GenomeNet

Database: RefSeq
Entry: NC_011887
LinkDB: NC_011887
Original site: NC_011887 
LOCUS       NC_011887             458070 bp    DNA     circular CON 12-AUG-2015
DEFINITION  Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete
            sequence.
ACCESSION   NC_011887 NZ_ABIP01000000-NZ_ABIP01000162
VERSION     NC_011887.1  GI:220914669
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN00000043
            Assembly: GCF_000022085.1
KEYWORDS    RefSeq.
SOURCE      Methylobacterium nodulans ORS 2060
  ORGANISM  Methylobacterium nodulans ORS 2060
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Methylobacteriaceae; Methylobacterium.
REFERENCE   1  (bases 1 to 458070)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E.,
            Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T.,
            Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Ivanova,N., Marx,C.J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of plasmid2 of Methylobacterium nodulans ORS 2060
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 458070)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E.,
            Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T.,
            Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Ivanova,N., Marx,C.J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001351.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4003783
            Source DNA and bacteria available from Christopher J. Marx
            (cmarx@oeb.harvard.edu)
            Contacts: Christopher J. Marx (cmarx@oeb.harvard.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 08/12/2015 21:38:52
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 8,223
            CDS                                       7,797
            Pseudo Genes                           :: 331
            CRISPR Arrays                          :: 4
            rRNAs                                  :: 7, 7, 7 (5S, 16S, 23S)
            complete rRNAs                         :: 7, 7, 7 (5S, 16S, 23S)
            tRNAs                                  :: 72
            ncRNA                                  :: 2
            Frameshifted Genes                     :: 130
            Frameshifted Genes On Monomer Runs     :: 5
            Frameshifted Genes Not On Monomer Runs :: 0
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..458070
                     /organism="Methylobacterium nodulans ORS 2060"
                     /mol_type="genomic DNA"
                     /strain="ORS 2060"
                     /db_xref="taxon:460265"
                     /plasmid="pMNOD02"
     gene            37..2001
                     /locus_tag="MNOD_RS38500"
                     /old_locus_tag="Mnod_7772"
     CDS             37..2001
                     /locus_tag="MNOD_RS38500"
                     /old_locus_tag="Mnod_7772"
                     /EC_number="6.3.5.4"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631017.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="WP_012631017.1"
                     /db_xref="GI:501739530"
                     /translation="MCGFLAVFHGGPRPLAPSTILAGLSAIRHRGPDERDIWLDPEAG
                     VALGHTRLSIIGLSNGRQPIASQDGALQLIVNGEFYDFERIRAELQARGCVFRTQSDS
                     EIALHLYREFGTAGLGRLRGEFALVLYDAVERQLVVMRDRFGIKPLFVAEHDGALWVG
                     SEIKALVAAGVPAFWDLDAYVSRGFYLGNRTLFQGIRSLAPGHLLIASPGHIRERAYW
                     DLDFPAAAALDSAAIDEAEAVEGLRAEILEAVGLRLRADVPIAVYLSGGIDSSAMLGC
                     ATRLRGTPLDAFTLSFTDDGDYDERRFAAEAASFNGARFHPIPVTQDDLADDFEEALW
                     HNEVPFFNAHGVAKYRLSRVVAQARFKVVITGEGADEIFAGYPHFRRDMLLYNAERQD
                     PGLVADLRARLARSEGGYGGTTLPADAAWMTDRLGHGVSWVGNQSAWFDALRALYDGP
                     TRRRSAGIGAYRRFYNGLDHARMAGRDPLHRSMYLWAKSFLPNFVLTTLGDRMEMANS
                     IEGRVPLLDHHVAEYAARLPVWLKIRGATEKHVFREAMRPFLPEALYRRKKHYFRAPP
                     AMSAQRNRLAQLVADTLASRHLEDLPFFDARAVRKAHAEAAALPPERQALLDPMFTEI
                     TSLCLMQRRFGLATHPATLSPEASVREAAA"
     gene            1998..3122
                     /locus_tag="MNOD_RS38505"
                     /old_locus_tag="Mnod_7773"
     CDS             1998..3122
                     /locus_tag="MNOD_RS38505"
                     /old_locus_tag="Mnod_7773"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="WP_012631018.1"
                     /db_xref="GI:501739531"
                     /translation="MKIGIVGAGLNGLAFALLLKRFGLKAEIFERGDGPRDAGSGIYL
                     WPQGVQVLRFMIGDDRVLAAGQPIEYLDTHDRGGRLIHRQPVRLEGFEFPAPAVMFHR
                     TRLFRLLREALDADAVAYNSACTGIEQDADGVTAHFADGRSRRFDLLVGADGVFSGVR
                     GCIAPEAVATDTGVAACRGIVTFSDPALHGDRCQIFSYDGARVVTYPLDVRQGLRYWF
                     YAYRHGGRPLLGKAAIMAQVSGLAEPLPAMIAATGPDAMISNRLHRVDGLDAWHRGRV
                     VLLGDSAHAMLPTLGYGFTLGLENGFALAQALLCNCDATLESGLRRFDRRVRLRSREM
                     VAVMSDLTDLFYFQKEGAVTRDSLQAHMARFRTLAETTLF"
     gene            3122..4210
                     /locus_tag="MNOD_RS38510"
                     /old_locus_tag="Mnod_7774"
     CDS             3122..4210
                     /locus_tag="MNOD_RS38510"
                     /old_locus_tag="Mnod_7774"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_012631019.1"
                     /db_xref="GI:501739532"
                     /translation="MSDDAYRHAVRAFVAARIAPAIEEWERAGAYPASLHAEAGAAGL
                     LAFGEPPGPAPVEHPARRRILIEEITRGGSQGLTMGLASHGVSLAILAQADPDWAGPV
                     IRTVQSGERTIALALTEPQAGSDLAALRARAEPVADGWTITGEKRFICNGTRADCLVV
                     GAVTEAGLGLFLVERPQPGLTAEPLAAAGWRCLPLAALRFAGVPARLVVAPDRAARVL
                     QRALAQERLNLAVMALASAECVRDAALHHARTRMVRGASLDAMSHIRQRLAEIATRIA
                     LARCFVDSTAATAEASRIAMAKNAAVAALEEAARTAVQILGAAGCVAPSVVERTQRDA
                     PLIAIGGGTTEVMNEIIARSLAKETPAP"
     gene            4207..4665
                     /locus_tag="MNOD_RS38515"
                     /old_locus_tag="Mnod_7775"
     CDS             4207..4665
                     /locus_tag="MNOD_RS38515"
                     /old_locus_tag="Mnod_7775"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase"
                     /protein_id="WP_012631020.1"
                     /db_xref="GI:501739533"
                     /translation="MTTIPDHALRHSRALLDHVFQRQCGLTLVEQEPGRCLCRLTVTP
                     AIDNLSHCLHGGVTYAMLDVTSMLATLPLLGPDEYAVSTSMAVSILTAVPRNTEAEFE
                     SQVVRAGRTMIFTSCRAVRIGQDGRRTVFATGQITKARLRQDIRALTRAA"
     gene            4956..5936
                     /locus_tag="MNOD_RS38520"
                     /old_locus_tag="Mnod_7776"
     CDS             4956..5936
                     /locus_tag="MNOD_RS38520"
                     /old_locus_tag="Mnod_7776"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018485826.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631021.1"
                     /db_xref="GI:501739534"
                     /translation="MQGKEVSKQETAGKSSVGIDVSKSWLDVHVLPSGQAQRFANTEV
                     GIRQLKRWLGRFALGLVVVEATGKWHRQTRRSLHASGLPVAVVDPFRVRMFAKAQGIW
                     AKTDRLDARVLAQFAAVMAPPQRPPASDALEALQELVAARDSAVAEQTALKNQLAAAA
                     SPFLIRQFQDRLARIAADIEALAGEIRRLIAADPGLARRHAILVSIPSIGDTIAATLV
                     ASLAELGTCSSRQIGLLAGLAPVADDSGARQGVRVIWGGRPPVRRVLYLAALSAARHN
                     AGLKAFHERLIANGKKPKCAIIAVARKLAVLANSLIAQDRLWTPNQPQQA"
     gene            complement(6128..7060)
                     /locus_tag="MNOD_RS38525"
                     /old_locus_tag="Mnod_7777"
     CDS             complement(6128..7060)
                     /locus_tag="MNOD_RS38525"
                     /old_locus_tag="Mnod_7777"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001276152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="WP_012631022.1"
                     /db_xref="GI:501739535"
                     /translation="MTKITLEQWRMFVATAQQGSFLQAAEKLGKTQSAISHAIRKMEE
                     TLGQELFAIEGRRARLTTVGEMIYPRARELIGHAAQIERLCVSFDPEAEGEISIAVDV
                     IFPMQLLHRALEEYEKLYPHFSVRVWETTLSGASEILEDGRAVIGIAGQLPPGTVMEP
                     LLKVSFLCVAVADHPLHREGDLTHAMLKEHRQIVLSDSGRRNLSSGWLGARKRWTVGH
                     LATSVALVRAGQGYAWLPEHSIGADIAAGTIRPLRLHSGGRRTVQLHLGYTEIGQNLR
                     QALDLLGVFRDTVADHAPLATQAGFDVPPAAVAG"
     gene            7278..7925
                     /locus_tag="MNOD_RS38530"
                     /old_locus_tag="Mnod_7778"
     CDS             7278..7925
                     /locus_tag="MNOD_RS38530"
                     /old_locus_tag="Mnod_7778"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631023.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="WP_012631023.1"
                     /db_xref="GI:501739536"
                     /translation="MDRIRIEFFHDVVCGWCFVLSPRLKRIAADLPVDIEHRCFVLQD
                     SPAEMERVFGSLPRAKEVILGHWVQCAAADDIPGRINIEGMRRQSFAYPSGLAGTLAC
