_tag="BT0_RS03300"
                     /old_locus_tag="BT0659"
                     /EC_number="6.1.1.6"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="WP_011772594.1"
                     /db_xref="GI:500096587"
                     /translation="MKTAHWADFYAKKIIEEKGEKEQYTVASGITPSGTVHIGNFREV
                     ISVDLVARALKDANKNVRFIYSWDNYDVFRKVPKNMPDQELLTTHLRQAITRVPDTKT
                     NQSSYARANEVEFEKYLPIVGIKPEFINQSLKYMSSDYSNQIKFALDHKDEIAKVLNK
                     YRTTKLADNWYPISIFCTKCDRDTTTVKNYNHCYSIEYHCECGNKESLDLRKTWAAKL
                     PWRIDWPMRWKYENVDFEPAGKDHHSSGGSFDTSIEIVKIFGGTPPITFQYDFISIKG
                     RGGKISSSSGEVVSLKDVLEIYTPEVTRFLFASTKPNTEFSISFDLDVIKIYEDYDKF
                     ERVYYGIDDIKESKKEAFKRIYELSQPKAPDKEIPYQIGFRHLSVICQIFEGNKDKIF
                     KLLHDVKENQKEKLINKIDCCINWIKKFAPEEFKFSLRTTFDNTESLDSNKQGVTQLL
                     NFLKKDFNNITEKEIQDEIYNIARSNNIDPPLFFKQIYNILINKDKGPKLAGFIKAIG
                     IQKFEEIVKHYI"
     gene            complement(703740..704612)
                     /locus_tag="BT0_RS03305"
                     /old_locus_tag="BT0660"
     CDS             complement(703740..704612)
                     /locus_tag="BT0_RS03305"
                     /old_locus_tag="BT0660"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RMK6.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTPase Era"
                     /protein_id="WP_011772595.1"
                     /db_xref="GI:500096588"
                     /translation="MKSGFVSIIGRPSTGKSTLLNSICEHQISIISSIPQTTRNKIKG
                     IFTDKRGQIIFIDTPGFHLSKKQFNIALMHNVHSAIKETELILYVIDIQDKPGIEENE
                     ILTIISKSKINFLVVINKIDIQKTKEREIMIFLEEKGIKKDNIIKISAEQKINIEEIK
                     DKIYENLQEGPLYYPEEYYTDQEMNLRTSEIIRGVTIKKLKEELPYSLYIEIEILEDR
                     KNKLFIKANIIVAVESQKGIIVGKGGKGIKTIGEEARKIISEIFEKKCDLFLQVKLRK
                     NWNKNPKLIKNLIN"
     gene            704701..705060
                     /locus_tag="BT0_RS03310"
                     /old_locus_tag="BT0660A"
     CDS             704701..705060
                     /locus_tag="BT0_RS03310"
                     /old_locus_tag="BT0660A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178512.1"
                     /db_xref="GI:752506647"
                     /translation="MKKVNFEVFCEHCGGKVELNKSVCLNCHSKLGDLECPNCRYVGI
                     VSAFENGCPKCSYSPLEGQSQERIFRMRRRSRLKESRTSNDFLKSRFCFGFNVSVMLY
                     LFASFLIVLLFVYILFF"
     gene            705073..705480
                     /locus_tag="BT0_RS03315"
                     /old_locus_tag="BT0662"
     CDS             705073..705480
                     /locus_tag="BT0_RS03315"
                     /old_locus_tag="BT0662"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772597.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772597.1"
                     /db_xref="GI:500096590"
                     /translation="MGITVFYLFSVFLSFKIGENVKFVEDNVRQTSILYSDIEEVEFP
                     YAKTQILKFKGKTPIRYAYFSFDNDRLYSYTFVFDKKLISQYSIVLSIREKFGDAIVV
                     TPFSYIWDVGDSIIALNSNILRMTLKSYVNKER"
     gene            705477..705911
                     /locus_tag="BT0_RS03320"
                     /old_locus_tag="BT0663"
     CDS             705477..705911
                     /locus_tag="BT0_RS03320"
                     /old_locus_tag="BT0663"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772598.1"
                     /db_xref="GI:500096591"
                     /translation="MILRALFALIFYISCANHVYDKEIIINDTKFFVKLALDEVTRAK
                     GYMGTESINENNGMLFIFKEEKNLSFWMKDTPVPLEIAYINSVGVIKEIYSLVPFSQR
                     VVNSRYKVKYALEVPEGSFSKFKIKVGDRVKFNFDVNSLNVE"
     gene            complement(705912..706559)
                     /locus_tag="BT0_RS03325"
                     /old_locus_tag="BT0664"
     CDS             complement(705912..706559)
                     /locus_tag="BT0_RS03325"
                     /old_locus_tag="BT0664"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772599.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772599.1"
                     /db_xref="GI:500096592"
                     /translation="MISTKMLKISILNIDQLKYSIVIAVLILITLISCKDKNVTYDKR
                     IKKILDNNKIEYRIDKENDFIVSKIINDTKTEIIVRSKINSYQNSKTREIFGIVEIFD
                     VNSNKIQEISESLMSDSYNNRVLGSWEIIHDPERGNNSLVYIVKAEENAKETFLLDAL
                     EEVAATISIFKKVIKGNDIEVNTKNTSNEIDNDTLHNEEKMKDHAEEELQKIKAE"
     gene            706603..707562
                     /locus_tag="BT0_RS03330"
                     /old_locus_tag="BT0665"
     CDS             706603..707562
                     /locus_tag="BT0_RS03330"
                     /old_locus_tag="BT0665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012539075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772600.1"
                     /db_xref="GI:500096593"
                     /translation="MYFKSNDYSYTVIQSKNNYVQKSTFGISFVILNRGTKIFREDLF
                     GSLSNFDFIREIISIEKQSNRNSLQFISESYDKLKFILLSDDLNSGEKVNLAMKESIC
                     SFVFVLQSDMYLLNPFWIPNIFDEIVKKNVLLVGGEFFDKEEEVVPSVFIPTIDEQQK
                     LKVILINSERDYEKSLITMDYCGLYSKERFVQLGGFDRRIKNEYFQRLDFGLRAIYFG
                     ESVHIYRKLRIQYTALNVPEDLTKNRSFLIFLLKNYVPIFIGNGIKFSFFRFLKLCLR
                     YGINPFKFGREFKEIKHEITKNSLRFKGDLKSAIELWENNIID"
     gene            707525..708550
                     /locus_tag="BT0_RS03335"
                     /old_locus_tag="BT0666"
     CDS             707525..708550
                     /locus_tag="BT0_RS03335"
                     /old_locus_tag="BT0666"
                     /EC_number="3.5.1.28"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772601.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-L-alanine amidase"
                     /protein_id="WP_011772601.1"
                     /db_xref="GI:500096594"
                     /translation="MQLNFGKIILLINLIFVYFFLEAQEVDYVNILDSLDSKFFKFNF
                     NIANDILTIEHEKGHLKLKVGFEYGLSSVGYYIYVDPILLKDGEILITKRALMQIENH
                     FRALQSYSKPRIMSIVIDPGHGGHDRGAVVTHKINEHDITFLEKDFALTYSMHLYKVL
                     SNYFLDRNILLTRVDDVFVPLQDRSELANAIKPDFPHNVIFLSIHVNNAPNPEARGIE
                     FWYLPQDSKREVVRNFKGYDIRGNRYLRELNDILDIKYKYESKKLAEILYETFIDVLC
                     ETKIRSIREEQWFVIKNSSMPAVLIEIGFLSNIADAMLILDYNYMSKINILVLKSLIR
                     FIEFYEK"
     gene            708540..709052
                     /locus_tag="BT0_RS03340"
                     /old_locus_tag="BT0667"
     CDS             708540..709052
                     /locus_tag="BT0_RS03340"
                     /old_locus_tag="BT0667"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772602.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar filament outsheath protein"
                     /protein_id="WP_041178583.1"
                     /db_xref="GI:752506718"
                     /translation="MKNNSIYCSFFSRNGAKYSFEILIALLLLSFIFSLCMIFLNYEN
                     IFFRKVFYFYCENELIADLRYLKEKKTLKENLDFLVKDFLLGNSKGFSLQFGTRNVKF
                     LYSFISNDVYFINLSKEFYNSFENGGYNDSDKLRVNLFVKSLKETIDFNYPGNVRKIV
                     IFIEGYVLNV"
     gene            709139..710179
                     /locus_tag="BT0_RS03345"
                     /old_locus_tag="BT0668"
     CDS             709139..710179
                     /locus_tag="BT0_RS03345"
                     /old_locus_tag="BT0668"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772603.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein"
                     /protein_id="WP_041178513.1"
                     /db_xref="GI:752506648"
                     /translation="MSKVKNIVFILFFLIFLSSLFGQEVPGASSGDNSVKNEPGELVL
                     DFAELARDSSPTKLDLTDYVELVYSGASNIVKAEDMVLDLGISNWTVLLTPSSRMQAY
                     VKNSVVAPAVVKGESKRYAGDTILGVRVLFPSHSQSSAMILPPFKIPFYAGEDGNQFL
                     GKGLIDNVKTMKEVKVTVYSLGHEVDLEVLFEDMSGMEYVYPLGTLRFKGWADLVWSN
                     PNYLPGISAITGKDNIPNYPLPSSKMRFKAFRVSKSHSSKDQNLIFYVKDVRVIYDKL
                     SVSLDSDIDNESVFKIYETRGAESLRKLKAQEALKKVLKIKEDVSMPDESFQDFLEKG
                     SNDESGARTKEQ"
     gene            710251..712815
                     /locus_tag="BT0_RS03350"
                     /old_locus_tag="BT0669"
     CDS             710251..712815
                     /locus_tag="BT0_RS03350"
                     /old_locus_tag="BT0669"
                     /EC_number="2.7.3.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772604.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="WP_011772604.1"
                     /db_xref="GI:500096597"
                     /translation="MLDSENKELLEIFFEEAQNLVDTLEENIMSLEDDPNNAETIDEI
                     FRAAHTLKGGSASVDMMELSGFTHVVEDVFDAIRDNKLKICNDLVDLLLNALDVIKGM
                     LDARLNGDVYLQDVSELKNKLRRFLGDEHQTVSEISLENINDDEFLLSSRELSDMCEV
                     VGLGQKVLKVSIYFNKDNPMATIAGIQMFQALKDLGPILYTVPNYEQLIADKFLRRVD
                     YYLISLNKNTIEEKIKLSGVALSYAIDEFDIDSELAKTEAIERNTVVYDTLSEGKVRL
                     SNDELISLRERVGDAKLFEVKLNFNKDNPMSTISGLQMLQALKSLGEVYKSIPEDLLA
                     DKFFDFIVYYLISDTSVDSISKKVDLSDVVVSFDINEVDLKNIKDVNLNTEVGSYASS
                     KESKKTTVNVNLIRIDSKRIDSILNLVSEAVISKSTYNQINSDMTSFLYSFNYFYDYQ
                     ESFRNSFLVDLKIIFKDMGLELESSLENQIANLVEHKLDRTLQDMVGLRDLLFKILQD
                     SRFASGRLSRIITDLHESVLKTRMLPVSSIFSRFARVVRDLSKKLGKIVELSTEGEDT
                     EVDKSVIDDLVDPLMHCVRNSMDHGLETADERLSKGKDKAGHIILRAKNEGNVISIEI
                     EDDGRGIDPDIIRQKSIEKGLIKEDMVLSESEILNLIFEPGFSTASQITDVSGRGVGL
                     DVVKNNIKKLNGTIVIDSKVNVGTTFKIKLPLTLVIVQGLLVKSGSEIYVIPLNSVLE
                     THRISEENIKLLENDHEVYNLREEVISVLRLDELFNINNDQNLYEKFLIVISVNDKKA
                     GIVVDSILGEEDFVVKPIKDKYASSPGIVGATTLGNGKVVLIIDVFRLFDLKDMKG"
     gene            712823..714205
                     /locus_tag="BT0_RS03355"
                     /old_locus_tag="BT0670"
     CDS             712823..714205
                     /locus_tag="BT0_RS03355"
                     /old_locus_tag="BT0670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheW"
                     /protein_id="WP_041178514.1"
                     /db_xref="GI:752506649"
                     /translation="MEIKEICLGDHNVSNQVKGPTPVNLDFKVVSFNIGNDNYLVDIM
                     QVKEIRKSSNFTYVPNAKKYVVGLDNLRGEIISIIDLRIMFNLEVLKRNLEDIMVLRN