                     KSAERQGGSTAHGALFDRIQAAHLTENRNIADPRVLTDCAAAVGLDMARFEADMADPA
                     TRELVEQDRARARALAIRSIPSLVIGQRVISSTLPYHELRRRILACAASTPSVAC"
     gene            8556..8867
                     /locus_tag="MNOD_RS42190"
     CDS             8556..8867
                     /locus_tag="MNOD_RS42190"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783613.1"
                     /db_xref="GI:915398228"
                     /translation="MRHDGYEWRWTAAKSSAPPLVRETTPGKLPPFVESLLPEGWLAQ
                     VLKAPDAREVLKRGTRYMSNIAVVTDPKEIARLPADVLTAPLSQLSKLGRLEGEYTGP
                     A"
     gene            8898..9125
                     /locus_tag="MNOD_RS42195"
     CDS             8898..9125
                     /locus_tag="MNOD_RS42195"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783614.1"
                     /db_xref="GI:915398229"
                     /translation="MADIFARAETPRLSGVQIKAPMSLSIDGHLVPAVDTPFTHILKP
                     AGTAGFEHLPLVEWFCIELGRATGFEVPAWP"
     gene            9409..10266
                     /locus_tag="MNOD_RS38545"
                     /old_locus_tag="Mnod_7781"
     CDS             9409..10266
                     /locus_tag="MNOD_RS38545"
                     /old_locus_tag="Mnod_7781"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631024.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="WP_012631024.1"
                     /db_xref="GI:501739537"
                     /translation="MTQDASGKLTIRVMKRHDLGLAIDWAAAEGWNPGLKDADCFKAV
                     DPTGFLVGCLGDEPIASISVVRYSSTFGFLGFYIVRPDQRGRGFGYRLWRAGIAYLED
                     RTVGLDGVVAQQDNYARSGFVLAHRNVRFGGSPQVEAPHDERLKLVGPDLIEAVLAYD
                     RPFFAAPRETFLRCWLKPDTRTAVAFVEDGTVKGYGVIRACRSGYKIGPLFADSERGA
                     DLLFQALASQAKGSLVFLDLPEPNQAAVQLAASYGLSPVFETARMYRGERPDLPLART
                     YGISTFELG"
     gene            complement(11380..12660)
                     /locus_tag="MNOD_RS38550"
                     /old_locus_tag="Mnod_7783"
     CDS             complement(11380..12660)
                     /locus_tag="MNOD_RS38550"
                     /old_locus_tag="Mnod_7783"
                     /EC_number="4.2.1.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631026.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="WP_012631026.1"
                     /db_xref="GI:501739539"
                     /translation="MTCTRLRRLHARQILDSRGRPTVEAEISLDNGIQVRASVPSGAS
                     TGKAEAVELRDGGEAWGGLGVSRAVSNIRGEIAALLEGCDVLDQVGLDNRIREADGTH
                     NLARFGANATLAVSIAAVRASAVATGIPLHRRLAELCGTTPSMPMPMVNILSGGLHAG
                     RGMDVQDFLVIPIGASSYSEALDWICRVRTAAASICAKRGISTLLADEGGLSPGFATS
                     EEALSLMVEAFEQAGLEPGVQAAIALDVASSSLASANGAYAFARQGRSFGAREMIELQ
                     RQWAASFPIVSIEDGLGEDDWANWPALTRALGHLQLVGDDLFATQPDRIRRGIDENIA
                     NAALIKVNQNGTLSGTLEAITTARAAGYATVISARSGETEDDFLADLAVGVAGRQIKV
                     GSVRNSERLAKYNQLLRLEEEGLAWSGRTGLAPL"
     gene            13626..14294
                     /locus_tag="MNOD_RS38555"
                     /old_locus_tag="Mnod_7784"
     CDS             13626..14294
                     /locus_tag="MNOD_RS38555"
                     /old_locus_tag="Mnod_7784"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiaminase II"
                     /protein_id="WP_043753889.1"
                     /db_xref="GI:760071079"
                     /translation="MSPLFSTDAWTRNALLYEAARTLPFNRALADGTLPMPAFRHYMI
                     QDAHYLVGFAQALALAAAKSDQPGYVVQFAAAAAAAIEVERTLHTDFFSRFGVSTEEV
                     AATPPTPAAHHYICFLLASGFREPLAVHLAAMLPCFWMYREIGRDIHARASLDNPYRA
                     WIDTYAGEEFSRAVDAMIEVTDVVWAEAGAKERAAMHAAFTRAAQLEWMFWDSAYRDA
                     TWPV"
     gene            complement(14524..14787)
                     /locus_tag="MNOD_RS38560"
                     /pseudo
     CDS             complement(14524..14787)
                     /locus_tag="MNOD_RS38560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020096520.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_except=(pos:complement(14674..14676),aa:OTHER)
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(15055..15381)
                     /locus_tag="MNOD_RS38565"
                     /old_locus_tag="Mnod_7787"
     CDS             complement(15055..15381)
                     /locus_tag="MNOD_RS38565"
                     /old_locus_tag="Mnod_7787"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631030.1"
                     /db_xref="GI:501739543"
                     /translation="MTKHTPPFSAEVRERAVRMVLEYQGEHGSQDAAIRSIAAKIGCS
                     GEALRNWVRQAERDQGLRAGPTTGERARITALERENRELRQANEILRKASASCAMAEL
                     DRRSRP"
     gene            complement(15481..16524)
                     /locus_tag="MNOD_RS38570"
                     /old_locus_tag="Mnod_7788"
     CDS             complement(15481..16524)
                     /locus_tag="MNOD_RS38570"
                     /old_locus_tag="Mnod_7788"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein RepB"
                     /protein_id="WP_012631031.1"
                     /db_xref="GI:501739544"
                     /translation="MKRRDAIKNLYTAPPEPEKLAVANTRAVVENPPERVLAGPVRTM
                     GLALGRLEEESRALQDALASGASVVELEPEHIESSFVRDRLEDSGTGYEEFRRSIAER
                     GQEVPILVRPHPDKAGRYQVAYGHRRLRAVAELGRRVRALVRTMSDAELVVAQGIENS
                     ARQDLTYIEKALFARRLEDRGFERTVIMDALSTDKGELSKLISVARAIPEELVQTIGP
                     APKAGRRRWLALAELLSDAACAASALRMARDPDLAGLDSDTRFVRVLGAAAPRPAARE
                     RPTAWQSDGGVTRARISRAGSTVTLAIERDPAFGEFIASRLDDLYAAYRRDTDSSSAS
                     SGPGRDGSGVREN"
     gene            complement(16521..17723)
                     /locus_tag="MNOD_RS38575"
                     /old_locus_tag="Mnod_7789"
     CDS             complement(16521..17723)
                     /locus_tag="MNOD_RS38575"
                     /old_locus_tag="Mnod_7789"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_043754115.1"
                     /db_xref="GI:760071308"
                     /translation="MRTKPGPTSDDRVSAHARLLSSQLQGLRERLFPPESQKVLRKFT
                     SGEAARLIGVSDSYLRQLSLDGQGPVPEMLPNGRRLYTLRQINELRRFIAETRPKEAR
                     AVLPLRREGERLQTLACVNFKGGSAKTTTTLYLAQWLALQGYRVLALDLDPQASLSAM
                     FGVQPEFDLRWGDTLYGAIRYDDKRRSLREIIRPTNFDGLDLVPGNLELMEFEHETPR
                     ELSAGRVSSGGLFFQRVGAALAEVQDAYDLVVIDCPPQLGYLTLGAVCAATSLLITIH
                     PQMVDVASMSQFLLMTSDLMSVVRKAGGDLSHDFIRYVVTRHEPHDGPQSQIVALLRN
                     LFGDEVLAASVWKSTAIADAGLTKQSLYELERNSVGRATYDRAIESLEAVHREILGLV
                     HQAWGRAA"
     gene            18479..19450
                     /locus_tag="MNOD_RS38580"
                     /old_locus_tag="Mnod_7791"
     CDS             18479..19450
                     /locus_tag="MNOD_RS38580"
                     /old_locus_tag="Mnod_7791"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631033.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012631033.1"
                     /db_xref="GI:501739546"
                     /translation="MLAIHPNARTTPAVRAEIARSPEPSGVLAQRFGVSTETIRKWRK
                     RGPADCQDRSARPHKLPWKASAAERAVVCALRRATGFPLDDLTFIVSHFLPHLNRDAV
                     YRILKAAGLNRLTPADRTRKPHSAFKEDEVGFVHLDVTPLPKLQDRDGVTRKRSLYVA
                     IDRASRFVHLAVKDDEMAASAIAFLEEALAALPFRVTQVLTDRGSCFTADEFETACRR
                     HGVEHRTTRPYTPRTNSMVERFNDRVQREVLSITLYSHQDLETLLAGFTAAYNGRRQR
                     VLKDRSPDLVLRERLRAKPELAKPVTKPPDPEALPKALQMVAAAKEV"
     repeat_region   19462..20935
     gene            complement(19541..20875)
                     /locus_tag="MNOD_RS38585"
                     /old_locus_tag="Mnod_7792"
     CDS             complement(19541..20875)
                     /locus_tag="MNOD_RS38585"
                     /old_locus_tag="Mnod_7792"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631034.1"
                     /db_xref="GI:501739547"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     gene            complement(21088..21408)
                     /locus_tag="MNOD_RS42200"
                     /old_locus_tag="Mnod_7793"
     CDS             complement(21088..21408)
                     /locus_tag="MNOD_RS42200"
                     /old_locus_tag="Mnod_7793"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011084950.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_050783615.1"
                     /db_xref="GI:915398230"
                     /translation="MHAENLIKLHKTQLASDRTSCQSATANPMRLVLHTAARWLILAM
                     REAVPKTHPRASAEFATIWLRLLKLGARIRESASRVRLAFAAACPEAGLLRHPAGVLG
                     PAPT"
     gene            complement(21390..22037)
                     /locus_tag="MNOD_RS42205"
                     /old_locus_tag="Mnod_7794"
     CDS             complement(21390..22037)
                     /locus_tag="MNOD_RS42205"
                     /old_locus_tag="Mnod_7794"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012452059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783616.1"
                     /db_xref="GI:915398231"
                     /translation="MRGRKLTAAFDGGRLPSDGGVLLLAQATRRLGIADRLAAVIPDW
                     RDPHRIRHPLTEILLARILASACSHENADDLDHLCTGAVFKLACARLPESGPDLMSQP
                     TVSHLENTPCLRDLIRLGRVLVDFFCVSSPEPPTAITLDIDDTLDVVHGHQQLSLFNA
                     HHDERCFLPIHVYDPVTGRAVAVILRPGKTPSGREVRGHLRRLVRAIRRHCTPRT"
     gene            22479..22688
                     /locus_tag="MNOD_RS38595"
                     /old_locus_tag="Mnod_7796"
     CDS             22479..22688
                     /locus_tag="MNOD_RS38595"
                     /old_locus_tag="Mnod_7796"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631036.1"
                     /db_xref="GI:501739549"
                     /translation="MHRLLGTSGDKTSRHAYRQRWTVETVMPIAKRCWGEALSARTEA
                     TLHLQALLKGPVYNVHRLVRLGIYA"
     gene            complement(22867..24117)
                     /locus_tag="MNOD_RS38600"
                     /old_locus_tag="Mnod_7797"
     CDS             complement(22867..24117)
                     /locus_tag="MNOD_RS38600"
                     /old_locus_tag="Mnod_7797"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018746218.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631037.1"
                     /db_xref="GI:501739550"
                     /translation="MPRRSKPTGPSTSTALTRGASATEPSKPTPIEQPIQFDFLAQQD
                     ERVTKILRFWDHVPWAVLYKHDVMRSGAYLKMVTRAFDVGGRLHQLQMTPARLVRDGQ
                     ELDDYPGDREQLIELAIRRLAAMKREFRLHRKNASNVIGSKVVEVVALNLGIYEIQNE
                     LKRNGHEYNYTQILESIDILNKTHCSITAYDTDQDGDGVAHVMNGPIFTQVYFTRNDK
                     EEKNAAMRVTIHVNSLVADAIRGLDFYDVSYEALMKLKPVSRWIFKRLHHAMVFPTSN
                     EDPRIQTIRASTILAYSGMGEYARLRDALKQIMIYLDDLKRNGIIEEIMAEDEWEGSG
                     RSKRKADVSYTIRMSEEFYRQSIQAQQSRIEALTDFRDITGQATPEVWTPATPTARLE
                     VAKRRTSRRTKGTSDLPLFGSVQD"
     gene            24962..26095
                     /locus_tag="MNOD_RS38605"
                     /old_locus_tag="Mnod_7798"
     CDS             24962..26095
                     /locus_tag="MNOD_RS38605"
                     /old_locus_tag="Mnod_7798"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631038.1"
                     /db_xref="GI:501739551"
                     /translation="MPRISALLCLACHGKPEEQWTQIAYAGLLAEPPQWSESDVAAFE
                     ALTPRQRSDLVVGHMTDIPTVRVEPAQERRKRRQRDNRLRQRRHLAGFRYVRRHALDP
                     FLDARLSAGARTTLIYLIARCGRGQAFTKRTCLVATDLGIAQRTVQAHYAALEGAGYI
                     ARSAPDPQTGATTIVLTHLVEPPMPRKKQAGTDTRSQEGRAQEFAPTQAIKDSKTREN
                     EVSDASSVSVARGSQKTGAALVEAAQPPSSVLGDNPLVGSVGQTREMLRPDIAREVQS
                     ARAVRPADTEELTPFDRAMNEILLRVAAHRSKTSEGIVTRSDGTPAQAAVGQGACSPS
                     RTPATNSHPRSSNTPSGQACHVERNFLSLLAPRTIVVRVFPTT"
     gene            complement(26479..28136)
                     /locus_tag="MNOD_RS38610"
                     /pseudo
     CDS             complement(26479..28136)
                     /locus_tag="MNOD_RS38610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015928007.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
     gene            complement(28902..29807)
                     /locus_tag="MNOD_RS38615"
                     /old_locus_tag="Mnod_7800"
     CDS             complement(28902..29807)
                     /locus_tag="MNOD_RS38615"
                     /old_locus_tag="Mnod_7800"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="myo-inosose-2 dehydratase"
                     /protein_id="WP_012631039.1"
                     /db_xref="GI:501739552"
                     /translation="MILYGTNPIAWSNDDDQSIGAHLTLDDCLSDCRKIGFDGIEKGH
                     KMPDDGMALKARLAEYGLRYAAGWHSTNLLVNDIDTEKTALARFIEMTKAAGGDHINA
                     CECSNTVHGNAAVPVNDRPIMTDPQWERFSAGYEELSRFAADRGVKMGYHHHMGTIIE
                     SGADIDRFMAMAGPHTHLLLDTGHCTFGGADPAAVAEKYMNRVTHIHCKNIRPEIMRQ
                     VREENLSFLEGVRRGVFTVPGDPEGCVDFAPVLRIAAEQGYSGWLVIEAEQDSLMREP
                     FFYQNMGLAALRNMAGAAGLDKVAA"
     gene            complement(30107..30919)
                     /locus_tag="MNOD_RS38620"
                     /old_locus_tag="Mnod_7801"
     CDS             complement(30107..30919)
                     /locus_tag="MNOD_RS38620"
                     /old_locus_tag="Mnod_7801"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-deoxyglucuronate isomerase"
                     /protein_id="WP_043753892.1"
                     /db_xref="GI:760071082"
                     /translation="MANLLRRPFGAHGKVHEITPHSAGWRYVGFSLYRLRPGETVGEA
                     TGAMEAILVMVEGKAAVTAAGNDWGELGDRMDVFEKTPPHCLYIPNGENWTAVAITDC
                     TIGVCLAPGQSGHAARRIGPEGITLTRRGQGSNTRFINNIAMEAEDYCDSLLVTEVFT
                     PAGHWSSYPSHRHDEDDYPRITYLEETYYHRLNPAQGFGIQRVYTDDGSLDETMAVHN
                     HDVVLVPRGHHPCAAAHGYEMYYLNVMAGPLRQWRFEPDPAHRWLLEGEAKT"
     gene            complement(31016..32854)
                     /locus_tag="MNOD_RS38625"
                     /old_locus_tag="Mnod_7802"
     CDS             complement(31016..32854)
                     /locus_tag="MNOD_RS38625"
                     /old_locus_tag="Mnod_7802"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631041.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyruvate decarboxylase"
                     /protein_id="WP_012631041.1"
                     /db_xref="GI:501739554"
                     /translation="MMTTVRLTAAQTMMRWLSVQMTEEGERFIEGVWAIFGHGNVAGI
                     GEALEKIGDALPTWRGQNEQTMAHAAIAYAKTKRRRKAMAVTSSIGPGATNMVTAAAL
                     AHVNRLPVLLIPGDVFANRRPDPVLQQIEDFDDGTVSANDCFRPVSRYFDRITRPEHL
                     LTALPRALQVMTDPAQCGPVTLAFCQDVQAEAYDWPEAFFAPKVWHIRRPEPDRRELA
                     AVIEMIRAAQKPVIVSGGGVLYSGADQDLAAFAEKHNIPVVETQAGKGALDWQHPLNF
                     GSPGVTGSDCANRICAEADLIIGAGTRFQDFTTGSWAAFRNPQRKLVSVNLTGYDAAK
                     HSAVPLVADAKIALTAITAGLEGHRFAGPDASLRTAWFKAADRVMAAPQGENPNDLPT
                     DAQVVGAVQRYAGADTVVMCAAGTMPGALQVLWRAAPGGYHMEYGYSCMGYEVAGAMG
                     IALAVPEKEVICFVGDGSYMMANSELATAAMMHVPFTIVLTDNRGYGCINRLQIECGG
                     APFNNMYVDSRHKTFPEIDFVAHARAMGAEAVKVAGIAGLEAELARPRDRKVPRVILI
                     DTEAESSLGVGGAWWDVAVPEVGTTEALRAARERYDSHAAFQRTFD"
     gene            complement(32851..34773)
                     /locus_tag="MNOD_RS38630"
                     /old_locus_tag="Mnod_7803"
     CDS             complement(32851..34773)
                     /locus_tag="MNOD_RS38630"
                     /old_locus_tag="Mnod_7803"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-dehydro-2-deoxygluconokinase"
                     /protein_id="WP_012631042.1"
                     /db_xref="GI:501739555"
                     /translation="MKTLDVITIGRSSVDLYGTQIGGRLEDMRSFQKYIGGSPTNIAA
                     GTARLGLKSALITRVGDEHMGRFIREELLKEGVDVRGVKTDPERLTALVLLGIRDQER
                     FPLIFYRSDCADMALCEDDIDESLIAQARSVVATGTHLSHPRTEAAVLKAFRLARTHG
                     ARTALDIDYRPNLWGLAGHDAGESRFIASKAVTAKLQSHLPLFDLIVGTEEEFHIAGG
                     DTNTLAALRAVRAVSSAVLVCKRGAAGAVAFTGEIPDSLDEGEMGPGFPIEVFNVLGA
                     GDGFMSGLIKGWLEEAPWPRALAYANACGAFAVSRHGCTPAYPSLTELEFFLERGVVT
                     PALRHDAALEQLHWSTNRHGDWSTMRVFAFDHRMQLEVMEGASPAKIGAFKELCLQAA
                     LEVQDGRPGYGILCDDRLGRDALQAAAGTGLWIGRPVEWPGSRPLTLEPELGPDYGGL
                     AEWPLDHVVKVLCFCHPDDTLEMRAQQEAVVTRLFHAARRQRLEFLLEIIPSKVGPVD
                     DRTTATLIRRFYEIGIYPDWWKLEPMASAVAWAEACAAIEEHDRHTRGIVVLGLDAPE
                     AELAESFRIAAGFSLVKGFAVGRTIFGQVARDWLAGRIGDEDAVAEMVRRYARLCAVW
                     DAGKGLASATAGREQA"
     gene            complement(34804..35703)
                     /locus_tag="MNOD_RS38635"
                     /old_locus_tag="Mnod_7804"
     CDS             complement(34804..35703)
                     /locus_tag="MNOD_RS38635"
                     /old_locus_tag="Mnod_7804"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein iolH"
                     /protein_id="WP_012631043.1"
                     /db_xref="GI:501739556"
                     /translation="MKYTLDPHMFRHLSLEETCRKTAELGYDSIELSPRPDFLAWWTR
                     PKVYPERIRSFKKALKDHGVGLATLQPMYRWASPYPDEWELAIDNWKRAIAIAVEMEC
                     PMFVSEFGRGGSPERSLNDRSGLHRPETCEGQFFRAMDILVPILEREGIVLSLEAHPE
                     HWVEEVAPAIDIIKTINSPMVKASFIAPHTFFYGPDMVANLRATAGYLAHVRLADTYD
                     HNKSSQLRYIVNPPGAKVRVHQHLDIGQGEIDWDLFFSTLADMKFDGVLSNCVFAWED
                     RAEDSARFMLAEMKRYVGTYWKA"
     gene            complement(35816..36739)
                     /locus_tag="MNOD_RS38640"