                     GDLLIGVIVDKVNNVFSIDSSLIQDPHPVLSQEALIRYIKGVVEYGEKLYILLDVDRI
                     FDYDREEEILLEDSRNYDEIDASGNENNSLSYSNNFLELSESSVGDLATSSKSDLDDL
                     KVIKENLFKYSFNASLVNDEFLKEIGMQLDIANINDLSYDNFLGEFYSKSSGRLWDDR
                     YLKEFQDEIVKPYINEMSGVGTVLNVFEVGCGDGKETISFVNVLYESYKDPFKVTAID
                     NNLVKVIGTSNLIFSGSDINLSEIYRKNSFEQSPGVYKFKPEIMNNILFEYSDAILSE
                     FPENLGIIFLRDILCFLNDDGQNLILDAIAEKSVSGALLILGDNEELKNNDLFVKDRS
                     VKYFNLYKRI"
     gene            714217..714702
                     /locus_tag="BT0_RS03360"
                     /old_locus_tag="BT0671"
     CDS             714217..714702
                     /locus_tag="BT0_RS03360"
                     /old_locus_tag="BT0671"
                     /EC_number="2.1.1.80"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004791212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheX"
                     /protein_id="WP_011772606.1"
                     /db_xref="GI:500096599"
                     /translation="MRIDYIEPFLDAASSVLRDMLLVEDIQMGSPGLKSINQKIRGVS
                     VIVGLAGSVEGSIIIDMDIDTALFVASKLNFEEYVDFDDEETKEMVAATLTEVGNIIA
                     GNFVTTLHAKGFVFDITPPAFIYGENMKISNKGSEALIVPFTLPDGKIIEVNIAIRER
                     V"
     gene            714751..715191
                     /locus_tag="BT0_RS03365"
                     /old_locus_tag="BT0672"
     CDS             714751..715191
                     /locus_tag="BT0_RS03365"
                     /old_locus_tag="BT0672"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002557259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_011772607.1"
                     /db_xref="GI:500096600"
                     /translation="MIQKTTIAVDSSNKPKGINYDTGVPFNVLIVDDSVFTVKQLTQI
                     FTSEGFNIIDTAADGEEAVIKYKNHYPNIDVVTLDITMPKMDGITCLSNIMEFDKNAK
                     VIMISALGKEQLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVK"
     gene            complement(715212..715724)
                     /locus_tag="BT0_RS03370"
                     /old_locus_tag="BT0673"
     CDS             complement(715212..715724)
                     /locus_tag="BT0_RS03370"
                     /old_locus_tag="BT0673"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772608.1"
                     /db_xref="GI:500096601"
                     /translation="MIKKIFLLLIINTSIHSRLITTSIEKRSSEATKKYSAFNLIIEE
                     EYYTKHPKGTHEMQIYELTENFIKSIFRDKINYTAITPTYKEANKYLLQSEIIDKDFS
                     KYKIFKIKAIDSIFKSSALIYTKKGFYKLELHIGNNNKNKLEIFNLNMSYFTKHLNEI
                     SNAMIFYKKY"
     gene            complement(715721..716767)
                     /locus_tag="BT0_RS03375"
                     /old_locus_tag="BT0674"
     CDS             complement(715721..716767)
                     /locus_tag="BT0_RS03375"
                     /old_locus_tag="BT0674"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772609.1"
                     /db_xref="GI:500096602"
                     /translation="MVKILSNFFKATLIASIIAFLIEELSIILFLPYKIRFALIFIGF
                     LFDAILILIFLYKISKAYFSQKLQIYIRNNLFFDLIHCLIPLIFYSSHQIQNIINPHE
                     TILSPIVLSLFKLRFLRLLRFNDLMIEIYYNPKEKNLILVAFARTFSISLLIPFIFFI
                     IFSSSGFANTIPEKQEFNIIKNISITTEKNYIKEKYPFILIIKDTDKTIYSKSDDIFF
                     YYSPSEYKIIEMEQTKFYIDKYLQRKNDSVIGIFLFTLFISFALFLTNFYKFFKASFL
                     NPIILMQKVLQNPIEYRKIQIPFHFSEEKVYEMAKTFNNVLLKDKLNAKRRSKLPLEI
                     EKVKRIINSNKEHV"
     gene            complement(716761..717624)
                     /locus_tag="BT0_RS03380"
                     /old_locus_tag="BT0675"
     CDS             complement(716761..717624)
                     /locus_tag="BT0_RS03380"
                     /old_locus_tag="BT0675"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772610.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772610.1"
                     /db_xref="GI:500096603"
                     /translation="MNSKVYFPHLYHYLFNHESIKGLSVFEKEIEIIKYLEENKKTIS
                     TFIDENFKSDTDLLIQYVKEKTDIIITPLVLSNIESIDLNIVKDLFNKELNKNNLELI
                     FGSIKANPYLRKEFLYDFNAISSGHITFYINKLFEDKNSYTTHLIKKENDMLDSSKIV
                     KNYIKILLLLRVLIIKFYLEKEIKLMPRNIENTAKLVSREIEFLDDNTVSLITQSLFK
                     YENLSNISPIATLISIFSNRTRIPNIKNNRIKGFIGYDESWFSIKQLSSKEHDPRIIK
                     ELLEIARKNKW"
     gene            complement(717621..718283)
                     /locus_tag="BT0_RS03385"
                     /old_locus_tag="BT0676"
     CDS             complement(717621..718283)
                     /locus_tag="BT0_RS03385"
                     /old_locus_tag="BT0676"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772611.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglycolate phosphatase"
                     /protein_id="WP_011772611.1"
                     /db_xref="GI:500096604"
                     /translation="MRIKACIFDMDGTLINSIMDIAFSMNLALKKLGYTEIKIDEFNT
                     LVGRGYSKLVENTLEHLNVNLNDKHLKDNLYQEFVKAYNQNLSSLTKAYDGIPELLRK
                     LNSLNIPVGILSNKNHEELLIISKDIFKDINFFEVRGYSPRFEAKPDPSNALDMIIEL
                     NLMPKEIAYIGDSDVDMITAQNAGFLPIGVSWGFRTIKELKESGAKYILSSPSELLDI
                     IK"
     gene            718495..720075
                     /locus_tag="BT0_RS03390"
                     /old_locus_tag="BT0677"
     CDS             718495..720075
                     /locus_tag="BT0_RS03390"
                     /old_locus_tag="BT0677"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772612.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter ATP-binding protein"
                     /protein_id="WP_041178515.1"
                     /db_xref="GI:752506650"
                     /translation="MQDILILDKVTKRYGDFIANDNICIRFKKGEIHAILGENGAGKT
                     TLMKTIYGIHKPDSGQIFLRGHELKLKDSSESIRSGIGMVFQHFMLIPKFTAVQNIIL
                     GYEDSKFGFINYDHAKRRILKLSERYGLKIDTDKPIENLSVGMGQKVEILKVLYRNAD
                     IIIFDEPTAVLTPNEIDEFMNVLKILAVEGHTVILITHKIKEIKAVAQRCTIMRLGKV
                     IGTFDITKTDEGMLTKLMIGKETSLDISKRQIVDHTNILEIRDLSVKDERGVFKVKNI
                     SLNLREGEIFGIAGVEGSGQEELVEAILGVRDIFSGDIIKKVDGKFESIKGLSVKQII
                     DRKIGHIPSDRQKHGLILDFNILQNIGIKSFDDVNYLKMKSSGIGNDKLKVKFLNTVK
                     KQFVNFNLILLKKISEQLAASFDITPRDILSKVKNLSGGNQQKVVVAREINLKPEVLL
                     AVQPTRGLDVGAIENIYKKFLAQRDEGMTVLLVSLELDELMSVCDRIAVMYNGGIVGV
                     LEHNFDVGVIGKMMMGIV"
     gene            720109..721227
                     /locus_tag="BT0_RS03395"
                     /old_locus_tag="BT0678"
     CDS             720109..721227
                     /locus_tag="BT0_RS03395"
                     /old_locus_tag="BT0678"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_041178584.1"
                     /db_xref="GI:752506719"
                     /translation="MAVFLNSSIFINFFAFFLGILILGLIVLILGYSPLRMYYIMIEV
                     IFSSPKHFAYIVSYATPLIFTGLSIGIALRVGLFNIGVESQFMLGSISALIAGIFLDF
                     PPVLHVICIFLFASLASGILGVLIGYLKIKFNINEVISGIMFNWILFHLNNIIIDLPA
                     IKKDNSDLSKPIRESAFIDFFGSWKLSSEGLAYRAKHPFINDLLKAPLNFGIIIGIII
                     AILMWFLLNKTMLGFKISSVGRNIVASYRVGIDIKKILMFTMFLAGAFAGLAGAIQVM
                     GVNKAIFKLTYMEGTGLNGIAVALIGNNSPIGIIFSSTLFSILFYGSSRVQSLMGLSS
                     SIVSLMIGIVVIMISASHFLNKMFLRGIKSVKRTNISN"
     gene            721199..722125
                     /locus_tag="BT0_RS03400"
                     /old_locus_tag="BT0679"
     CDS             721199..722125
                     /locus_tag="BT0_RS03400"
                     /old_locus_tag="BT0679"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772614.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_011772614.1"
                     /db_xref="GI:500096607"
                     /translation="MSNALIFLISETLINSQTLILAGLGGLISERCGIINIGLEGTMA
                     LGAFVGATVAYCYGSPLFAIFAGGLSGLVLSILHAIFTVFLKSDQIITGMAINFLGPS
                     VAMLFGTFIFGSASTPPIDIKLPILFDGVLDKRSLVFQIFGKRYSLYIAIICVVLFHV
                     MFKYTKIGLRIKASGEEPEVLESLGVNVFMIRFFCVLLSGLFAGIAGAVLSTVIASSY
                     MQGIIGGQGFIAIVMVIFGNWQPFGILMGSFLFSFIRTLVVMMSQVSFLSLIIPLKIL
                     IILPYVVVILSLMFFSKRNYVPKALGLPYKKD"
     gene            722277..724502
                     /locus_tag="BT0_RS03405"
                     /old_locus_tag="BT0680"
     CDS             722277..724502
                     /locus_tag="BT0_RS03405"
                     /old_locus_tag="BT0680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772615.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_041178516.1"
                     /db_xref="GI:752506651"
                     /translation="MLKIKHRFIGFLFLCLLITILFFSLIFKFVLSSYLERYYKQLTR
                     AQIRRAAFAVQALLDTFYIIIDGASSNLALETMSEYSFIKNGGHIFSEVELDRLRENS
                     KIVLDAVKGNRKYRNRVYEILFNLKLDTFYEEFAFLDFEGKIIVSTRHANNIDFGQSE
                     SNTEYFKNSVKEYKKSELNFVGWYPGLTEGITGEVAIRSHYKDKKASAIVVPVYSAED
                     KVFLGYLVGYLLDDVIRDKLDRSRFGFYNRGNLFYLDPYNNLVNPLIEYNESSKVSDK
                     FVSILKNALSKPPMQPLVPGQIPVYQIERAYFPEMKLYNYYAILPISSELGDNSGILV
                     ARIPYEDIYGVIYSLAFKFIVCAILGIIILVVILSVRLETVISFRLNLVRNLVKEIVQ
                     GNLDKDYVINDKYDDELGSLGLQIVKMRDAIADAIASVLKNISYVNKASVEVVNSSQN
                     LSSSALQQASTLEEMSANIEQISSGVEMSVNHSRETERIALITNENAQIGGKAVEESV
                     VAMQSIVEKVSVIEEIARKTNLLALNAAIEAARAGDEGKGFAVVASEIRKLADLSKES
                     ALEIGELVEENSRLATEAGLIFKDMLPEIEKTTNLVKKIFEGSYKQNDQIIQFKEALD
                     QVGEVVQASASSSEELSSMADRMLEKAKELKQVISFFKVKDFEVDAFDKLNSGDDVLM
                     TGDLTSLNMESNSSLGDSQDDIHGDSKVSYESINKRVDPKKAIDVVDKDLDFDEDFSD
                     F"
     gene            724532..726439
                     /locus_tag="BT0_RS03410"
                     /old_locus_tag="BT0681"
     CDS             724532..726439
                     /locus_tag="BT0_RS03410"
                     /old_locus_tag="BT0681"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772616.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein"
                     /protein_id="WP_011772616.1"
                     /db_xref="GI:500096609"
                     /translation="MKLKLKVRILLIVSILIAIFISILFFVFGMSINSSLVAQQLDLM