                     /old_locus_tag="Mnod_7805"
     CDS             complement(35816..36739)
                     /locus_tag="MNOD_RS38640"
                     /old_locus_tag="Mnod_7805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631044.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhizopine-binding protein"
                     /protein_id="WP_012631044.1"
                     /db_xref="GI:501739557"
                     /translation="MKRLLLAAALTACALPAYAGGRIGVSMTSLDNPFLTILLNGMKG
                     EAARTKGVELMLEDAQRDVSRQLSQVQNFVANRVDAIVVNAVDGDSTAAITRAAKAAG
                     IPLVYVNHPPAELGRGMPKGTAFVGSNELDSGTMQARAVCKMLAGKGRAVILMGPLEN
                     HSALVRTKDVVDVFRTPDCPIHILDKQTANWMRVEAQDLVASWLTAGMRFDAVIANSD
                     EMAIGAAQALKSAGVAMKDVVIAGIDATPDGLAAMATGDLDVTVFQNATRQGEVAVQT
                     AVAMAAGEKAEDAIWVPFELVTKDNLAEYRK"
     gene            complement(36821..37606)
                     /locus_tag="MNOD_RS38645"
                     /old_locus_tag="Mnod_7806"
     CDS             complement(36821..37606)
                     /locus_tag="MNOD_RS38645"
                     /old_locus_tag="Mnod_7806"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="WP_012631045.1"
                     /db_xref="GI:501739558"
                     /translation="MRFALNHILAPKLPLEEFFASARALGATEVEIRNDLPDVVGTVA
                     PEEVRTAAEKTGVSIISIKALYPFNVWTDDMAKRAAKLAAYAAACGAKALVMCPLNEG
                     KAVAFDVLVASLKAMKPILLDHRLTGLVEPLGFPVSSLRTKKEAIAAIRAADGADTYR
                     LVHDTFHHHLAGETEFFPEWTGLVHISGVTDPIVAVADMLDAHRVLVDGADRLENIPQ
                     IRRLIAAGYSGPFSFEPFATEVHELEDPKGAAKRSMDFVSASL"
     gene            complement(37616..38626)
                     /locus_tag="MNOD_RS38650"
                     /old_locus_tag="Mnod_7807"
     CDS             complement(37616..38626)
                     /locus_tag="MNOD_RS38650"
                     /old_locus_tag="Mnod_7807"
                     /EC_number="1.1.1.18"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inositol 2-dehydrogenase"
                     /protein_id="WP_012631046.1"
                     /db_xref="GI:501739559"
                     /translation="MTVRVGIIGTGAIGREHARRIEQVLSGGKVVALSDVNATSAEAV
                     RAEIARDARLFETGEALIASPDVDAVLVTSWGATHEQYVLAAIAAGKPCFCEKPLATT
                     AEGARRIVDAEVAHGKRLVQVGFMRRYDAGYIALKQAVKSHTGAPILVHAAHRNPAVP
                     EQYVTPMAIHDTLIHEIDVLRWLLDDDYVSARVLFPRKAARSHAKLRDPQVVVLETKK
                     GVLIDVEIFVNCHYGYDIQCEVVGEDGIARLPEPMAVEMRLDAKRQNAILTDWKDRFI
                     ASYDVELQDFLKAAAAGTASGPTSWDGYVAAITSDACVEAQERAGEAVAITLPARPSL
                     YN"
     gene            complement(38742..39776)
                     /locus_tag="MNOD_RS38655"
                     /old_locus_tag="Mnod_7808"
     CDS             complement(38742..39776)
                     /locus_tag="MNOD_RS38655"
                     /old_locus_tag="Mnod_7808"
                     /EC_number="3.6.3.17"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="WP_012631047.1"
                     /db_xref="GI:501739560"
                     /translation="MFVNNSSAEGVAVAAPVATRRRLPVEANILLILIGIALVFELLG
                     WVVVGQSFLMNPQRLTILILQVSVIGIIAIGVTQVIITGGIDLSSGSVVGLSAMVAAS
                     DAQSSAWTKVLYPSMTDLPVAVPILVGLAIGLLAGVINGMLIVYTKIPPFIATLGMMV
                     SARGLSKWYTKGQPVSGLTDEFSVIGSGIWPVVIFLSVAVIFHVLLRYTRYGKFTYAI
                     GANEQAARISGIEVDRHLIKVYGVAGLLGGLAGIVTAARAQTAQAGMGTMYELDAIAA
                     AVIGGASLSGGVGRITGTVIGTIILGTMTSGFTFLRVDAFYQEIIKGLIIIAAVAADV
                     YRQKKRVKKA"
     gene            complement(39802..41322)
                     /locus_tag="MNOD_RS38660"
                     /old_locus_tag="Mnod_7809"
     CDS             complement(39802..41322)
                     /locus_tag="MNOD_RS38660"
                     /old_locus_tag="Mnod_7809"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631048.1"
                     /note="with RbsBCD acts to import ribose into the cell;
                     RbsA contains 2 ATP-binding domain; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-ribose transporter ATP-binding protein"
                     /protein_id="WP_043753895.1"
                     /db_xref="GI:760071085"
                     /translation="MAAVRDSAAAPNSEYLLTIENARKEFPGVLALDNVQFKLRRGTV
                     HALMGENGAGKSTLMKIIAGIYQPDRGEIHLRGAPIELKSPLDALENGIAMIHQELNL
                     MPFMTVAENIWIRREPLNRLGLVDHAKMNEMTAELFRRLNINIHPQVQVRDLSVANRQ
                     MVEIAKAVSYESDVLIMDEPTSALTEREVEHLFEIIRELRAQGKGIIYITHKMNELFE
                     IADEFSVFRDGRYIATHPSSEVTRDDIIRMMVGREITQMFPKEEVPIGDVVLSVKNLS
                     LEGVFQDVSFDIRAGEIFGIAGLVGSGRSNVAETIFGVTPATSGTIEILGKPVNIGSP
                     STAIRHQMALLTEDRKETGCLLILDILENMQIAVLQQDFVRGGFVFEKTLTGACATMS
                     EKLKVKTPNLQERIENLSGGNQQKVLIGRWLLTKPKILILDEPTRGIDVGAKAEIHKL
                     LVELARNGVAIMMISSEMPEVLGMSDRIMVMHEGRMTGILDRAEADQLKIMELAAK"
     gene            complement(41423..42364)
                     /locus_tag="MNOD_RS38665"
                     /old_locus_tag="Mnod_7810"
     CDS             complement(41423..42364)
                     /locus_tag="MNOD_RS38665"
                     /old_locus_tag="Mnod_7810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631049.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="rhizopine-binding protein"
                     /protein_id="WP_012631049.1"
                     /db_xref="GI:501739562"
                     /translation="MKEILLVAVLMSSIASSALAENIGVSMSLFDDNLLTVMRNDMTN
                     YATTLNGVTLQIEDAQNDVAKQQSQVQNFIAAGVDAIIVNPVDTDATAAISKIASNAG
                     IPLVYVNRLPVNLGKLPPKQAFVGPDERESGTLQTKEICRLLKQAGKTKANIVVMMGE
                     LSNQAARQRTQDVHEVIATPECSFMKIVEEQTANWSRTQGADLMSNWLSAGVQFDAVV
                     SNNDEMAIGAIQAMKAARVDMKTMIVGGVDATQDALAAMAAGDLDVTVFQNVVGQGRG
                     ALDAALKLARGKKVEQKVFVPFELVTPANLQNYRAKN"
     gene            complement(42753..43781)
                     /locus_tag="MNOD_RS38670"
                     /old_locus_tag="Mnod_7811"
     CDS             complement(42753..43781)
                     /locus_tag="MNOD_RS38670"
                     /old_locus_tag="Mnod_7811"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631050.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="WP_012631050.1"
                     /db_xref="GI:501739563"
                     /translation="MRRPTIADLAEAAGVSVATVDRVLNGRYRVREETARRVLEAAHK
                     IGFYGANVIRARVLAEQPEYHLGFILQKERHAFYQTFARQIEEAVGAVPNKRLRATIR
                     FVQSAAPAELADLIRSMKGKVQAVAATGLDHHDATAAVAELRAVGVPTFSLLSDFAQG
                     VRESYIGTNNLRVGRSAAWLMSKMACRPGKIVIFIGGHRYHGHALRETGFRSYFREFA
                     PDFELLDSIVNIETRQLTCEATLGLLARHDDVVGIYVAGGGMEGAVAALREVRQPDDV
                     ACIVNELTPESTQGLLDRFVSIVMATPLPTLCSDLVAMMVHAIEHGMAEYPGQRFLPI
                     ELWTPESL"
     gene            44173..45126
                     /locus_tag="MNOD_RS38675"
                     /old_locus_tag="Mnod_7812"
     CDS             44173..45126
                     /locus_tag="MNOD_RS38675"
                     /old_locus_tag="Mnod_7812"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012631051.1"
                     /db_xref="GI:501739564"
                     /translation="MAAQSPRVRHLNWNLLRTFLVIVEERSITKAAERLHLRQPTVTA
                     SLQKLEETLGTQLILRDSRRFVLTSRGEALRKECVEIHQHVERIGERLSTDEDDLSGL
                     VRMLIVTEVMLPTLDRALGLMHRRHPSVTLSIDVANSQEIARAVAQRTVPFGLCLLPK
                     PLAALECRMLMREEFGIYCGRTHPLFERQDVTLEDLRAEPFVAFTCGQPGGALEPMVA
                     LRDGAGLGARTAGVSSHLGEVARMIAAGIGIGILPVTAAERMADKDLLWRLPVLEGQI
                     GADLYFLRNPEMALDRAEKAFLDLFLSLVPDPEGPAEPVWV"
     gene            complement(45385..46632)
                     /locus_tag="MNOD_RS38680"
                     /old_locus_tag="Mnod_7813"
     CDS             complement(45385..46632)
                     /locus_tag="MNOD_RS38680"
                     /old_locus_tag="Mnod_7813"
                     /EC_number="3.5.1.87"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate amidohydrolase"
                     /protein_id="WP_012631052.1"
                     /db_xref="GI:501739565"
                     /translation="MSRSSNIRPNISRLWSSLMRSAEIGATPRGGLRRLALTEEDGEV
                     RREFIRWCEEAGCVVRVDGIGNIFAFRAGQDPDAKAVLVGSHLDTQIKGGRFDGILGV
                     LAGLELVRTLNDHGVTTRRPIAVVNWTNEEGARFEPPMIGSAVFTGRASLDFAHGRAD
                     KDGITLGQALDAIGFRGTDRLSPEAFDSLFELHIEQGPHLDEAKRQVGVVTGAFSVRG
                     MVVEVVGETGHVGPTPMPKRRNAIVGAARVTLAVDDIGWSRHETGGKSTTMRLRVEPN
                     LLGILPDRVEMTCDFRHPDDAVATEMLASLKAQIPDIEQRSGCKVSIREQWSYGGMQY
                     DPGCVGLVREVAQALGYSTMDLLTEAGHDAMHAADHLPTAMIFTPCEGGLSHNEAENV
                     TPDDIEPGVNVLLQSVLRRAEVV"
     gene            46944..47990
                     /locus_tag="MNOD_RS38685"
                     /old_locus_tag="Mnod_7814"
     CDS             46944..47990
                     /locus_tag="MNOD_RS38685"
                     /old_locus_tag="Mnod_7814"
                     /EC_number="4.3.1.12"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631053.1"
                     /note="catalyzes the formation of L-proline from
                     L-ornithine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="WP_012631053.1"
                     /db_xref="GI:501739566"
                     /translation="MPNAGGGPESRYRADESLAAGPPLVLCAAEVAAALDREALIEAL
                     AAAFRGGCEAPRRHHHAIPIPGEPDATLLLMPAWSVGRHFGVKVAAVVPGNNARFLPA
                     VQSQYLLFCGRTGRLRAALDGNELTSRRTVAASSLAARFLALPGAGRLLIVGTGEIAR
                     HVAASHAALRPIRSVEVWGRSPAKAQAVAADLTRAGVNASPATDLAEACARADIITCC
                     TLSREPLVEGRWLRPGTHLDLIGGFTPAMREVDDGAVARATLFIDTPAALHEAGDLAI
                     PLARGIIAPTAVAGDLADLASGRHPGRTSVDEITLFKSVGASIEDLAAAILCVERHRA
                     RPASVFPTPVEARP"
     gene            47993..49321
                     /locus_tag="MNOD_RS38690"
                     /old_locus_tag="Mnod_7815"
     CDS             47993..49321
                     /locus_tag="MNOD_RS38690"
                     /old_locus_tag="Mnod_7815"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012631054.1"
                     /db_xref="GI:501739567"
                     /translation="MATTTTPSIVAEPPAVAEPHRMRRIAIASVIGTTVEWYDLFVFA
                     TASALVFNKVFFPSFDPLVGTLLAFGTFASAYLARIVGAALFGHFGDRLGRKSMLLFS
                     LVLMGVATFAIGLLPNYAAIGIWAPILLLSLRVVQGLALGGEWGGAVLMAVEHAPRHQ
                     RGLYGSWVQIGVPAGTLLANLVFLLINAVLPAEDMLAWGWRIPFLASILLVLVGGYIR
                     LNVSETPSFAKVKRASEQVKVPFAELMRKSWKTVVLGGVATMSTGSSFNLIVAFGLSY
                     GTQNLGFTRNTMLAIVLLSCAACVALLPFFGWLSDRWGRRPVIVGGILAEALVAFPLF
                     WLMDTKTFAGALAGYLLMMMAFAANYGPIATFLAELFGTRVRYSGLSIAYMLSGVLGS
                     AATPFVTTWLLAATGQGSSVAWYMIGSAVLSAGALMLLVETVRRDLTDAS"
     gene            49353..49994
                     /locus_tag="MNOD_RS38695"
                     /old_locus_tag="Mnod_7816"
     CDS             49353..49994
                     /locus_tag="MNOD_RS38695"
                     /old_locus_tag="Mnod_7816"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="demethylmenaquinone methyltransferase"
                     /protein_id="WP_012631055.1"
                     /db_xref="GI:501739568"
                     /translation="MTLDRTGTSEAMHRLAAVETATIGHVLSHGFMDPAIQGLGGEAR
                     ICGPAVTVALPPEGGAALAWAVSTARRGDVLVVDRQGDACHACWGAVMTEAALAVGLA
                     GIVIDGPVTDAAAIRASGLPVWCRGRSPLTIKRRPGGRVGGTIRCGGVTVRTGDLVLA
                     DENGVLVLDPERAFALAEEALTLQEGEPAFIARLRRGERLADLYGLTREDLDR"
     gene            49991..50380
                     /locus_tag="MNOD_RS38700"
                     /old_locus_tag="Mnod_7817"
     CDS             49991..50380
                     /locus_tag="MNOD_RS38700"
                     /old_locus_tag="Mnod_7817"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_012631056.1"
                     /db_xref="GI:501739569"
                     /translation="MREILEIPVISEAIRGLGAPTSALVRAGDLLFTCGMPPIDTRTG
                     RIVTGPIEAQTRASLDALRVTLDHAGSSLAKVVKATVYVTDPVLMGGVNTVYQEFFPD
                     GWPARTFAAIKPWPLPFDIEIECVACL"
     gene            51620..52456
                     /locus_tag="MNOD_RS38705"
                     /old_locus_tag="Mnod_7819"
     CDS             51620..52456
                     /locus_tag="MNOD_RS38705"
                     /old_locus_tag="Mnod_7819"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631057.1"
                     /db_xref="GI:501739570"
                     /translation="MTVRTYFASLGGLPPQTQLLTDRATFTEAYAVIPKGVYSDIVTS
                     YLPFWEKTRCWVIARPLSGFSETFSQYVMEVSPGGGSDKPELDVGAEGVLFVVDGELT
                     VTLGGKDNLLAPGGYAYIPPASDWQVRNQSGQKVRFHWIRKAYDYVAGIPAPDPIFAN
                     ELDIVPNPMPDTEGKWATTRFVDPSDMRHDMHVTIVTLQPGAVIPFAETHVMEHGLYV
                     LEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGNFRYLLYKDVNRHMKLGGEL
                     RR"
     gene            52453..52944
                     /locus_tag="MNOD_RS38710"
                     /old_locus_tag="Mnod_7820"
     CDS             52453..52944
                     /locus_tag="MNOD_RS38710"
                     /old_locus_tag="Mnod_7820"
                     /EC_number="3.5.3.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate hydrolase"
                     /protein_id="WP_012631058.1"
                     /db_xref="GI:501739571"
                     /translation="MNTIVAQPLTREAFSPYGEVIDTEGADHFPINNGRCERYHALAR
                     TDAIGPGARVIISIFKGAPYTLPLKLHMVERHPLGSQAFIPLSPRPFLVVVARDDGNR
                     PGRPQAFLTRPGQGVNYPPNVWHGVLTPIGEPQDFLVVDRAGDGNNLEEFFFPEPYEI
                     CLP"
     gene            53532..54347
                     /locus_tag="MNOD_RS42210"
                     /old_locus_tag="Mnod_7823"
     CDS             53532..54347
                     /locus_tag="MNOD_RS42210"
                     /old_locus_tag="Mnod_7823"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase C13, legumain asparaginyl peptidase"
                     /protein_id="WP_012631059.1"
                     /db_xref="GI:501739572"
                     /translation="MPSRSTYLILAVLAWWAAAEGPGPVLAGGGIAAPQQTSPSPQSR
                     QNSTETYIVSFGLFGGESVFESEARGAARILREWLRARPSPLVSFNSKWGGAATARTL
                     AAALRTAGAAMDPDNGTLVVVLTSHGTPEGLAIVAGTTSDTLTPPDLRRMLDASGAKY
                     RIVIISACYSGVFVPALADPRTLVITAAAADRPSFGCQDGARWTYFGDAFFNRSLRRA
                     PDLETAFEGARRLVTARERRDGFEPSRPQLAGGSEVLALLARHNRPARSGFVR"
     gene            54726..54974
                     /locus_tag="MNOD_RS38720"
                     /old_locus_tag="Mnod_7824"
     CDS             54726..54974
                     /locus_tag="MNOD_RS38720"
                     /old_locus_tag="Mnod_7824"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016920157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631060.1"
                     /db_xref="GI:501739573"
                     /translation="MTQAASELDFEAALRSPKSCFAEPQDVVAHPALSREMKLAILRE
                     WEQDARRLSASEGEGFYGGEESMLGRVEDAINLVRRQA"
     gene            complement(55099..55362)
                     /locus_tag="MNOD_RS38725"
                     /old_locus_tag="Mnod_7825"
     CDS             complement(55099..55362)
                     /locus_tag="MNOD_RS38725"
                     /old_locus_tag="Mnod_7825"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012290056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754126.1"
                     /db_xref="GI:760071319"
                     /translation="MLSAPSPAVLAWSCGLASLSPGQPPCPGFRPDEWGETLANCRRF
                     VDDFGIQAAELGWDTLTPFGVHPQHEIIRGDWSGVLMPCAYRV"
     gene            complement(55794..56318)
                     /locus_tag="MNOD_RS38730"
                     /old_locus_tag="Mnod_7826"
     CDS             complement(55794..56318)
                     /locus_tag="MNOD_RS38730"
                     /old_locus_tag="Mnod_7826"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631062.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="WP_012631062.1"
                     /db_xref="GI:501739575"
                     /translation="MNDKADVSTSQPGADTIELVAAIISAYVSNNIVPPADLPALIAT
                     AGQTLGELGKPSAPAAEETPKLTAAQIRKSVTPDHIISFIDGKPYKAMKRHLTKNGLT
                     PAEYRQTYGLPGDYPIVAPNYAAQRSELAKSLGLGQLRRKMAEKRAADEAKGSAPAGS
                     KKGRGRPRRAAASE"
     gene            56958..57185
                     /locus_tag="MNOD_RS42215"
     CDS             56958..57185
                     /locus_tag="MNOD_RS42215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008997084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783617.1"
                     /db_xref="GI:915398232"
                     /translation="MVEAKLLAWHRADERSWRLAQIPGVCPIGATLLTLKTPAPEAVP
                     VGPAVRRLDRLDPGDGCGPRESRSLRCCDHS"
     gene            59063..59350
                     /locus_tag="MNOD_RS38745"
                     /old_locus_tag="Mnod_7829"
     CDS             59063..59350
                     /locus_tag="MNOD_RS38745"
                     /old_locus_tag="Mnod_7829"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631064.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroES"
                     /protein_id="WP_012631064.1"
                     /db_xref="GI:501739577"
                     /translation="MTFRPLHDRVVVRRIEAEEKTKGGIIIPDTAKEKPQEGEIVAVG
                     PGARDETGKLVPLDVKTGDRVLFGKWSGTEVRIDGQDLLIMKESDIMGVLA"
     gene            59442..61091
                     /gene="groEL"