                     QNLIGNVKNSLTLYLSSMEERVKINSMYLDSSSVFESIARSKPKRIEAILDQIEILVK
                     TGRGNNLMITNKKGEIIFTTAVKDNSDYGISVADKEYFLKLRGTSSIYNSSVLLADSG
                     SVEEVLMRDVSKIRNKSGQIPYLLIGIPLRDHNTSDVFGYFMIFYAIDYLYNSFKGIS
                     FGALGSGRTMVFDQTGSFLIHHTWLPGDNLVNVNPYYSSVVKSTSEDLIQKNQEISLR
                     RYVDLHGQEFVGFAQKVKCHLSNFSFIVYLRVNTNDFYYMTRLTTFILGISFVVTLVI
                     LGLVTIYLVGKLSAVLNGILSYSGRLASGDFTVSSYSLEWKTLELHGLYEDLELLRSN
                     FSSVARGVIENLDYLYENAIQIANASQNLSSGAVEQASTLEEMTANIEQISQGVTENT
                     DNASTTESIAVNTNEKTKEGHESVTKAIEAMEVITDKIGVIDEITRQTNLLALNASIE
                     AARVGDKGKGFEVVAAEVRKLADQSKESAREIIDIAHKSLTVASKAGNNFEQIVPGME
                     KTAGLVKNITRESYNQSNQIGQFKNAIEQVSQLVQTTASSSEELSAMSERMLDSVKHL
                     KESVDYFKIDK"
     gene            complement(726495..727559)
                     /locus_tag="BT0_RS03415"
                     /old_locus_tag="BT0682"
     CDS             complement(726495..727559)
                     /locus_tag="BT0_RS03415"
                     /old_locus_tag="BT0682"
                     /EC_number="2.1.1.61"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R0A7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA
                     (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
                     /protein_id="WP_011772617.1"
                     /db_xref="GI:500096610"
                     /translation="MQIAVLLSGGVDSSVALYIMIQKGYKNIKCYYLKIWLEDELSYI
                     GECPWKEDINYVEAVCKKFNVPYEIISLQDEYYKRVVTYAIEELKIGNTPSPDIFCNQ
                     RIKFGAFFDKINEHYDLIVTGHYAKIENKNDHYILKQAKDKIKDQSYFLSHLSRKQIS
                     KLHFPLGDLLKTEIRQIAQKIDLPNKNRKDSQGICFLGKIKYDEFIKYHLGELKGNII
                     EQETGKILGTHNGYWFFTIGQRKGIKLSHGPWFVTEKDIQNNIIYISNSINYLKQGKQ
                     QFLVHKTNWINKPLNNGDLSAKIRHGEKKIKCKIEMLKNDIIKVDLEEKDYGISPGQF
                     CIFYQEDECLGGAKILKTLT"
     gene            727657..728880
                     /locus_tag="BT0_RS03420"
                     /old_locus_tag="BT0683"
     CDS             727657..728880
                     /locus_tag="BT0_RS03420"
                     /old_locus_tag="BT0683"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772618.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxy-3-methylglutaryl-CoA synthase"
                     /protein_id="WP_041178517.1"
                     /db_xref="GI:752506652"
                     /translation="MKVGISDIRVFLPLNCLNLHVLLDNSLYNSDEKFFKKFNRAIDA
                     TLQKAFRFTSPNEDSVTMASSAVKLIFDNNNLELDKMRVFLGGTETGVDYSKSISSYV
                     YGALKLAGINLSNNFLTFQVQHACAGSALSLHSAASILSHSEKFEYGIVFSSDIAHYS
                     NLTTAEITQGAGATAVLIEQNPKVVSINLSEFGVYTDDVDDFFRPFGSLEAKVKGRYS
                     IDCYNKANEEALANFAYKKNMSIKDLFSKYRFILHVPFAQMPIDSMHYVLKKYYSEDE
                     SERNAYLESIDFYDSVEASKEVGNLYTGSIFLSLMSYLKRVFAKKDISGEKILFCSYG
                     SGNIMVIYELTVEENAHCVVKTWDIDKMLSVRHDANFDEYRDFFENRIVPGESQGFYL
                     KEIREDGYRVYGYRA"
     gene            728864..729928
                     /locus_tag="BT0_RS03425"
                     /old_locus_tag="BT0684"
     CDS             728864..729928
                     /locus_tag="BT0_RS03425"
                     /old_locus_tag="BT0684"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422434.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="isopentenyl pyrophosphate isomerase"
                     /protein_id="WP_041178518.1"
                     /db_xref="GI:752506653"
                     /translation="MGIEPNILNNKKRQIEICLDKEDVSKSDNLLNFVNLKHDALSEL
                     DFCEIDTRESIFGYDIAMPIFISSMTGGVKEGNKLNKSLVKIANDLRIPMSLGSFKLI
                     FKYPEYIKDFYLRKYAHNIPLFSNIGATQLREFGIFEIIEMNKRLEVDAIIVHLNSGQ
                     ELMNLRGERSFRGIKDSIARICSVSNIPVIVKETGFGISPDSVISLLDLGVSYVDLAG
                     SGGTNWVLVEGIKEENLDIASCFANWGISSVLTLLSIKDFFKDKVFASGGYETGMDIA
                     KGIALGAKLVGIAAAILRAFYAGGENALYNLLKGYEYVLKMSMLLSNSKDLAQFRLNK
                     YFLSHPLPFNVKSFKDFYET"
     gene            729918..731168
                     /locus_tag="BT0_RS03430"
                     /old_locus_tag="BT0685"
     CDS             729918..731168
                     /locus_tag="BT0_RS03430"
                     /old_locus_tag="BT0685"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772620.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxy-3-methylglutaryl-CoA reductase"
                     /protein_id="WP_041178519.1"
                     /db_xref="GI:752506654"
                     /translation="MRLSENFRSKSILEKKREIKSLLKLNLCDFFYDSADEDFLCHMI
                     ENYVGYLSLPIGIVKNLKVNGKYYTVPIATEEPSVIAALNFSSKILEHANLSYSVGEV
                     LGIAQVYIKTDKDLSDMCLGLFKKIDLWSKPLLHNMERRGGGFRKLSTKFIKEIGIQK
                     LNIYVDVCDAMGSNLLNSVAERVAHHITLEFGYECVLKILSNDSNDFAIKANFKLNVN
                     DLLKDSEESLVLAQNISLISKIGFFEEDRAVTNNKGIMNGITGLCVATLNDTRALEAC
                     IHKFASRSGIYLPLSKFYISDENLIGEIELPLQVGIKGGSAGSHEAAILSFKIMGIDC
                     KKEFMGVLSCVGLASNFAALRALAFDGIQRGHMKLHVNKILYLLERDYNISSDERGKI
                     LFKMSESGIYSLDFALKILGDLRA"
     gene            731170..732108
                     /locus_tag="BT0_RS03435"
                     /old_locus_tag="BT0686"
     CDS             731170..732108
                     /locus_tag="BT0_RS03435"
                     /old_locus_tag="BT0686"
                     /EC_number="4.1.1.33"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diphosphomevalonate decarboxylase"
                     /protein_id="WP_011772621.1"
                     /db_xref="GI:500096614"
                     /translation="MKIRCKVNPSLALIKYWGKRDKFLNIPATSSIAVSVDKFYSISE
                     LELSCKDEIILNSRVVVLSDREINFFNHARKILNKPNVGFRVISENNFPTSAGLASSS
                     SGFASIAACILRYFNQYSHQKASQLARIGSASASRAIYGGFTLLKEGAKSSFQLDSFN
                     CFSDLCIIFAIVDGRKKEISSRVAMEICKQDKFYWDAWIESSRNIFKEALYFFLKGDF
                     NGFGLKIVKSYQCMFSLMLSSSIIYFKSNTIELIKYIADLRSKGVPVFETMDAGPQVK
                     VLCLKKDLELILTRLTSNFRDVNFVVSKIGSGLEWI"
     gene            732099..733040
                     /locus_tag="BT0_RS03440"
                     /old_locus_tag="BT0687"
     CDS             732099..733040
                     /locus_tag="BT0_RS03440"
                     /old_locus_tag="BT0687"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772622.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomevalonate kinase"
                     /protein_id="WP_011772622.1"
                     /db_xref="GI:500096615"
                     /translation="MDIISFSVPGNLLLMGEYFILEEDGFGLAVAIKERAYFSFKRSD
                     TWRFFAKKTKIDDFTLIENNDDFVFRMFRYLKQKYFVNLEDFSFDVYIDTSNFFLNSG
                     VKKGFGSSAVVAVGIVCGIFLILNNDNYFVKDKIFMYCLEAYRYAQGGMGSGYDIATS
                     LFGGVVKFKGGDLPTYDRLENICFNNFYLMRGPSPVKTTSSIIRYYEYKDSLMSFIKD
                     VNIVMKKIILNISNSSDCLLSSLKLAKNIGLDIGEKIGISANLPLNLAYLENECTLIK
                     ALGAGNETFLVYEPNFEVFEQFNIEPIDLDLDGVKFQ"
     gene            733041..733934
                     /locus_tag="BT0_RS03445"
                     /old_locus_tag="BT0688"
     CDS             733041..733934
                     /locus_tag="BT0_RS03445"
                     /old_locus_tag="BT0688"
                     /EC_number="2.7.1.36"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772623.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mevalonate kinase"
                     /protein_id="WP_011772623.1"
                     /db_xref="GI:500096616"
                     /translation="MFVIKKPSKILFLGEHSAVYGFPVIGTTIPLYMYLVYIFSDSWK
                     YLGVPSLKIDEVIHFINKRFNKVRPVEFLIFSQIPVGLGFGSSASLSLCFAEYIVSHD
                     EYRTYDKILLAREIENIFHGRSSGMDVLLVELDGTFYLERKNGSFSYRRIAFCNFYFL
                     IGAVRRECTTNKIVSDLNYRISLDNSQFEIIEKLGCIVKNSYIAFNKRDILLLANNMN
                     VANNYLNSLGLSSCTLDYVIEKGRQFEALSGKLSGAGRGGAFILLFQDENDASLCLEK
                     LSKDLDKNNINLIFPLKIFKC"
     gene            complement(734056..734129)
                     /locus_tag="BT0_RS03450"
                     /old_locus_tag="BTT0026"
     tRNA            complement(734056..734129)
                     /locus_tag="BT0_RS03450"
                     /old_locus_tag="BTT0026"
                     /product="tRNA-Val"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:complement(734093..734095),aa:Val,seq:tac)
     gene            complement(734182..734625)
                     /locus_tag="BT0_RS03455"
                     /old_locus_tag="BT0689"
     CDS             complement(734182..734625)
                     /locus_tag="BT0_RS03455"
                     /old_locus_tag="BT0689"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772624.1"
                     /db_xref="GI:500096617"
                     /translation="MQKKFISIILIFTSQFILLGINEDLEFLYSSIHQLRNDLHLEKL
                     EIDKTLEIVAKEYAINLNENKVLTHTLFGTTPMQRVKKYDKYFCRIREILAAGMDVQD
                     VTGAWLKSKKHKEALLNKDTSKMGGYVLRTKDKKNIFVVLFGEKF"
     gene            734695..735219
                     /locus_tag="BT0_RS03460"
                     /old_locus_tag="BT0690"
     CDS             734695..735219
                     /locus_tag="BT0_RS03460"
                     /old_locus_tag="BT0690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772625.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="neutrophil-activating protein A"
                     /protein_id="WP_011772625.1"
                     /db_xref="GI:500096618"
                     /translation="MANHLNYLKTDDLDKINLKLQELLAGLHVFYANLRGIHWNIKDV
                     NFFVIHKKTEKLYDYVAEVIDILAERARALGYDSEFRCSEFIKKSFINEISLDITSSL
                     EPSISSIVCNLNDILKNMSKTRCFVDGTSDYGTANILDDIIVSFEKYLWMYRSLLSDC
                     ECPCHKKGCCSEKH"
     gene            735344..737350
                     /locus_tag="BT0_RS03465"
                     /old_locus_tag="BT0691"
     CDS             735344..737350
                     /locus_tag="BT0_RS03465"
                     /old_locus_tag="BT0691"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772626.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor G"
                     /protein_id="WP_041178520.1"
                     /db_xref="GI:752506655"
                     /translation="MEIRNIGIMAHIDAGKTTTTERIIYYTGRTHKIGDVDSGNTITD
                     WMSQEQDRGITISSAAITCYWKNHQINIIDTPGHVDFTAEVERSLRVLDGGIVVFSAV
                     DGIQAQTETVWKQASKYSIPRLAYVNKMDRVGANFFKVVEDIKNKFGIVPIVLQIPIG
                     SENNFEGVIDIIRNKELHFELRDGKPIVLESVVREEFIENVKIFRENLIDSISNFSDK
                     ITKLFLENSVIDDSIIIEEIRRCTISGFIIPVLMGTSLKNIGIEPLIDAVVDYLPSPF
                     EKKISAYSLKTDRSVSIDPKNEKKLSALVFKVQYFSTIAAHLYFIRVYSGVLNSSKRI
                     VNIAKNKREKFTRIFRVFSNKNEQIDEVKAGDIGAVIGLKYSITGDTLVEENNEVVLE
                     PLVFPEPVVLISIEPEKASDDVRLKEVLEVIAKEDPTFSYKESKETGQLLVSGMGELH
                     LEIIIMRIRDDFKLNVYTGKPQVSYRESLSSTVNDVFEFVNMFAGKELNLKIGMIVSP
                     LVRGEGNKIEFECDVEPLFKAAILRGITSSFSSGIIGYPIIDAGIKITSLDYDKSKVN
                     ESVIESIAGLAFNEFFKRANPIKLEPVMMLEIRTPIEYTGEVISTLNFIGGMIHSISN
                     IENYEIIKAEAAFEKLFGYTSILRSATKGRGVFTMEFSYFKEKM"
     gene            737669..738877
                     /locus_tag="BT0_RS03470"
                     /old_locus_tag="BT0693"
     CDS             737669..738877
                     /locus_tag="BT0_RS03470"
                     /old_locus_tag="BT0693"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose repressor"
                     /protein_id="WP_011772627.1"
                     /db_xref="GI:500096620"
                     /translation="MQGENMVSIRGGNRKKILLSLKNMQYSRTDLARKLSLTNAAVTI
                     LTNHMIKENILVEVGSKESGIKKHGRKEILLDINKDFAYSMGVIISSNYFQIGIANLK
                     CEVLISETYSFEPPVSAYEILEKIKDHMIEIIWKHNFSRDKFIGLGFSITGIIKDKES
                     GIVNDSHGAWIEKDVPVKAILEEYFSLTVYLESYVKNLSLAEFMGKNVDNIMFFDYTD
                     TAELSIWSGGNVYAGFNNKSGMVSHMVIDYGGEKNCPTCGNKGCVNMLISNFALQRLI
                     SKEFMNGEIPELYDKYESRLKKVTIYDIFALHDKYEFIHRIMEDTVKYLAIVIINIQR
                     VLDFNYLVLYGQSFKLKSFFDLLKKEIKRLNKESIILKLSSLDTEVSVVGPASSVIFN
                     KFYLTGGDID"
     gene            738938..740287
                     /locus_tag="BT0_RS03475"
                     /old_locus_tag="BT0694"
     CDS             738938..740287
                     /locus_tag="BT0_RS03475"
                     /old_locus_tag="BT0694"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal recognition particle protein"
                     /protein_id="WP_011772628.1"
                     /db_xref="GI:500096621"
                     /translation="MFENLGTGFRDFVKYISGKSVINEKNIEAAIDTIKNALIEADVN
                     LRVVRRFINSVVEEAKGIKVLRNIDPKSQFIKIVNDKLINFLGDKHSELVLSPVNKLS
                     CILMLGLQGSGKTTTCAKLAMRLKSENRKVLLVAADTFRAAAVNQLKILGMQVGVSVF
                     SLEGESDPIKVVKKSIEYAKTELFDTVIIDTRGRLEVEDLLLREIIEIKKIVAPTETI
                     LVADAMTGQSAVNIAKEFNDSVGITGVIFTKFDSDARGGAILSLKTICGAPIKFVGVG
                     EKPEDLDVFYPDRVASRILGMGDVVSLVEKAQSVIDKEEALRLEEKFKKANFNFEDYL
                     NQFKYMRNMGGISSLMGMLPGVSLEMLNRGVDERELKREEAIILSMTKKERLNPVILN
                     SPSRKKRIALGSGTTVFEVNKFMKKFSQTVLMMKKMKNKSFQNKIASLFGDKGGMIN"
     gene            740284..740535
                     /gene="rpsP"
                     /locus_tag="BT0_RS03480"
                     /old_locus_tag="BT0695"
     CDS             740284..740535
                     /gene="rpsP"
                     /locus_tag="BT0_RS03480"
                     /old_locus_tag="BT0695"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R0B9.1"
                     /note="binds to lower part of 30S body where it stabilizes
                     two domains; required for efficient assembly of 30S; in
                     Escherichia coli this protein has nuclease activity;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S16"
                     /protein_id="WP_011772629.1"
                     /db_xref="GI:500096622"
                     /translation="MSVRIRLKRMGAKKRPYYRIVVMDSASPRDGRAIEELGYYHPVE
                     KQNQVKINENKFRDWIGKGAIPSDTVKKILNKNNFKVES"
     gene            740545..740793
                     /locus_tag="BT0_RS03485"
                     /old_locus_tag="BT0696"
     CDS             740545..740793
                     /locus_tag="BT0_RS03485"
                     /old_locus_tag="BT0696"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772630.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772630.1"
                     /db_xref="GI:500096623"
                     /translation="MKEYGNEIELIEFVVKSLVDKRDEVKLNVVEGEKSTILELRVSA
                     NDVGKIIGRRGRIARAIRTLLSACAAKTNRRVQLEILD"
     gene            740797..741297
                     /gene="rimM"
                     /locus_tag="BT0_RS03490"
                     /old_locus_tag="BT0697"
     CDS             740797..741297
                     /gene="rimM"
                     /locus_tag="BT0_RS03490"
                     /old_locus_tag="BT0697"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772631.1"
                     /note="Essential for efficient processing of 16S rRNA;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="16S rRNA-processing protein RimM"
                     /protein_id="WP_011772631.1"
                     /db_xref="GI:500096624"
                     /translation="MFVKGIILSSYGINGYAKVKSISNGFDDFFDLKGNKLVLKKKCC
                     SSIEVKVEDVSLMNHSLLLKFEEFNTPELIKDLIGFELWVNDEFASKLEEGEYYFGEL
                     IGYKLVNNGKELGVVVSFFECVASILLEVKVGSKLFFVPFLNIYLGDIDRELKTIELK
                     VLDLLK"
     gene            741294..742013
                     /locus_tag="BT0_RS03495"
                     /old_locus_tag="BT0698"
     CDS             741294..742013
                     /locus_tag="BT0_RS03495"
                     /old_locus_tag="BT0698"
                     /EC_number="2.1.1.31"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R0C2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (guanine-N1)-methyltransferase"
                     /protein_id="WP_011772632.1"
                     /db_xref="GI:500096625"
                     /translation="MKITILSLFPSIITPFFENSIMKKVISKGIISCEVISIRNFSDD
                     KHKRCDDIPYGGGAGMVLKAQPISAALDYVNARSKTTIFVSPSGLKYNQKLAYDLSKK
                     DELVIICGRYEGLDQRIIDLYVDFEISVGDYVLSSGEVAALVIIDSVYRLLEGVINPN
                     SLLEESFSCECGLLEYPHYTRPYEFKGLEVPNVLLSGHHEEIRKWRFMKSIEKTKKNR
                     YDLYLKYLEMRGENDGFNKKN"
     gene            741991..742353
                     /locus_tag="BT0_RS03500"
                     /old_locus_tag="BT0699"
     CDS             741991..742353
                     /locus_tag="BT0_RS03500"
                     /old_locus_tag="BT0699"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422447.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L19"
                     /protein_id="WP_041178521.1"
                     /db_xref="GI:752506656"
                     /translation="MDLIRKIEAKGKRTESFDFRVGDTIRVSYKIIEGTNERIQNFEG
                     LVISIQNKGIGQTFLVRKISSGIGVEKIFPMHSPIIEKVQVLKRGKVRRAKLYYMRDR
                     IGKAAMKVKERLDIKKLK"
     gene            742331..743161
                     /locus_tag="BT0_RS03505"
                     /old_locus_tag="BT0699A"
     CDS             742331..743161
                     /locus_tag="BT0_RS03505"
                     /old_locus_tag="BT0699A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772634.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772634.1"
                     /db_xref="GI:500096627"
                     /translation="MILRSLNNTQVSKITLNKKFPLNGRLEVIKSLGVNKWLVSFLGN
                     YFEVKSNLPLKVGFKYFAKIVNTSGNFLIHVNYASMFRDLDLFETDDKVVFKRRGNSL
                     DQNTKKLFRNIFANIKDEFVLKFLLTLYDQIITEQDFMQIYNYFGSKLEIREQDNKLP
                     IFIENDNNFIISIPFKFMEGSGLLFLFSYKDLEMVYKWSFVYFFNEQEKIICEIHLFG
                     ANSKLRIYANFDLNNIVRELRRSLFRYNITDIKILDSIQEFEDFDCEVIVAKSIDYKI
                     "
     gene            743170..743430
                     /locus_tag="BT0_RS03510"
                     /old_locus_tag="BT0699B"
     CDS             743170..743430
                     /locus_tag="BT0_RS03510"
                     /old_locus_tag="BT0699B"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar biosynthetic protein FlhB"
                     /protein_id="WP_011772635.1"
                     /db_xref="GI:500096628"
                     /translation="MHGEKLALLIKYDTKFPAPFILAKARGEKVLRIKELAKREGIPI
                     VEDKYLSESLFLVNEGDFIDSKYFKVVAHILSVVYKLKSNKL"
     gene            743704..744243
                     /locus_tag="BT0_RS03515"
                     /old_locus_tag="BT0701"
     CDS             743704..744243
                     /locus_tag="BT0_RS03515"
                     /old_locus_tag="BT0701"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772636.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178522.1"
                     /db_xref="GI:752506657"
                     /translation="MKSDQNKACGNDFRKVNKVPYWKMRKVKSDLKKQNVVALNTNDN
                     KSVGTNSNDQKNYKGNKQKGFSKDRRLRIRFKEVCPICEKPIRDIISCMSMKLNGEDK
                     PIHFDCAIDKLKSENELFKNESLLYGGVGKFFVIDKSVRGNSLAFKIVREVDFENLES
                     CPSWRKKIFQDMNKGFKFY"
     gene            744246..744743
                     /locus_tag="BT0_RS03520"
                     /old_locus_tag="BT0702"
     CDS             744246..744743
                     /locus_tag="BT0_RS03520"
                     /old_locus_tag="BT0702"
                     /EC_number="2.7.7.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B2S145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="WP_011772637.1"
                     /db_xref="GI:500096630"
                     /translation="MRVALFPGSFDPITWGHIDLVKRASLIFDKVIVLVANNSAKSYL
                     LSDIERYELTFEVIASLGWSRIFVDRYDGIILDYALKNNIGFIVRGVRAFHDFEFEFE
                     RYVVNNKLSPSIDIVFLPSSDKYLFVRSDLVKELIKNKNFDLSSFIPDLVQKKLKSKF
                     IDKLS"
     gene            744795..744977
                     /locus_tag="BT0_RS03525"
                     /old_locus_tag="BT0703"
     CDS             744795..744977
                     /locus_tag="BT0_RS03525"
                     /old_locus_tag="BT0703"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:B5RMP7.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L32"
                     /protein_id="WP_011772638.1"
                     /db_xref="GI:500096631"
                     /translation="MAVPKFKPSKSRSRTRRSINMRKKIPQFQECSNCGNLAVRHRVC