                     /locus_tag="MNOD_RS38750"
                     /old_locus_tag="Mnod_7830"
     CDS             59442..61091
                     /gene="groEL"
                     /locus_tag="MNOD_RS38750"
                     /old_locus_tag="Mnod_7830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010682003.1"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is essential
                     for growth; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="WP_012631065.1"
                     /db_xref="GI:501739578"
                     /translation="MAAKDVRFSSDARERMLRGVDILANAVKVTLGPKGRNVVLEKSF
                     GAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIVKE
                     GAKYVAAGMNPMDLKRGIDLAVAAAVKDITGRARKVASSEEIAQVGTISANGDKDIGQ
                     MIAQAMQKVGNEGVITAEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDP
                     YILIHEKKLSSLQAMLPVLEAVVQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAV
                     KAPGFGDRRKAMLEDIAILTAGQMIAEDLGIKLENVTLPMLGRAKRVRIEKETTTIID
                     GAGEKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAIIRVGGSTEVEVREK
                     KDRVEDALHATRAAVEEGIVPGGGTALLRAKAAVAALNSDNSDVQSGIRIVLKALEAP
                     IRQIAENAGVEGSIVVGQISDNTGSETYGFNAQTEEYEDMLQAGIVDPAKVVRTALQD
                     AASVAGLLVTTEAMVADAPKKESPAPAMPGGGMGGMGGMDF"
     gene            61764..61949
                     /locus_tag="MNOD_RS38755"
                     /old_locus_tag="Mnod_7831"
     CDS             61764..61949
                     /locus_tag="MNOD_RS38755"
                     /old_locus_tag="Mnod_7831"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012752783.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753899.1"
                     /db_xref="GI:760071089"
                     /translation="MRCRGPEVAAEAYFRLADFTAALTMSFVDGAAATVFGTGFFGFL
                     ASRFPRFFSEAMTNLLV"
     gene            62164..62364
                     /locus_tag="MNOD_RS38760"
                     /old_locus_tag="Mnod_7832"
     CDS             62164..62364
                     /locus_tag="MNOD_RS38760"
                     /old_locus_tag="Mnod_7832"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007675393.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631067.1"
                     /db_xref="GI:501739580"
                     /translation="MQLVSSARHQFPAEIVQHAVWLYLRFTLSYPVQNTFYAQRHLIS
                     RRTLRLFRAGAADAWQAATAAA"
     gene            62978..64960
                     /locus_tag="MNOD_RS38765"
                     /old_locus_tag="Mnod_7833"
     CDS             62978..64960
                     /locus_tag="MNOD_RS38765"
                     /old_locus_tag="Mnod_7833"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018261250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753903.1"
                     /db_xref="GI:760071093"
                     /translation="MRDALARLPADFNPEGYRRHNPNLGDLSDDAARIHYATIGRLEG
                     FAYRSDQIPGFDPDHFREIHPAFASADDATCQAAWQAEGGPNGPPGTQVEHLRRLDLP
                     LRTYPAAFPWRFYTRLYPRAAAHRWAALAHFLREGFAEVGTQIPYGEDAPSFLIALGD
                     HFAHRNDPAAVQAYELAVALGATPTVAHQKRLAEAYGRVGAWSAALDLYAHLFASGIC
                     EEAIMRCFVSAAAARQDWPRLFTLLPQALAQTGVMGDTIAREATETYFAHRSRTARAL
                     YADHRRAEGDAVLAEAVERVADLMTACGSSRARTAPERPMIAILADRLPDRARHRLDQ
                     RVALLGRIGFEARIFDLGTVRAFEEAVPAATAAILVRTPAWPTVVQALVCAKRAGVPT
                     LYETDELIVDPRFAPPPLEAFAGRIGERVHQDLVFGVALYRAAAKLCDFGLAPNRVLA
                     AHLDGIVARGRSFIVRDAIVPEARSPGVGEQVRLFLHAPQLQDVRATEAAGAALLEAF
                     RREPRIALTTAGFVTLDEAFAPFADRISQHGPVPDWEEALRGSDLNLVLADEGEAAAC
                     VAVTGWLAAARFGIPTLASATRAYCEDLEDGVDVRLASKEAEWRAALSALIAEPNLRQ
                     ALGTAAARSAGSRYTENAAAEDCRAMIKHVGKLRQQ"
     gene            64957..65907
                     /locus_tag="MNOD_RS38770"
                     /old_locus_tag="Mnod_7834"
     CDS             64957..65907
                     /locus_tag="MNOD_RS38770"
                     /old_locus_tag="Mnod_7834"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018263746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="WP_012631069.1"
                     /db_xref="GI:501739582"
                     /translation="MTIWNWFNWTTLRRNLAQRLDPDRARAGISTLAAPPSPAGDTVD
                     VLFERLISAAAATSRTLALDGSFFREIGPVVDGDSLEARSAEDLLAAAYRPGSRLLDF
                     GCGAMHGRSFIESLGYTWQGVDYLDGVSPLVRDEVARLGEAVQLYDGRVLPFADGEFD
                     VVWAMVSLHHVQHIDISFKEISRVLRPGGKLIGQVAYLEQMQDFGTFNFTPYGLKVAA
                     QNAGLRLARIDPKHDAFVFLLRRLIVTLTASDETPLNRMMGPEGFVHRTLIEAGRRLG
                     LDIRTTNLLRLLFCTHFVFEIEKTADGSVSSSGFGSAGVG"
     gene            66099..67271
                     /locus_tag="MNOD_RS38775"
                     /old_locus_tag="Mnod_7835"
     CDS             66099..67271
                     /locus_tag="MNOD_RS38775"
                     /old_locus_tag="Mnod_7835"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018263746.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753905.1"
                     /db_xref="GI:760071095"
                     /translation="MEAAAILTQLCRLFAHLPYGWRELAVLRQRAGDAEGAARDFARA
                     LAADPGDLHTLMQSVRHSAGMGRLDEAQACLSAFVPRTPGQVRRAERLEQLVAYMRRH
                     PETEAMLLAMAIRTSPRHLGIAAVEARIAAALEERRPFSLIRLGDGEGAWISDPDEEG
                     GRFRSLYRNNRKRILRTWFGNDDLIDRADFLALRDRFLATIPTASVVGVTYPERIRHE
                     YGIASLDGVPSCTNVLRHVSPLLHREGVSVCTHDIHLDLHLSGALQRLMTSGHPVGLI
                     SCHPQLAGAISRRFGTRIAAALLIPEEKRFAPIIGATGMQGAHYPEAFGHVMARLRQR
                     DWSGIFWLVAAGYLGKLYCHEIAARGGVAVDIGSIADAWSGKATRPGLSNLDPYRL"
     gene            67309..68130
                     /locus_tag="MNOD_RS42220"
                     /old_locus_tag="Mnod_7836"
     CDS             67309..68130
                     /locus_tag="MNOD_RS42220"
                     /old_locus_tag="Mnod_7836"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018261710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="WP_012631071.1"
                     /db_xref="GI:501739584"
                     /translation="MACPNEMTPSPAITAEQVLKSLAARRPIDLAVAVVTAHPDDETI
                     GLGGVMAHLRNLTLLQLTDGAPLDPAFAAAAGFPTRQAYAAARRSELVDALAVLVEGR
                     VARQVFYEIPDGRLADHLDVAIERLVEDLIWVDAVLTHPYEGGHFDHDAAAFAVQEAC
                     RQLARRGDHTPARLEFTSYHHIRGRLRTGHFVDHVACPEIVVPLLPEAARRKEAAFAC
                     HRSQASNLAAFGYGPERFRPAPTYDFFQPPAGGEVMYGIEVWHGLQRAFASAVHA"
     gene            69089..69277
                     /locus_tag="MNOD_RS38785"
     CDS             69089..69277
                     /locus_tag="MNOD_RS38785"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753908.1"
                     /db_xref="GI:760071098"
                     /translation="MFRIHDGLGDPDHEVVARTGNRLLIFRVDRLRQLASGLIDDLVG
                     ETDRIGMGFIGLRHQQIS"
     gene            69535..69789
                     /locus_tag="MNOD_RS38790"
                     /old_locus_tag="Mnod_7840"
     CDS             69535..69789
                     /locus_tag="MNOD_RS38790"
                     /old_locus_tag="Mnod_7840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631075.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631075.1"
                     /db_xref="GI:501739588"
                     /translation="MQKIALGLCATAALLALPSTGSAQGFYFGPGGVQIDDGHRDYYE
                     ERRYRRERGMCRELRQACLYKEELGEEGMGNCRRYRRLCT"
     gene            70108..71745
                     /locus_tag="MNOD_RS38795"
                     /old_locus_tag="Mnod_7841"
     CDS             70108..71745
                     /locus_tag="MNOD_RS38795"
                     /old_locus_tag="Mnod_7841"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631076.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631076.1"
                     /db_xref="GI:501739589"
                     /translation="MILSSSLPGCTIERVFRHTDHLVVIAHGRRCHGRCPTCGTPSSA
                     VHSRYDRRPADLPSMGQPVTLRLRIRRFYCHHPACRRRTFAEPLPRLIPPRARRTRRL
                     AQAQTRIGLAVGGEAGARLTGHLGMQTSPDTILRLVHRLPLPRANAPRAVGIDDWAIR
                     KGRSYGTLLVDLERRCPIDLLPDRSGATVAAWLRRHPSIQIVARDRSTEYARAATAGA
                     PAALQVADRWHLLLNLRQVLERWLGRVHGRLRQLPPLASGDGRQPGERPRAYRRSAAE
                     IAVSLDSRARRLAAYEDVRRRHLAGETLLAIGRATGLARATVRKYAQAESFPERAIRR
                     PNPSRLDPYLAHLEQRMAEGCENAMALWREIRRQGFAGTHRQVHRFVAERRTARKWLS
                     QPASTSTEAIRPSPIASPKQLAWILVQPLATLQPRAAADLARIRQDPEAARIADLARR
                     FTMLVRACGLGGDRPADPASELDRWLLETRNCGVAALETFAAGLAQDGAAVRAALTTS
                     WSNAQAEGQISRLKMLKRTMYGRASFALLRSRILIAA"
     gene            complement(71860..72309)
                     /locus_tag="MNOD_RS38800"
                     /old_locus_tag="Mnod_7842"