                     VKCGYYRNSQYLELGL"
     gene            745000..745242
                     /locus_tag="BT0_RS03530"
                     /old_locus_tag="BT0704"
     CDS             745000..745242
                     /locus_tag="BT0_RS03530"
                     /old_locus_tag="BT0704"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl carrier protein"
                     /protein_id="WP_025443510.1"
                     /db_xref="GI:645072431"
                     /translation="MDQSEIFKKVRSIISEQLDKKEDEITMESRFVEDLGADSLDIYE
                     LLYLLEEAFDDKIPENEASEFETIGDVVAFIEKKKD"
     gene            745248..745982
                     /locus_tag="BT0_RS03535"
                     /old_locus_tag="BT0705"
     CDS             745248..745982
                     /locus_tag="BT0_RS03535"
                     /old_locus_tag="BT0705"
                     /EC_number="3.1.26.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772640.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease III"
                     /protein_id="WP_011772640.1"
                     /db_xref="GI:500096633"
                     /translation="MGSAVVMKLDTDRRKKLNEFLLGLHIDFNDIDLLNMSLSHSSYA
                     NEFDQKYANNERLEFLGDSVLNLIITDYLYRFYPEKSEGELSKARSYIVSEESLSSIA
                     RELNLGNYILLGRGEENNDGRNKKGILADAIEAFVGALYLDGGFLKTLDFVIELFEVH
                     IRLMFNRGDFKDYKSLLQEYVQKKYKISPTYKLAKELGPDHNKVFCVELYVNDKFISN
                     GKGKSKKEAEMIAAEMALKNIANIDL"
     gene            complement(745954..747177)
                     /locus_tag="BT0_RS03540"
                     /old_locus_tag="BT0706"
     CDS             complement(745954..747177)
                     /locus_tag="BT0_RS03540"
                     /old_locus_tag="BT0706"
                     /EC_number="2.7.7.19"
                     /EC_number="2.7.7.25"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772641.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polynucleotide adenylyltransferase"
                     /protein_id="WP_011772641.1"
                     /db_xref="GI:500096634"
                     /translation="MNLGINTKDIIKISKIFNKHNYEFFLVGGALRDLLLKKIPYDFD
                     FTTNATPEEIMQLFPNNVKTGIKHGTISIIFNKKIFEVTTYRIDIDYENKRAPKNIKF
                     TKNLNEDLQRRDFTINSIAMNILNYEIIDCYKGKQDLNKKIIRCIGDPNKRFEEDALR
                     ILRAARFASTLDFTIDKNTLISMKYKKTNILFLSKERINNEFIKLLEGKNPIKGINYL
                     QKINFFKYFFNIEINKKLKNKITLLNKNKFYLKAMVIFTIKKDISCLIENLKSLRFSN
                     KDIKLILLYKTVINEINTLRIKKLHDIRILLSKATRENYKEILDIYKALKGKDHKLKF
                     IINKIRRKKLLKDPLSLKELKINGNDIKNLKLTENKNIGKILDYLLREVLTNPKLNKK
                     EILIKKIKDQYLQYS"
     gene            747303..749069
                     /locus_tag="BT0_RS03545"
                     /old_locus_tag="BT0707"
     CDS             747303..749069
                     /locus_tag="BT0_RS03545"
                     /old_locus_tag="BT0707"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772642.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178523.1"
                     /db_xref="GI:752506658"
                     /translation="MNKSNVSIYDSIDKLSKDSRAKLIREIKKNLSLNSSVLSENNSN
                     YLYSNFAMQIDDFLSKKFMEESFWVRIWVYILKFFQKDKTKEDIYKMHLLKRLEDHVN
                     NMYKNPVIDFKKGYLRIGFVEMFFELYCHLVKLKGYFKMLEKGNIVEQAMFEVIHSKI
                     PNSQCEIEDFLEPEEYEQFLKKDKTQDELEEIIKIRIGNYIASIPLQIYSVVEDMFEF
                     FYVLNGIAFFPYRSFFSFFNVEPLDDMGNFDVSDLDRTVSTSFESVSKYFKCFFEILH
                     TLKDIEINEEVLKIIVKNYFLIIKSNENNILSEESLLGIDSMFKDILCIMTEIISLSK
                     TLPYLDVFKIYYENPVLKPKNYVPCFDVKGFYENILFLNVTEQLVKNYAKSLAILVNR
                     DLKKLIENYSVIINLDSMIFKGMELEYSNFKKLYFLNEFFKYIYDIKIIEILRTVNNV
                     VLVNNTDLRSLYIKLERNISVLRKKVYDLYFELNYKNEEYERYNKNYDSDDSYKEKIL
                     EWCLSEVETVKGLVFEFMGCFIDLKEKYIALLDNNNAFIQSTLNISHKLSTEDNTKIS
                     LGYVIANVLFIIKQSLFILENL"
     gene            749076..749396
                     /locus_tag="BT0_RS03550"
                     /old_locus_tag="BT0708"
     CDS             749076..749396
                     /locus_tag="BT0_RS03550"
                     /old_locus_tag="BT0708"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772643.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772643.1"
                     /db_xref="GI:500096636"
                     /translation="MKNSNSNDLRLFSILIRVLVIILFFNSVLSLFMFLAGAYNVFKY
                     SFQKFSLEFAIVLSTISFGLEAMRLIFYLFRRKRIKHYIILVFSFIICFCAFFVKIFL
                     FLEI"
     gene            749466..749539
                     /locus_tag="BT0_RS03555"
                     /old_locus_tag="BTT0027"
     tRNA            749466..749539
                     /locus_tag="BT0_RS03555"
                     /old_locus_tag="BTT0027"
                     /product="tRNA-Thr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:749500..749502,aa:Thr,seq:tgt)
     gene            749544..749625
                     /locus_tag="BT0_RS03560"
                     /old_locus_tag="BTT0028"
     tRNA            749544..749625
                     /locus_tag="BT0_RS03560"
                     /old_locus_tag="BTT0028"
                     /product="tRNA-Tyr"
                     /inference="COORDINATES: profile:tRNAscan-SE:1.23"
                     /anticodon=(pos:749578..749580,aa:Tyr,seq:gta)
     gene            749859..750893
                     /locus_tag="BT0_RS03565"
                     /old_locus_tag="BT0709"
     CDS             749859..750893
                     /locus_tag="BT0_RS03565"
                     /old_locus_tag="BT0709"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772644.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminodeoxychorismate lyase"
                     /protein_id="WP_011772644.1"
                     /db_xref="GI:500096637"
                     /translation="MTIKKFFISLFVLFVIFSFLAFFLYFLNSSPFKSDLIYEFEVQK
                     GWGVKKIAWELKKKGLIRSDKLLIAISYLFGSDKNFREGKYLINGHCSTFDVYREFLK
                     GRPILPINITIPEGYTGRRIALKLSESGIISDAQSFVDLINDVKFINDLGLSYDSLEG
                     FLFPDTYKFYKGMDMKEIIRIFVGNFFSKLGSIGIEHKSYSSGEFYNKVIVASIVERE
                     YRVKSEAPVMASVFYNRIKSNMALQSCATIEYIITEELRKTHPTRIYFSDLEITSAYN
                     TYINKGYPPGPISNAGIVSLKAAFFPANTEYLFFVIKDPKVGTHKFSSAYNDHLLAVN
                     SYIRNFITKD"
     gene            750900..752675
                     /locus_tag="BT0_RS03570"
                     /old_locus_tag="BT0710"
     CDS             750900..752675
                     /locus_tag="BT0_RS03570"
                     /old_locus_tag="BT0710"
                     /EC_number="2.7.7.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772645.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_011772645.1"
                     /db_xref="GI:500096638"
                     /translation="MEYAKVIDLIKQRVDIVALISERVRLVKSGSSYKGLCPFHAERT
                     PSFSITPAQGLFYCFGCRKGGDVIKFLMDIEKLDYNGAVKSLCSRIGIVYDDIKKTTV
                     VKNKTQDKSIISKIYDLNAKLIKTFEFFLNNNQKVLNYILQMRGISKDVIDLFNIGYL
                     RFDIPGKFNFYNFLISKGYSDEILSKSGLFSKRKGIFSILSGRLIFPIRDFKGNVVGF
                     GGRYLGRNNGPKYINLSETEVFKKRELLYGFYEGFSVIKESKSVILTEGYIDVLSFFT
                     AGVKIAVSTLGTSFSREHFALIKRYANKIIMCFDDDAAGLLATFKAYQICLPFDIDVS
                     VIRMKYGVDPADVLKNKGAFVLKDMINDGCDAFEYLLEKYSGKYDLSKTTDLNSMVGM
                     FINLISLSSTNTQRDLLLKKLESKMGIKLETLREDYYSMRERSAIASYKRNAYSYEIN
                     TYERYLLVALLKDFNYFTIIRRNISDSDLYDVDVKKIFMCFEYLFENNESFSLLNLKE
                     LLKDNKYSVSEVFFENMLRVEFEVDDEMVKQILFAIKKRKVENRILVFKDMSKDNVSI
                     DAKAQIRELMFLNMQRENLRIYLNE"
     gene            752668..754560
                     /locus_tag="BT0_RS03575"
                     /old_locus_tag="BT0712"
     CDS             752668..754560
                     /locus_tag="BT0_RS03575"
                     /old_locus_tag="BT0712"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase sigma factor RpoD"
                     /protein_id="WP_011772646.1"
                     /db_xref="GI:500096639"
                     /translation="MNSVENKDLQIFKKKNSKIIKAILSHLGDKKAITFEDLSTFLSG
                     DMLDPDNIDYIYGVLENEGISLVNEKMESDICDIDEFDEADKLDSQCMMLDDSIQSDD
                     EIDDKLDEFDDEVLDKEDFSSGYIKSGLLKDSNSEDPIRLYLKEIGKEFLLTGNQEVE
                     LAKQMDSGESIIENILKNEGLVIENYYNLVNAIYSRVDKEEFFKKEKEREKDNNFDYY
                     NKKKRITSFYKASLKPFQDRLIKYIERKHSLYELGEDIFEESITSERLHIKEMLKSVP
                     LYQEELRIFSDDYIDSASKIKDLKRQQKSILDRLKIDKVRNLRILGRDLAIPERRERI
                     EKSLNIREDLIKEQITEAQLAQKELERIEMYYEYPMDKIISMSEEILKGKQMMQHAKD
                     QLIKANLRLVVSIAKKYANRGLHFFDLVQEGNIGLIKAVEKFEYKRGFKFSTYATWWI
                     RQAITRSISDQARTIRVPVHMIEQINRLNRETRYLVQVLGKDPTDEELSSRLGWDLKK
                     VKTVKNVSREPVSLETPIGEEEDSVLSDFIEDKAIKNPAKHTSFVVLQDQIRAVLGTL
                     PEREQEVVKMRFGLEDGYSLTLEEVGLHFNVTRERIRQIESKALRRLKNPKKTQKLKD
                     YLEDLN"
     gene            754573..755331
                     /locus_tag="BT0_RS03580"
                     /old_locus_tag="BT0713"
     CDS             754573..755331
                     /locus_tag="BT0_RS03580"
                     /old_locus_tag="BT0713"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014696532.1"
                     /note="possible nucleic acid-binding protein; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-ribbon protein"
                     /protein_id="WP_011772647.1"
                     /db_xref="GI:500096640"
                     /translation="MESNIDVLKNLEGIYKAKFELEERQKNIPKYLQTKKAQIDGLIE
                     ALAELQFKFKEYQKEDSSLKLDIQDINVRKGKAEEKIDSIKTQREYEALEKELQTIID
                     DEVAIRKKMTHITGLKTKVDREIADVKSRLEVEQDMYATESNDLENELLEIIKKLDSI
                     KGEEEKYAFRMDEDFLFKFQRIIRNKSNGVVPLIENVCKGCHMILPVEFANKVRREPD
                     DVKFCPYCSRILYYQDKFEVGLEMVPGGLADLIE"
     gene            755362..755708
                     /locus_tag="BT0_RS04275"
     ncRNA           755362..755708
                     /locus_tag="BT0_RS04275"
                     /ncRNA_class="RNase_P_RNA"
                     /product="bacterial RNase P"
                     /note="Derived by automated computational analysis using
                     gene prediction method: cmsearch."
     gene            755729..756694
                     /locus_tag="BT0_RS03585"
                     /old_locus_tag="BT0714"
     CDS             755729..756694
                     /locus_tag="BT0_RS03585"
                     /old_locus_tag="BT0714"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772648.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772648.1"
                     /db_xref="GI:500096641"
                     /translation="MGINYLKCTFYLIISLSLLFFIFYVLSYFKTFSNSYLKAGPTEV
                     NLLVLWDNREYKEIIDYAENGLKENKFDFNLNLLLGFSYFYYSLMLNDSYLKNQFLDN
                     SIERLRFLMSINDDVPMNSLYYILGKAYSHKGEYYSDLSVKYLSKALYSSSFDFMSVK
                     EDIFEYLGYSYQILKDYNSSLKFFEKAYKENKSDLVLWSLAYVNYKTGNIDKSVEYIN
                     KFLQEENKSLKNEKSDDNLMQKVYLLYGDIYLEREAYEDALNCYDKVLKINSLNPNVY
                     VKIGDIYRKRDKDYPKARKYWREALSINPYLEEARERLKISLEDF"
     gene            756707..757756
                     /locus_tag="BT0_RS03590"
                     /old_locus_tag="BT0715"
     CDS             756707..757756
                     /locus_tag="BT0_RS03590"
                     /old_locus_tag="BT0715"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012538453.1"
                     /note="functions in MreBCD complex in some organisms;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein Mbl"
                     /protein_id="WP_011772649.1"
                     /db_xref="GI:500096642"
                     /translation="MNFFKSFLIDIGIDLGTCNTLVYIKDYGVVMSEPSVVAIDVNKN
                     NRVVAVGRNAKKMLWKTPENIKAVRPLRDGVIADIENTEKMIKYFISQIFSRKKLFFK
                     PRMVIGVPTCITEVERRAVKESAMNAGAREVKVIEESLAAAIGSDIPIFEPTGHMVCD
                     IGGGTTEISVISLGGMVVSRAIRTGGDEFDESIIKYMRNAHNIIIGQQTAEKLKIKIG
                     NVYPDTHNLKVETIDIKGTDAVTGLPRKQIIDSMEVRESLQEPIGIVVDEVKRTLGAT
                     PPELATDIVERGIILTGGGALLKGLSRLLSKETGVPVYVADNPLLSVAVGAGLFYDYA
                     NRIDISKNIYSFINE"
     gene            757759..758604
                     /locus_tag="BT0_RS03595"
                     /old_locus_tag="BT0716"
     CDS             757759..758604
                     /locus_tag="BT0_RS03595"
                     /old_locus_tag="BT0716"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772650.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein MreC"
                     /protein_id="WP_011772650.1"
                     /db_xref="GI:500096643"
                     /translation="MKFLVNFKNFIKVLSVLIFAIILMLYDSSASKINKRDDFFIFTL
                     NSYIQRNVHEFFNFISSIFKAINEYKDYGETIEAYKKRIQQLEIVIQNVQVLRQENAR
                     LKEQLGFYSVHSNDFISAEIIYLNYANVSSLMAINKGYNDGVQKDMIAVAYQDGFSGL
                     VGKVVKVYADTARVLPLTSYENFVSARIQNSKFIGLVEGKGYGEVLEMNYVNKLAENT
                     LKIGDSVVTAGFSDYPSGIYIGKITHFDVLEYNSLLSIKIEPVIVLDKLEYVFLIKGN
                     QRIEK"
     gene            758601..759083
                     /locus_tag="BT0_RS03600"
                     /old_locus_tag="BT0717"
     CDS             758601..759083
                     /locus_tag="BT0_RS03600"
                     /old_locus_tag="BT0717"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011772651.1"
                     /db_xref="GI:500096644"
                     /translation="MISFILYYIVSIFLGQVFQYYCDINFSFSIDIFLIILIFNSLNF
                     VFNIGLISSILHGFIMEYFNGLPLGFFVFSYVLIFYLLEKVKLIVPKSMFSITIFFIF
                     SKFVIWFVAMTFADFIDLKGFNYSIFDFNIVINIVFLNFLYPILNYCTRNLYTIKEEY
                     "
     gene            759085..760887
                     /locus_tag="BT0_RS03605"
                     /old_locus_tag="BT0718"
     CDS             759085..760887
                     /locus_tag="BT0_RS03605"
                     /old_locus_tag="BT0718"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_011772652.1"
                     /db_xref="GI:500096645"
                     /translation="MKVILKGRYMFGLLLLFFVFFSYLFTLFKMQIGKHLFYDREATV
                     LLSRVEKIKASRGEILDSNFNVLANNLTAFVLKVSLEQYYGMSLEDRDEMLDFLSSIL
                     GIERELILSKIEAPRGYLKDVEIVELSPEMLFRVAEKRSYYPAFLWTYSFKRNYLVDD
                     SCSHPIGYVGRINQRELRSFYNVKGYDNNSTIGKLGIEQIYDSYIRGKEGLIKYRVDS
                     RERKMDSGSIIEHMTPGNNIVLNINKDIQLLAKNTLGKRYGTVVVLKPSTGGVLALHN
                     YPYYSMNDVYNKYSKEDYSFLNRAIQSVYPPASVFKLVLTTALLEEKVLDRARKIYCP
                     GYFRVGNRVFHCWQRGGHGYVDLEHAVAHSCNVYFYILGLKYLGVEKIFKYAKEYGFG
                     EKTGIDLPNEVSGLIPSPEWKEKFFNQPWVGGDTVNFSIGQGFLNATPMQIANMIAMI
                     ANEGVIYKPRIVNRILNGSTNEVILENVPEVLKKTDIISQNTFKFLKKYMRNVITYGT
                     ARNSVLTKAVEVGGKTGTGQTGVTGLENSSFVALAPYNASPSEQVVIFSLVEGRSNTD
                     NMWSAKSVDLMMQGIFANQSYEDILKEYRPWYIR"
     gene            760893..762212
                     /locus_tag="BT0_RS03610"
                     /old_locus_tag="BT0719"
     CDS             760893..762212
                     /locus_tag="BT0_RS03610"
                     /old_locus_tag="BT0719"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772653.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rod shape-determining protein RodA"
                     /protein_id="WP_011772653.1"
                     /db_xref="GI:500096646"
                     /translation="MAVFRKSYDSLTLFSLVMISFIGVLLIYSSDYTSNGSLMKIEYI
                     KQIVWVLGGFCVIFIIGKYDLKIIHGMIYPLYFLLVASLVFTAIFGVTVNGARSWIGI
                     WKLGGQPSEFGKIISILTLAKFYSSRNEYHNFFVFIFAFILIVPVILFVFLQPDFGTA
                     VVYLNMFIFISFFAGIDIHYILYFALTGFFSFFFVVLPVWYEYKADMGNILYLIFSNN
                     FYFQLAFLVLILVFLSSAIGFFVSKYNFSIRLIYFYILFMSSILLIAAFFSKFLSKFM
                     KPYQIKRFLVFLDPNIDLKGAGWNLNQVKIAIGSGGMFGKGFLKGPYTHANYVPSQST
                     DFIFSILAEEFGFLGVSVVLILFFLIFFRILIIMNKSKDRYMSLVLAGVLGLLFFHTS
                     FNIGMSLGLLPITGIPLPFLSYGGSSTITFFLAMALYFNIESIVTMD"
     gene            762367..764118
                     /locus_tag="BT0_RS03615"
                     /old_locus_tag="BT0720"
     CDS             762367..764118
                     /locus_tag="BT0_RS03615"
                     /old_locus_tag="BT0720"
                     /EC_number="6.1.1.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1R0E4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="WP_011772654.1"
                     /db_xref="GI:500096647"
                     /translation="MSEKLDKEDVLYKKRHSIAHVMAEAVIELFPNTKIAIGPPIKDG
                     FYYDFDFEKHIIEDDLLLIEQKMREILKTGSSFVKEVITKEQALMLFKDEPYKIDLIH
                     ELDIADEISIYKSHNFTDLCKGPHIDNMGKIDPKAFKLISIAGAYWRGDEKNKMLTRI
                     YGTLWNNEKDLKAYLKLREEIKRRDHRKLGRELDLFSVHEEIGPGLIFFHPSGARIRA
                     LIEDFWREEHFKNGYDILFTPHVGKSWLWETSGHLDFYKESMFEKMEMDKSNYYVKPM
                     NCPFHIAIYNTGRHSYRDLPFRWAELGTVYRYEKVGALHGTMRVRGFTQDDAHIICTY
                     DQVKFEVQEVLRFALYMWNKFGFTALKAYLSTKPEKSVGDEDDWIMSVKVLKEALINL
                     GIDYDIDEGGGAFYGPKIDLKIIDSLGREWQMSTIQFDFNLPARFKMTYTAEDGKERQ
                     PFMIHRALLGSIERFFGILVEHYGGAFPVWLAPLQVVIIPVNNIVEEYALEVLSRFKK
                     EGIRIKLDNDCNMRMNAKIRQYQSQKVPYMFIVGEKEVVEGKISIRTRTNEQINGLEL
                     KEALEFVKLKVSNKEIL"
     gene            764120..764743
                     /locus_tag="BT0_RS03620"
                     /old_locus_tag="BT0721"
     CDS             764120..764743
                     /locus_tag="BT0_RS03620"
                     /old_locus_tag="BT0721"
                     /EC_number="2.7.8.5"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422469.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-diacylglycerol--glycerol-3-phosphate
                     3-phosphatidyltransferase"
                     /protein_id="WP_011772655.1"
                     /db_xref="GI:500096648"
                     /translation="MNSEIIMSPNKITFFRIILSFVILFILCLEDLWNSYLFLILIWF
                     LIIFNEITDVIDGYIARKYNLVSNVGKILDPYADVLQHLTYFAFFFYKGITPYYFFMI
                     FIYRELSVGVVRNLIIQFDIVQQAKFLGKIKSLFYAIATFASLFFYSLNKLRITTLIE
                     NFISSILNLDFNFSFIVGMIYAMSAFLTIISLIDYVVIFLYLSKYEK"
     gene            764733..766175
                     /locus_tag="BT0_RS03625"
                     /old_locus_tag="BT0722"
     CDS             764733..766175
                     /locus_tag="BT0_RS03625"
                     /old_locus_tag="BT0722"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772656.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772656.1"
                     /db_xref="GI:500096649"
                     /translation="MRSNVLLIFIWLLIGFYSHAQLKQMLTEVKPLSISSESGKGSVY
                     LKVSKSSNYILTFDVSSDSDFVYMVYDIFNKKYITDKIRKKDVKLKLNKDILYAVIYV
                     TSENVNIDFILTDLDLSIISDSSLKAKISGIKKKDKTFLLKDLPNFQLGLKLKRYILR
                     TYNRSIYLAYQIEGNDDIKVSSFIENIGWFDISTAVNDNITDIACFDFAINSKGELYV
                     VFTTKNTSDFSSELIVKKFNSRKWIDISPKFRDNIGFLVNIGIDKRDNLYVAYLRKIG
                     SEYKVNFVANKGYSNIWNSVMDSYMSKGNANVDDVSSIGIISEPFLGIFYNYKVNNYV
                     NSEFIIDSGKTWGNANIQSANVANSVKIISNSKSDQVVLSYITKDRPVVSVFTLQYDK
                     WQNISPNIKIDGVTSDILSYRNDLFLTFEDGNDIRLIYFDDNTWYFFNESEIFQKSVC
                     KPQFAKYQDKGFILSYLSLDFKILYFRLIS"
     gene            complement(766152..766676)
                     /locus_tag="BT0_RS03630"
                     /old_locus_tag="BT0723"
     CDS             complement(766152..766676)
                     /locus_tag="BT0_RS03630"
                     /old_locus_tag="BT0723"
                     /EC_number="4.6.1.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenylyl cyclase"
                     /protein_id="WP_011772657.1"
                     /db_xref="GI:500096650"
                     /translation="MFEIELKAFIPKNKLKEILKLANQKFKFIKEEIKDDTYYCNTEK
                     IIRIRKFNTLEKIVTFKIKSLENDIEINKEIEFKVDQVNNFISFLEEMNFKFLYKKIK
                     KSLIYKKENLNIEINEIENLGFFLEIEKIIYDKNELSFAKTEIYKTIKEFKLQNNIEK
                     KSYFELILANQSKV"
     gene            766767..768086
                     /locus_tag="BT0_RS03635"
                     /old_locus_tag="BT0724"
     CDS             766767..768086
                     /locus_tag="BT0_RS03635"
                     /old_locus_tag="BT0724"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772658.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="potassium transporter"
                     /protein_id="WP_041178524.1"
                     /db_xref="GI:752506659"
                     /translation="MLKFEFSDRFFLFSYFILIMFLGSLLLSLPIAWNGEKKLEYIDV
                     LFTSVSAVSITGLVTVKMENFSTFGFIIIMLLIQFGGLGFITIATFYLLIPKRKLNLT
                     DARIIKQYSLSNIEYNPVKILKSILFVTFLIELIGVLLILVCFRLRGVNISLLEALFT
                     TISAFCNAGFSMHSESIYAWRDVPEAIVVIAILIICGGLGFMVYRDITNTIKYRKKLS
                     LHAKIVFLLSFFLIILGTILFFFSEMHKLKEGYSLGTLIFNSIFYSISTRTAGFNYLD
                     NALITSRTQMLSLPFMFIGGAPGSTAGGIKITTFFLIILAVIKSQDGNGYIIGSYKVS
                     IDSIRFALLFFVRAVFILCFSFFVLLAAESGGKWRVIDLGYEVFSAFGTVGLSVGVTQ
                     DLSFLGKVIIIFTMFAGRIGLFSMAIFVSRRSRFEEFTRPRQDILVG"
     gene            768093..768875
                     /locus_tag="BT0_RS03640"
                     /old_locus_tag="BT0725"
     CDS             768093..768875
                     /locus_tag="BT0_RS03640"