     CDS             complement(71860..72309)
                     /locus_tag="MNOD_RS38800"
                     /old_locus_tag="Mnod_7842"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012631077.1"
                     /db_xref="GI:501739590"
                     /translation="MNIGQAAKASGVSAKMIRYYEQTGLIPQADRKASGYRDYSDVDV
                     HMLRFIRRARGLGFSVAKINELLGLWRDESRQSAEVKRLAQAHIDELERKIKGLQDIE
                     HTLTMLVNACEGDHRPHCPILKHLENGEDNEDLSIHPRKGAVAGLAY"
     gene            complement(72364..74871)
                     /locus_tag="MNOD_RS38805"
                     /old_locus_tag="Mnod_7843"
     CDS             complement(72364..74871)
                     /locus_tag="MNOD_RS38805"
                     /old_locus_tag="Mnod_7843"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_012631078.1"
                     /db_xref="GI:501739591"
                     /translation="MNAPVRPADLSSASISLPIEGMTCASCVGRVERALKAIPGVETV
                     SANLATERASITTNAPVDRSKLVGAVENAGYSVPAAFSAPASSIELSVEGMTCASCIG
                     RVERALKAVPGVTQASVNLATERATIEGSADSGALIAAIEQAGYGATVIGKAVNAGGQ
                     DDTAEQAEKKETERRELKRDFTIAAVLTAPVFVLEMGSHLIPGVHGAIDATIGMQWSW
                     YIQFALTTLVLFVPGIRFYEKGLPALWRLGPDMNSLVAVGTLAAYGYSLVATFAPAFL
                     PPGTINVYFEAAAVIVTLILLGRLLEARAKGRTSEAIKRLVGLQAKTARVRRDGKTVD
                     LPIASVAAGDIIEVRPGERIPVDGEVTEGESYVDESMITGEPIPVSKALGSEVVGGTV
                     NQKGAFAFRATAVGGNTVLSQIIRMVEEAQGSKLPIQAMVDKVTMWFVPAVMAVAALT
                     FAAWLYFGPSPALTFALVNAVAVLIIACPCAMGLATPTSVMVGTGRGAELGVLFRKGE
                     ALQLLKDSKVVAVDKTGTLTEGKPALTDLELAIGFDRKAVLGLVAAVEAKSEHPIARA
                     IVEAAHNEGLELPMVSGFESVTGFGVKATVDGKPIEIGADRYMAELGHDVAGFATVAE
                     RLANEGKSPLYAAIGGKLAAIIAVADPIKETTPPAIRALHDLGLKVAMITGDNARTAK
                     AIAARLGIDEVVAEVLPDGKVEAVRRLKSQYGKVAFVGDGINDAPALAEADVGLAIGT
                     GTDIAIEAAEVVLMSGSLQGVPNAIALSKATIGNIRQNLFWAFAYNTALIPVAAGVLF
                     PAFGILLSPVFAAGAMALSSVFVLGNALRLRRFKVAH"
     repeat_region   74625..74905
     repeat_region   74982..75799
     gene            75047..75748
                     /locus_tag="MNOD_RS38810"
                     /old_locus_tag="Mnod_7844"
     CDS             75047..75748
                     /locus_tag="MNOD_RS38810"
                     /old_locus_tag="Mnod_7844"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631079.1"
                     /db_xref="GI:501739592"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGVPA"
     gene            complement(76023..76883)
                     /locus_tag="MNOD_RS38815"
                     /old_locus_tag="Mnod_7845"
     CDS             complement(76023..76883)
                     /locus_tag="MNOD_RS38815"
                     /old_locus_tag="Mnod_7845"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="WP_043754142.1"
                     /db_xref="GI:760071335"
                     /translation="MRKLLLTSAATALLTGAASAADLPRREPPPPPVFTPVPVFTWTG
                     FYAGFNAGYGFDTGPNRGPTVIGVGPATGLVIVPTVIAFRNESNLDGFTGGGQIGYNY
                     QFTPGAGVVIGLEADAQYVDFGRDRNRFIATGPIAAQRVFNPAGLAGLDFFGTVRGRL
                     GYAWDRTLIYGTGGFAYGSGGGRDFGLPNDDDFQTGWTAGGGVEYALPTDSFLNFFRS
                     SSVTVKVEGLYVNLDRGRRFNGAFAVNNAGAIITTASPGVVVVNAGQFRRDTEFAVVR
                     AGLNYKFGTW"
     gene            complement(78182..78886)
                     /locus_tag="MNOD_RS38820"
                     /old_locus_tag="Mnod_7846"
     CDS             complement(78182..78886)
                     /locus_tag="MNOD_RS38820"
                     /old_locus_tag="Mnod_7846"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631081.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631081.1"
                     /db_xref="GI:501739594"
                     /translation="MILNALALTLKRQAQGDFRGRHFEATLIVQAVSWSLRDALSDRD
                     IAEMLLERGLTVDHSTLTRWVLADAPAIERRLRRFRKPPCGSVRVDETDIRVRGQWRS
                     PDRAIDKPGEAVDVLLTANRDLDAAKRLFRNGAGPYPPAIAESRKAGLLPRTPTHHVS
                     KPLQQGIASDPFRVKRAMPRVGGFRSFKTARRTIQGVKARLWRRKGFGFLGAWTVREQ
                     NQLLAHCFGLPVANKA"
     gene            complement(79184..79366)
                     /locus_tag="MNOD_RS38825"
     CDS             complement(79184..79366)
                     /locus_tag="MNOD_RS38825"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753915.1"
                     /db_xref="GI:760071105"
                     /translation="MLGTGTGSEIRQPLGYAIVGGLLVSQVLTLFTTPVVYLYMERLS
                     RSLSSRSRPGQDLPAM"
     repeat_region   79372..80189
     gene            79436..80137
                     /locus_tag="MNOD_RS38830"
                     /old_locus_tag="Mnod_7848"
     CDS             79436..80137
                     /locus_tag="MNOD_RS38830"
                     /old_locus_tag="Mnod_7848"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631082.1"
                     /db_xref="GI:501739595"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGAPA"
     gene            complement(80494..81264)
                     /locus_tag="MNOD_RS38835"
                     /old_locus_tag="Mnod_7850"
     CDS             complement(80494..81264)
                     /locus_tag="MNOD_RS38835"
                     /old_locus_tag="Mnod_7850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_012631083.1"
                     /db_xref="GI:501739596"
                     /translation="MERFTGKAVAITGGGSGIGKATAARFVAEGARVVINGRDVAKLE
                     ATAREIDPSGRNVVVSAGDIADPATGAALVEAAVSRFGQLDVLVNNAGVFNPKPFLEL
                     TEADYDWYLDTILKGKFFTAQAAAKAMKDRGGAIVQTGSMWAIQAIGATPSAAYSAAN
                     AGVHAMVRNLAIELAPFKIRINAVAPAVIETPVYSTFMSAQQVRDVLPTFNAFHPLGR
                     NGQPGDVAEAILFLASDQAAWITGTVLPVDGGVTAGRQ"
     gene            81383..81883
                     /locus_tag="MNOD_RS38840"
                     /old_locus_tag="Mnod_7851"
     CDS             81383..81883
                     /locus_tag="MNOD_RS38840"
                     /old_locus_tag="Mnod_7851"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631084.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="WP_050783648.1"
                     /db_xref="GI:915398263"
                     /translation="MMDTAQAIMDAAERRIRSAGYSGFSFREIADEIGIKSASVHYHF
                     PTKEALAAAVTRRYNDRIAASIDAQIAAGTAPVEAWRHVFRAALADGARMCLCGALGV
                     TSGDLSEEVAAEVRRFFTYGVDKLKAGGLSEARAMQVLATLEGAILIASVRSDPAFFD
                     LSTSDL"
     gene            complement(83329..85683)
                     /locus_tag="MNOD_RS38845"
                     /old_locus_tag="Mnod_7853"
     CDS             complement(83329..85683)
                     /locus_tag="MNOD_RS38845"
                     /old_locus_tag="Mnod_7853"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631086.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin transporter BioY"
                     /protein_id="WP_012631086.1"
                     /db_xref="GI:501739599"
                     /translation="MRDSRFGNPERESEVPFKPHSSHWGVFSARMIDGELEVRPYEGD
                     PDPNQIIENFPGALRHRARIAQPMVRRGWLERGPGPDEKRGQDEFVPMAWQEVLDLLG
                     RELVRVRDGFGPEAIFGGSYGWSSAGRFHHAQSQIHRFLNIACGGYVRSVTSYSSGSS
                     QVLIPHILGNHEELAKHNVTWEQVEKDSEIVIAFGGMALKNSMVAGGGISKHVERGVM
                     QRAAARGCEFILVSPLASDLPEEARPEWVSLIPASDTALMMAMVHTLVVEGRHDRAFL
                     ERYTVGWPTFERYLLGEADGIPKDAHWAAPLTGVPADAIMALARRLHGKRALVVVSHS
                     LQRARYGEQPVWMGMVLAAALGQIGLSGGGYAYPLGAIAYYGRRKNAVKLPTLSQGSN
                     SVREFIPVARIADMLLGPGEAYRFNGKTLTYPEIKLIYWAGGNPFHHHQDLNRLKKAF
                     AAVDTLVVHELAWTATARHADIVLPCTMTLERDDIGGSSNDPLLVPMRQIAPPYGEAR
                     DDFAIFADLAERLGARDAFTEGRTVRQWLEHLYEPTRLGLVQLNLPAPSFEDFWESSG
                     ILVPQGPDDGGNLRAFREDPLASPLETPSGKLEIFSETIASFGEADCPGHPAWLGSGY
                     LPTESAPLVLVSNQPRTRLHSQLDFGGHSGSGKHRGREIASMHPKDAAERGIADGDIV
                     RLFNERGACLAAIALTEDIRPGVIQLPTGAWYDPADPTEEKTLCVHGNPNVLTEDVGT
                     SALAQGCTGQLTTVEVERFDGNLPPIRAYDPPLSLPAPASHLDG"
     gene            complement(87313..88500)
                     /locus_tag="MNOD_RS38850"
                     /old_locus_tag="Mnod_7855"
     CDS             complement(87313..88500)
                     /locus_tag="MNOD_RS38850"
                     /old_locus_tag="Mnod_7855"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631088.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_043754144.1"
                     /db_xref="GI:760071337"
                     /translation="MKIIKIETLEIELSGQCGIASWRPVFVRIHTDAGITGMGEVGLA
                     YGTGTPAAAPMIRIIGERLVLGRDPNDTETIWEHMLRRSFWAEGGGPVVFGAMSAIDA
                     ALWDIKGKAAGLPVHRLLGAETPLPLRCYASQMQFGWEDISVLKNSPSEYRDTAQTAR
                     AQGYDCVKVSPIYVAPDGQRARNRGVFTPEFRKLARARMEAVRDGVGPDADIILELNS