                     /old_locus_tag="BT0725"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772659.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lectin"
                     /protein_id="WP_011772659.1"
                     /db_xref="GI:500096652"
                     /translation="MKTFVIIGLSNLGIHVLENLSKLDCQIIIVDTSKELVEEYDVIS
                     TESFILDQFTKNTLKKVIPVDTDAVIIDFDNDLGKSALVTHYCNLLGVKEICVKTEDR
                     DDAEILKTLGATKIIFPSKDAARRLTPLLVSPNLSTYSIVGHDIIVAETIIPKEYVGK
                     TLLEADLRREKGITVIAVRNLSNSRYEFVDGDYFFLKDDKIVICGKPDKIENFTNNKD
                     LIKDLISVSKSEDASYTENSKKLGFLRFFNFMKKFSKDRKND"
     gene            768888..769859
                     /locus_tag="BT0_RS03645"
                     /old_locus_tag="BT0726"
     CDS             768888..769859
                     /locus_tag="BT0_RS03645"
                     /old_locus_tag="BT0726"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772660.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_011772660.1"
                     /db_xref="GI:500096653"
                     /translation="MTKIIPVASGKGGVGKTSFVANIGYKLACLGKTVILVDLDLGGS
                     NLHTCLGVKNTGVGIGSFINKREKDFSSLIIKTPYKKLYLIPGDALYTGTANIPFSIK
                     KRIIDSIQRDLVADFVFIDLGSGTSYNTVDFYLSAYSGIIVTVPETPSILNAYSFLKN
                     ALYRLLYLGFPPKSAEREYISNFFKNKIEGTNVKFKDLVTGIEVISLSSSLKIKKMMN
                     SFYPRVVLNRIESSEEIAMCENLINVVKNNINIPVEFIGFIPFAKSFRESVNNRIPFI
                     DFDKNSKLNKYFEFIAGNLIKSPVEGSPYIYDDIYDMIKDQSQFIRN"
     gene            769899..771248
                     /locus_tag="BT0_RS03650"
                     /old_locus_tag="BT0727"
     CDS             769899..771248
                     /locus_tag="BT0_RS03650"
                     /old_locus_tag="BT0727"
                     /EC_number="2.7.1.90"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772661.1"
                     /note="catalyzes the formation of fructose
                     1,6-bisphosphate from fructose 6-phosphate and
                     diphosphate; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diphosphate--fructose-6-phosphate
                     1-phosphotransferase"
                     /protein_id="WP_011772661.1"
                     /db_xref="GI:500096654"
                     /translation="MHRLRNKNLDFKIENLGECKQDNPLINFYADESHIHFTGEANKI
                     RFNVYKNDEAWDQYENIFLEKAGPRHKIYFIPKHVKAAITTCGGLCPGFNDVIRSIVR
                     TLWKVYGVHNIYGVKFGYQGLLPDSNLSFVELNPDVVDDINQLGGTILGSSRGGIKPV
                     EIVDTLERMGINMLFNIGGDGTQKGSVLIAEEIERRNLKIAVVGIPKTIDNDFMFVQK
                     SFGFETAVEQSVAAVAGAHFEANSAYNGIGLVKVMGRDSGFIAAHTALSSNDVNFCLI
                     PELDFDIEGPNGLLEHLERRLLAKENLDEMPHAVILIAEGAGQKYFDPSSRKKDDSGN
                     LLYEDIGLYIKDKINTYFKSKNISINLKYIDPSYLVRSSPANASDSLYCARLGSNAVH
                     AAMAGKTKLLISLWSTKFVHIPIKMAVIARNKVNINGSFWRDVLASTGQPFSMKNEK"
     gene            complement(771264..772595)
                     /locus_tag="BT0_RS03655"
                     /old_locus_tag="BT0728"
     CDS             complement(771264..772595)
                     /locus_tag="BT0_RS03655"
                     /old_locus_tag="BT0728"
                     /EC_number="1.6.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012539118.1"
                     /note="CoADR; specific for coenzyme A disulfide; requires
                     NADH; involved in protecting cells against reactive oxygen
                     species by recycling coenzyme A disulfide which can reduce
                     hydrogen peroxide; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CoA disulfide reductase"
                     /protein_id="WP_011772662.1"
                     /db_xref="GI:500096655"
                     /translation="MKIIIIGGTAAGTSAAAKAKRTNKELNITIYEKTNTTSFGACGL
                     PYFIGGFFDEPNNMIARTPDEFEQNGISVFTEHEVMRVDIKNNTLQVKNLQTKQIFND
                     TYDKLMIATGGNPIIPPISNIQLSNFYTLRNMQDGKEIKKLFKKKDIKDIVIIGAGYI
                     GIEMVEAAKALEKNVRIIQLDKRILTESFDREITNIMEEELIKNNVLLHTDEFAKSLI
                     GKEKVKGIITNKSEYKADLVILSTGIKPATEFLEGQLETLKNGAIIVNEYGETSVKNI
                     FSAGDCATIYNLVSKKNDYIPLATTANKLGKVIGENLAGRHVAFKGTLGSASIKVLSL
                     EAARAGLTEETALKLGIKYKTVFIKDKNHTNYYPNQEDLYIKLIYNEETKEIIGAQTI
                     GKNGAAIRMHALSLAIYSKLTTNEIGMMDFAYSPPFSKTWDALNVAGNAAK"
     gene            complement(772605..773993)
                     /locus_tag="BT0_RS03660"
                     /old_locus_tag="BT0729"
     CDS             complement(772605..773993)
                     /locus_tag="BT0_RS03660"
                     /old_locus_tag="BT0729"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-cystine transporter tcyP"
                     /protein_id="WP_011772663.1"
                     /db_xref="GI:500096656"
                     /translation="MNTTIIYTLLNITIMFTLIGLLYFLHKKHISFTKRLLVALGLGI
                     AFGITMKHCYESESIILKETIEWINILGIGYIRLIKMMVIPLILVSIISAIVKLTNSQ
                     DIWKMSLSVILMLIFTAGIAAIIGIGTSLFFNLTAEGLQSGVDEITQGKKLNQGLERL
                     QKTPITQKLSELIPENIFADMAGTRSNSTIGIVIFAALVGIVALKVAKKKPESIEFFK
                     QIISTAQDLTSGMIILILKSTPYAILAMITKISATSDISSIMKLGKFALASYIAIGIT
                     ILMHMTLIALNRLNPIIFIKKAWPVLTFAFISRSSAATIPVNVEVQTKQLGVSEGTAN
                     LASAFGVSIGQNGCAALHPAMLAIMIAPTQGINPTDPLFLLQLIGIIIITSFGAAGAG
                     GGATIASLMVLSSMNLPVELVGLVISIEPLIDMGRTSVNVSGSMVAGIITAKNLNQLD
                     RNIYNNQNEIEK"
     gene            complement(774075..775655)
                     /gene="pgi"
                     /locus_tag="BT0_RS03665"
                     /old_locus_tag="BT0730"
     CDS             complement(774075..775655)
                     /gene="pgi"
                     /locus_tag="BT0_RS03665"
                     /old_locus_tag="BT0730"
                     /EC_number="5.3.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772664.1"
                     /note="functions in sugar metabolism in glycolysis and the
                     Embden-Meyerhof pathways (EMP) and in gluconeogenesis;
                     catalyzes reversible isomerization of glucose-6-phosphate
                     to fructose-6-phosphate; member of PGI family; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="WP_011772664.1"
                     /db_xref="GI:500096657"
                     /translation="MLKYINLNKLKNFQELRQTNPEELKKTLSEDRIKKYDIKIEGHQ
                     VHYNYATKQINETHLNIFQNLSDEANLIEKYKEIIDGKHINISENRKVLHHLTRKQLG
                     TEVIENNENMREFFERELKRIFEFAKQVQNGSIKSTSGKVFKNVVQIGIGGSSLGPKA
                     LYTAIKNYAKQKNLHMMKAYFISNVDPDETEEVLSEIDLQETLFIIVSKSGNTLETAA
                     NMQFLIKKLENNGIKEYQKQIIIITSKGSMLALEQGYLEYFFMHDSIGGRFSPTSAVG
                     LTLITLCFTENVTKEILKGACEVDKKALNKNVRENAPLLAALISVYESNILNYSSNCI
                     IAYSKAMENFYLHLQQLEMESNGKSVNRFGEKIDYKTVRIIWGGIGTDVQHSFFQMLH
                     QGTDIVPMDLIGFSESQLKQDSTLEGTSNNDKLKANLIAQIIAFSYGKKDTNKNKNFE
                     GERPSALIYSKELTPYTVGAILSHYENKVMFEGFLLNINSFDQEGVQLGKVIATKILK
                     DNNLKDEIIKSYDRLLQE"
     gene            complement(775684..776088)
                     /locus_tag="BT0_RS03670"
                     /old_locus_tag="BT0731"
     CDS             complement(775684..776088)
                     /locus_tag="BT0_RS03670"
                     /old_locus_tag="BT0731"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772665.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_011772665.1"
                     /db_xref="GI:500096658"
                     /translation="MLIDLEQIKIKKRIRQNIGDTSTLKESIKKHGLIYPIIIDKNKN
                     LVAGFRRYQVLKELGYKEVDVKVIPTEDKKILLEIELDENNARKSFTKSESESGEEQL
                     KYYSEKNIIIRFLKFIILKIKKILKRKKQNKT"
     gene            complement(776094..778853)
                     /locus_tag="BT0_RS03675"
                     /old_locus_tag="BT0732"
     CDS             complement(776094..778853)
                     /locus_tag="BT0_RS03675"
                     /old_locus_tag="BT0732"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772666.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="penicillin-binding protein"
                     /protein_id="WP_041178525.1"
                     /db_xref="GI:752506660"
                     /translation="MKNLNFSKKANLLIYITYFTISFSIILLSIAIVETVNIQRDKNF
                     GDVNPAIPSKLFDTNGRIITQFISDENRELLSLREIPNNLISTLLIREDLSFFFHRGF
                     SLMGILRAAFNIAIGRYFSGGSTLTQQLAKLLYTNQARRSILRKLNEIWWAIQLEKKL
                     SKYEILEKYLNKVYFGNGNYGVVAASKFFFNKSVKDINTAEAVLMIIQLPNAKLYSPF
                     YNPEFAKKIQKAVLHQVVSNGIISTELAEREFNEYWKNYDWTRMADTSAISDKEDHAP
                     YFSEYIRQRIIKHLPSGANIYKDGYSIYTTLDLDAQKYADEITQEMIIKTRKMYNSTK
                     SSETLVINSEIVPIIDTISDLFGIRSTRVNGRQYKKLRTRKFYEDNIDLIASFAAILG
                     IDKIDKATKEYTINNKTNPNFIVQPEGAFIALDTTTGAIKAMVGGSGYRKGSEFNRAT
                     QAKIQPGSAFKALYFSAAIDLKKITAATMFSDSPVAFFNQEGEVYAPENYGGKWRGNV
                     LTRKVLALSLNIPSLRILDTLGFENAIKYSAKLLGIKDQNEINKTFPKVYPLALGVIS
                     TSPIQMARAFAILGNNGKEVEPYGIKYIEDRNGKVIANVESETLTAIKNKGANAQIVS
                     PQTAYIMTDMMKSTIQYGTLANQRHTNLKDFKSDIAGKSGTTQNWADGWAIGYSPYIT
                     TALWVGFDKKGYSLGIAGTGTGLAGPSWGKFMAEYHKNLPRKVFIRPKGIINVQVQSE
                     TGLLPEGVPNETTINEIFIAGTQPFEKSKYYENKSEFLNKMEFNVYGIDKIDDNNELN
                     IEVNEFEYLIDDFNPLNKIDNKTELENDINETNNSSLDNSLENEHNQENVNHDIPDIN
                     LDNNINNTKTNDNDDNINIDDTNIDKKDKGNNEESKANPLIDENEQIDENGHKDVNGE
                     NIQLD"
     gene            779268..780053
                     /locus_tag="BT0_RS03680"
                     /old_locus_tag="BT0733"
     CDS             779268..780053
                     /locus_tag="BT0_RS03680"
                     /old_locus_tag="BT0733"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012422481.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772667.1"
                     /db_xref="GI:500096660"
                     /translation="MFLSRKIKDYEAKYRGKEIKMSTEINSFLNIKNSVEIRVGNYLA
                     YGVIYSISMNAIKIILQEDKVLPVLAQNGNSGNIQFKSFDNVGDDSFFIPSLVVKLVN
                     TSSCSVQEKEYNLLTLDFLSPMPEEVAVKIGKLLDLKLGQNQRIHERIIIDKDSLRKL
                     NLSSDKAFIEVKGVKHKCLIKDLSYGGALLISSFDYEGMDESNADLTLSFDIADKGVS
                     IVGKAKNLSVIQTPNGKVLALGIAFCEEKIPLDYTMLIHDYFN"
     gene            780037..781155
                     /locus_tag="BT0_RS03685"
                     /old_locus_tag="BT0733A"
     CDS             780037..781155
                     /locus_tag="BT0_RS03685"
                     /old_locus_tag="BT0733A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772668.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772668.1"
                     /db_xref="GI:500096661"
                     /translation="MIILIRGFMLKNIVYISLPEDFTSQIKDFIFDPKVLLPVEVDDV
                     KHFSQDELNFEAVMSAILKISAYDQDNVNFSYYKKLLLALNPNIVNTLIHVGLTKVDE
                     GDYNLALEIFLALKGIDNENEVLLFNLALLYEKMAENFLRVDQNMNAMTSNQNALEIY
                     EKLLEFESPNENVFANAGFFFVKQYKLDRAQELLKHYLKISNNLRLKNKVSDVLNAIG
                     VHKSLALNLERIYDLIILSKEDEAISKLVKLLEYHQDSWNAWFLLGWGYRRKGFYSEA
                     KDAFLKVLSLDSKNVDAMNELAICFMELLKFDDGLKYLLRALKLEPDNIKIVSNLGIL
                     YLKMERRKEAREYFEIVLEYDSSDPLALKYLGLLSSEF"
     gene            complement(781173..782174)
                     /locus_tag="BT0_RS03690"
                     /old_locus_tag="BT0734"
     CDS             complement(781173..782174)
                     /locus_tag="BT0_RS03690"
                     /old_locus_tag="BT0734"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation factor Sua5"
                     /protein_id="WP_025375716.1"
                     /db_xref="GI:644922385"
                     /translation="MKTEIIEQLEIKKAAKLIRAGELVVFPTETVYGIGANAYNDDAI
                     RMIFLVKRRPITNPLIVHVESIEKIKELVEYIPKSALILMQKFTPGPLTFILKNAGKI
                     SNFISGGLDSIAVRIPSEPVALKLIKMSGVPIAAPSANLSRRPSATNFEMAIRELDGL
                     VKGIIKKNEESKIGIESTVIGFDSKGNISILRPGSITKEMIEKELKGKFRVEYSVGKE
                     MLSKSPGNLLEHYKPRIPVYLFKQKDNIRQYASRQDTKVLIMKATLNSYWFNKSWNMN
                     NICVFNTLEEYAKNIYKVFVESEKTYKQILAEFVDNSQLGYSINNRLKKASLNKFIP"
     gene            782316..783092
                     /locus_tag="BT0_RS03695"
                     /old_locus_tag="BT0735"
     CDS             782316..783092
                     /locus_tag="BT0_RS03695"
                     /old_locus_tag="BT0735"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772670.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="WP_041178585.1"
                     /db_xref="GI:752506720"
                     /translation="MVNLFNLMDIRFGFLFLFFAFTQLNSATVGLASWYGEAFHGKST
                     ANGEKFDMTALTAAHKELPFNTIVRVTNLLNNRTVVVRINDRGPFRKDRIIDLSKSAA
                     EKLDFLGIGVAPVKIEILEQLDENKVVTQEAKKTVNTEDFSKDDSVVSGSKLNSNADL
                     DKDHSEVAEKILDNSTKEPDFYIQVGSYKTKDYAQRAYRILQKVGLNVLVNSHGPFFT
                     VFIPTYADDIHKNVELIKSTGYRDILVRKTKIPGDSISMD"
     gene            complement(783082..785139)
                     /locus_tag="BT0_RS03700"
                     /old_locus_tag="BT0735A"
     CDS             complement(783082..785139)
                     /locus_tag="BT0_RS03700"
                     /old_locus_tag="BT0735A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent helicase"
                     /protein_id="WP_011772671.1"
                     /db_xref="GI:500096664"
                     /translation="MNLIEYIFKKAELNIKGFVKRNTQLKMIEKISKALENENFLVIE
                     APTGTGKSFAYLIAAIDFIQKTQEKIIISTASINLQEQLIKKDIESLEKIIPFKMKFG
                     IIKGMKNYLCLRRLKEFERNLLTYTFNKKNLQTLIYWSQNTQTGDKDELNFIDEQIWE
                     EVSASPETCSGITCPDDNKCFFKKARKQILECDIIITNHHLLLNDLYIKNEILTEKEN
                     YENGSEKNDDEINLILPNTKNIIIDEAHYLEEAARTLFSRSFSRIGIKKIFTKIDKII
                     KKQNINNKYKKNFETSTMRCFENIEYIIQTQKDFPSIYRVTNDTHKTNFYIRIKTHLQ
                     NVIYNLGNYKETITSLTQEIENKTAKIELNRLIKNIEYKESLIKILISENQYDNLCFW
                     IENKKNVLIFKISEIYLGPGLNKIMYKRVKRIIFTSATLMTNQSFSYFLNQTGLNLSD
                     QNIKIEKLPYSFPYRQRSILTVISDIEYPNKEEKFLNQSTQYIKELVMLNKGGTLILL
                     TSLKSLEYISKNIKDFLFTNDINLFIQGKLPKHELINSFKESQKKSVLIGIKNFWEGI
                     DIKGDKLTMVIIPKLPFQTPSDPILIAKNELATKSNKNFFTQETLPQAIMKFKQGFGR
                     LIRDPKDYGIIVCFDKRLVEKNYGTLFLQSLPNIKTYYSNFENIKHIIDTFFKKIDQN
                     TNP"
     gene            complement(785273..785467)
                     /locus_tag="BT0_RS03705"
     CDS             complement(785273..785467)
                     /locus_tag="BT0_RS03705"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041178526.1"
                     /db_xref="GI:752506661"
                     /translation="MNFKETNIPCKRIKKFSISTSDGFKNILKINKGIIILFYINFHY
                     YKNVQIAINNHINFMEKSLE"
     gene            785515..786510
                     /locus_tag="BT0_RS03710"
                     /old_locus_tag="BT0737"
     CDS             785515..786510
                     /locus_tag="BT0_RS03710"
                     /old_locus_tag="BT0737"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772672.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase"
                     /protein_id="WP_011772672.1"
                     /db_xref="GI:500096665"
                     /translation="MNFLSNMSRPIMILAPMEDVTDTVFRNLIHLIGNGKDGPDIYFT
                     EFISVKGLLNKSKQSMQHILTKNDELNRPLIAQIWGNEPDEFFKAIEILSNLGFWGID
                     LNMGCPKKKIVKKGVCSALINNKSLAREIIMASKEACLKFGLSLSVKTRHGFFYSEVE
                     DWLGFLLKLGIDMLTVHPRLAINQSEGSIDISVFDKLVNLRDQINPSALIIGNGDILS
                     LEQAHQIVEKHSIDGVMFGRGIFRNLNLFRKGLPNFLSNNLNFRLNILKLHITDFHST
                     WSLTKDFNKLKKYFKIYFNEDERCSEYFHNIMNSSNYEELFKNLSRMDIIGDNLK"
     gene            786510..789134
                     /locus_tag="BT0_RS03715"
                     /old_locus_tag="BT0738"
     CDS             786510..789134
                     /locus_tag="BT0_RS03715"
                     /old_locus_tag="BT0738"
                     /EC_number="6.1.1.9"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="valyl-tRNA synthetase"
                     /protein_id="WP_011772673.1"
                     /db_xref="GI:500096666"
                     /translation="MSDELSKNYNPKVFEDRIYKKWLDNGVFIPNDGIEPKFSIVAPP
                     PNVTGILHMGHALNFTLQDILVRYKRMQGANTLWLFGTDHAGIATQAVFEKQLGELGK
                     SKDDFSREEFVEEIFKLKDKHREIIVNQIKRLGASYDHSRERFTLDAGLCQAVNKAFI
                     DLYNKGFIYKGEYLVNLDPGSGSVVSDEEVEYREVIGKIYFIKYLLDDGNFIEVATTR
                     PETMFGDMAVAVNPNDDRYKSLIGRDVTIPIANRKVKIIADSYVDMEFGSGALKITPA
                     HDPNDFEIAKRHDLAKINILTKDAKLNESVPIEYQGLSVSVARDKIERDLRDRGFLID
                     VKNHKHQVGHCHRSGEIIEPYLSNQWFVRMKPLADAALQALINDEIRFYPKKWENTYK
                     HWLLNIRDWCISRQLVWGHRIPAWYDVKTGEIIVSEFDPSLSEENKGRSFFRDPDVLD
                     TWFSSWLWPFSSLGWPKVTLDFKNYYPTNTLVTAYDIIFFWVARMVMAGLEFTGQVPF
                     KDIYITPLLRDKKGRKMSKSLGNGIDPLEIIDQYGSDALRFTLAFLSVQGQDLNIDTK
                     DFMFGAKFLNKVFNASKFILSNLEGRLILDNFELDDIDKWLLTSLNSTVAVIDWAFKN
                     YKYNEATKAVYEFFWNDFCDWYIEISKINLNSDDINLQNMTISKLIFFLKESLLIMHP
                     FIPFITEEIYSKLTSLQDVLALEKYPEYVSQRDFKEEYYRFNLLKEFIVSIRTLRSEF
                     SIVPNIKINVALRFGDTFKYERYFKEHEHIAKKLINFDCIFYNENYVGMIGVPNVNFE
                     SFADIKSLIDIDKELVKLGKQLEKYERLKHLVLAKLQNQDFLSNAPGEIIDLEKSKLE
                     EFDSFIAKINNYIHNLKK"
     gene            complement(789268..789945)
                     /locus_tag="BT0_RS03720"
                     /old_locus_tag="BT0740"
     CDS             complement(789268..789945)
                     /locus_tag="BT0_RS03720"
                     /old_locus_tag="BT0740"
                     /EC_number="2.1.1.-"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772674.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA (5-aminomethyl-2-thiouridylate)
                     methyltransferase"
                     /protein_id="WP_011772674.1"
                     /db_xref="GI:500096667"
                     /translation="MNKLIFKDKTIYSSKFEDIYYNPQYGLEESIYVFIKGCELDIDL
                     AALQSATIAELGFGTGLNFIALLKYLKENNLKTKINYYSIEKFPLKKEQIKKVSQSFS
                     KDISYFKTLLKKYPNTPTKNIKYKITNNINLKILVGEAREKLKELPKYIDYWFLDGFS
                     PSKNPKMWNKEIFTIIAKKSKIGAKLSTFSAARIVKDGLKLANFNYSRIKGFNNKKHM
                     IKAQKKQ"
     gene            complement(790161..790433)
                     /locus_tag="BT0_RS03725"
                     /old_locus_tag="BT0741"
     CDS             complement(790161..790433)
                     /locus_tag="BT0_RS03725"
                     /old_locus_tag="BT0741"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O51683.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_041178527.1"
                     /db_xref="GI:752506662"
                     /translation="MKNIKPLADRVLIKIKEAESKTISGLYIPENAKEKTNIGTVIAI
                     GSNKEDITVKVGDTVLYEKYAGAAVKIEDKEHLILKAKEIIAIIEE"
     gene            790577..792208
                     /locus_tag="BT0_RS03730"
                     /old_locus_tag="BT0742"
     CDS             790577..792208
                     /locus_tag="BT0_RS03730"
                     /old_locus_tag="BT0742"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772676.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heme ABC transporter ATP-binding protein"
                     /protein_id="WP_011772676.1"
                     /db_xref="GI:500096669"
                     /translation="MITVSNLEVAFGERILFKDVNIKFSSGNCYGIIGANGAGKSTFL
                     KVLGGTIEPSKGEVSIAKNQRMAVLEQNQFAYDDFRVIDTVIMGHKKLYAVQREKDEI
                     YEKPDFSDEDGIRAGELEAEFAELGGYEAESNAAVLLKGLGIDESVHSSLMRDIEGAL
                     KVRVLLAQALFGEPDILLLDEPTNNLDIQSIKWLEEFLINFENTVIVVSHDRHFLNQV
                     CTHIVDIDYGKVQVYFGNYDFWYETSQILNKQLKDAKKRSEEKIAELKTFIQRFSSNA
                     SKSRQATSRKKLIDKIKVEDLKPSSRKFPYVNFKSERELGKNVITIKNLTKEFEGQYI
                     LNKFSIVVEPGQKIVFLGSPISASFLFDVITNEDRDYKGHYEWGATVNFAYFKKDNEK
                     YFSVDLSLVDWLRKYSKDQDETYIRGFLGRMLFSQDEALKKVNILSGGEKVRCMLSKI
                     MLSGANVLLLDQPTNHLDLEAITSLNTGLRDFKGVVLFTSHDHQFIDTVANRIIEFTP
                     NGIIDRFMTFSEYIDDPKVKELRDKFYEGHASLKL"
     gene            792243..793916
                     /locus_tag="BT0_RS03735"
                     /old_locus_tag="BT0743"
     CDS             792243..793916
                     /locus_tag="BT0_RS03735"
                     /old_locus_tag="BT0743"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772677.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_041178586.1"
                     /db_xref="GI:752506721"
                     /translation="MKLNICIFIFLGACFSLAANVNLYFQKALTGQILGSPILDELRN
                     TITVLTKDRWLITYTMSLDKKYSYRLDRVPYPFLLKDFGSGYYVITGRNEVQKIRRGK
                     LIWRYSLDASPIKAPSMGNGYILIPQADKRVIALRLGDGQKIFEVNIEGKAVTSSVVL
                     ENGNFYIANENYRMFAFNPEGEKIWSASLMSFPNVLMISTNNEIIIGYQSGDVVVYDS
                     DFGDMLNSINLNYPINFLFEKFNGEYVAVSDNGFFFNLSKNFELMFSKNLSLKLKEAV
                     LYDNKNLFIVMKSNGVLALDEYFNPVDRYDGMKEISGLVANVGIIATGGLNWILTAYY
                     YEYKDELDVIVWNHTLGNRYHQNRIDFIEKYLIDHEDIYLALDEMLNSPYNRRVYDTF
                     LGTLDSLVIKYGSFPKKYLNLYKKAINNWLAPKNGIDRIAQRGRLYRYFIYVDDAASV
                     KNFINMAIEEKDISNVIQLVKSIAKFEYYYGQDELVYNYIQYVILNYQGSLEIAYAVL
                     LSLRKIILNSTEDNLKKYRNKYLTLLKFIKRQNFSDKINQCVNEIIVAL"
     gene            794047..796176
                     /locus_tag="BT0_RS03740"
                     /old_locus_tag="BT0744"
     CDS             794047..796176
                     /locus_tag="BT0_RS03740"
                     /old_locus_tag="BT0744"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011772678.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011772678.1"
                     /db_xref="GI:500096671"
                     /translation="MKRIRVLFIFLFIFLNVFTFHAREVDKKKLKDFVNMDLEFVNYR
                     GPYDSTDTYQQIIGIGEFLARNLINNKSNYYNKYYVNRYIDSEDEKSSSDVFIIGERS
                     SLDSILNLRKILIGYLMEGFSYSKESAELLAKAITIYNATYRGDLDYYSDSYIQPALK
                     DLSKHNVGLSRVYSQWAGKTHIFIPLKRNILSGNIESDVDLDKIVTEKVVISLLSENE
                     EVGTDFARDLTDVQDEIRDVDQEKIDIESVTLRSIDDELTETIDNLREQLEKATDDVE
                     KTGIKKQIDDKIVERNILKDKTEGLNKSQKKLDSSQERLDRQRDIVKDKIQESIDKEN
                     KDKNLPKPGDIISPKVDEKLQLTETIEDLKEQFDK