                     LTSTAGALQLAELFSDLGILFMEEPTHSNSPEAFVKVSSRSPIPLATGERLYTRWGFL
                     PYLQAGSIDMIQPDMGLVGGVSEGIKIAHLAHAFDVGFQAHICGSPLATAIALQVEAA
                     IPNLEIHEHHTFALKSCNRDLFEEDLQPVNGHLAVPTAPGFGMTLRKDAEKRMEISEV
                     SLA"
     repeat_region   88538..90015
     gene            complement(88618..89952)
                     /locus_tag="MNOD_RS38855"
                     /old_locus_tag="Mnod_7856"
     CDS             complement(88618..89952)
                     /locus_tag="MNOD_RS38855"
                     /old_locus_tag="Mnod_7856"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631034.1"
                     /db_xref="GI:501739547"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     gene            complement(90143..90928)
                     /gene="glnQ"
                     /locus_tag="MNOD_RS38860"
                     /old_locus_tag="Mnod_7857"
     CDS             complement(90143..90928)
                     /gene="glnQ"
                     /locus_tag="MNOD_RS38860"
                     /old_locus_tag="Mnod_7857"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631089.1"
                     /note="similar to ATP-binding component of ABC
                     transporters; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arginine ABC transporter ATP-binding protein"
                     /protein_id="WP_012631089.1"
                     /db_xref="GI:501739602"
                     /translation="MSQATTIDRANAATCEQPAIILDKVNKWYGAMHVLRDVSMTVSQ
                     KERVVVCGPSGSGKSTMIRCINRLEMHQEGRIIVDGTELTDDLRALDTIRREVGMVFQ
                     NFNLFPHLTILENCTFAPIWVRKMPKAEAEELAMSYLRRVKIPEQAKKYPGQLSGGQQ
                     QRVAIARALCMRPKIMLFDEPTSALDPEMIKEVLDTMIGLAEDGMTMVCVTHEMGFAR
                     KVADRVVFMDRGEIVEAGSPASIFEDPQTDRLKQFLSQILRGH"
     gene            complement(90940..92124)
                     /locus_tag="MNOD_RS38865"
                     /old_locus_tag="Mnod_7858"
     CDS             complement(90940..92124)
                     /locus_tag="MNOD_RS38865"
                     /old_locus_tag="Mnod_7858"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631090.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="WP_012631090.1"
                     /db_xref="GI:501739603"
                     /translation="MSQTTTAKISEAAGDPVPSIAGIPAAPITRAPPLAAGAGPLGWA
                     RTNLFSSIPSTIVTLVLLILLARWATEFVNWAILHAVWSVPNTATGPDTAACRDAKGI
                     GACWAVISEKYRFILFGRYLYEEQWRPAIVIVLFIGLYVVSAMRQFWRKELILIWITT
                     LTVVGVLMWGGVFGLTYVPQDSWGGLPITLILATFGLACAFPLSILVALGRRATNLPA
                     IRVLCTVYVELIRGVPLITVLFMASVMFPLFMPAGLNPDKLLRAQVAVILFAAAYLAE
                     VVRGGLQTLPKGQYEAADALGLGYWHKTAFIILPQALRLVIPPLVNTFIGFFKDTSLV
                     LIIGLFDLLTAGKVAMADLVWQPYSTEVYLVLAAIYFAFCYVMARYSRGLEQGFSRST
                     KR"
     gene            complement(92128..93339)
                     /locus_tag="MNOD_RS38870"
                     /old_locus_tag="Mnod_7859"
     CDS             complement(92128..93339)
                     /locus_tag="MNOD_RS38870"
                     /old_locus_tag="Mnod_7859"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631091.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012631091.1"
                     /db_xref="GI:501739604"
                     /translation="MSGAVLDPRLHPVRAAPRKKLNFSWSDPRFRNIVWQVVILSAVT
                     AVAWFLISNTNRNLEQRRIATGFAFLSRTAGIPIGEHLIDYDPAVSTYGRALLIGVLN
                     TLKVAVVGVVLATLWGTLLGIARLSRNWLVSKLAAVYVEIIRDVPLLLQLLFWYSILQ
                     ALPAPRQSFHPVPGVFLSNRGVKIPFVEWDEPYWWALLALTVGAVGTWAWSRAATRRQ
                     ERIGTRPKVWPMAILLMVGFPVAVWAGLGAPFVADVPELRGFDFNGGGTISPEYGALT
                     MGLVIYTAAFIAEIVRSGILAVPTGQWEAAAALGVRRGIILRKIVLPQALRVIIPPMT
                     SQYLNLIKNSSLAVAIGYQDIVSIANTTLNQTGQAIEGIAMVMLVYLVISLSISLFMN
                     WYNGRIALVER"
     gene            complement(93464..94489)
                     /locus_tag="MNOD_RS38875"
                     /old_locus_tag="Mnod_7860"
     CDS             complement(93464..94489)
                     /locus_tag="MNOD_RS38875"
                     /old_locus_tag="Mnod_7860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631092.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_012631092.1"
                     /db_xref="GI:501739605"
                     /translation="MNRVLAGAILFGALAAFADPSWAQGSGSKTIDDIRARGQLVCGV
                     TAGAAGFSLPDSRGVMRGIDADICRAVAAATLGEADKVRYVPTTVTNRFTALQSGEID
                     ILVRSTTWTLSREANLGLEFAGVYFFDGTGFMVNKSLGVKSSKELNGATICIQPGTST
                     ELAVADYFREHGMKFKPILIQDPAETQNTFISGRCDAYSMDISALASFRFQQGPKKDD
                     YVLLPEVISKEPVGVMVRKGDEKFFDLVRWSMIALLQGEESGVTQANVDQMLDSKDPT
                     IRRMLGLEGDLGKAMGVDNKWAYKILKSVGNFGEIWERNIAPLGISRGINALWTKGGL
                     HYPPPMR"
     gene            complement(96123..97355)
                     /locus_tag="MNOD_RS38880"
                     /old_locus_tag="Mnod_7862"
     CDS             complement(96123..97355)
                     /locus_tag="MNOD_RS38880"
                     /old_locus_tag="Mnod_7862"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012631094.1"
                     /db_xref="GI:501739609"
                     /translation="MSQAAIEPAPKLAPALPARSGTGNVARLAIAQALAGANSTVVYA
                     TGAIVGNMLAPSPVLATLPISIFVVGMAACTLPAGAIARRHGRRAAFLAGTGCGVLVG
                     LLSALAIVSGSFWLFCAATFFGGAYAAVVLSFRFAAADCVSPEQRPRALSAVMAGGVF
                     AGVIGPQLVTHTMDLWPPYLFAATFLAQAVVAAVSALVLLGVRLPMPSAAETSRGRPL
                     GAIARQPRFITAVICGVVSYLLMNFLMTAAPLAMHLCGLSQEDANLGLQWHVIAMYAP
                     SFVTGRLIARFGAPRVVAAGLALTAASAAVGLAGVDVAHFWLTLVLLGVGWNFGFVGA
                     SALVLECHRPEERTRVQSLNDFIVFGTMALGSFSSGGLLASYGWDVVLWISFLPILLA
                     VGALVWTAAVRTTNTRLG"
     gene            complement(97364..98683)
                     /locus_tag="MNOD_RS38885"
                     /old_locus_tag="Mnod_7863"
     CDS             complement(97364..98683)
                     /locus_tag="MNOD_RS38885"
                     /old_locus_tag="Mnod_7863"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631095.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631095.1"
                     /db_xref="GI:501739612"
                     /translation="MAPLDRRGLPLSTTSDRAAECYREGVDLLLTAWPGAAEALEEAV
                     AADPDFALAHAARARLHAMCAEPAQARARIAAAAERVARRGIERERSHVEVLSLAING
                     QPARALERALGHADAWPRDALILSLPLGAFGLLAFSGMTDHDQARVDLCERHARHYDA
                     DDWWFLTYRGWSHAENGAVKHGRALAERGFALRRANANGAHALSHAMFEGGAGEEAEA
                     LIAEWLPGYDRSGILHGHIAWHAALSALERDEPQRALAIYAEHVQPSVTAGLPINVVS
                     DTVSLLWRMQAYGYKVPAGLWDDAKVYSSKYFTKAGFAFADAHMGLLAAATGDKAAAV
                     ARIDALTDLVAAGTLAAGPVVPAICRAVLAFAEEDYAGCVRILEPVAAEVTRIGGSGA
                     QREIIEDTLLVALMRSGEAAKARALLDRRLHRRPSPRDTRWHTLLMA"
     gene            complement(98977..99255)
                     /locus_tag="MNOD_RS38890"
     CDS             complement(98977..99255)
                     /locus_tag="MNOD_RS38890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003596038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_043754149.1"
                     /db_xref="GI:760071342"
                     /translation="MGTKKHKPEEVVAKLRQVNVLVSQGHSVADAIRAIGVSEVTYYR
                     WRKEFGGLKTDQVRRMRELETENARLRKAIADLTLDKLILQEEARGNF"
     gene            99433..100380
                     /locus_tag="MNOD_RS38895"
                     /old_locus_tag="Mnod_7866"
     CDS             99433..100380
                     /locus_tag="MNOD_RS38895"
                     /old_locus_tag="Mnod_7866"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011647564.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631098.1"
                     /db_xref="GI:501739626"
                     /translation="MDEHRTIFVGIDVSKDRLDVHLRPSDEALHVPRDAKGLDTLARR
                     LGRLPVALVVLEATGGFEASVAAALAAVGLPLCIVNPRQIRDFARAMGRLAKTDTLDA
                     EVIALFAERIRPPARPLPEPERSHFAELVSRRRQIIGMIGMETNRRDQAVDKQLIRRV
                     DRHIAFLERELVELDRDIDRAIKASPVWCETEALLKSVPGIGDVTARTLLAQLPELGT
                     IGRHQLAALVGIAPINRDSGLMRGRRSIAGGRTSVRGVLYMAALTAIRRGSPFRPFYE
                     RLTQRGRPRKVALVAVMRKLLVTLNAIVRERTPWRPLAA"
     gene            100565..101368
                     /locus_tag="MNOD_RS38900"
                     /old_locus_tag="Mnod_7867"
     CDS             100565..101368
                     /locus_tag="MNOD_RS38900"
                     /old_locus_tag="Mnod_7867"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631099.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_012631099.1"
                     /db_xref="GI:501739629"
                     /translation="MTWEAIEVPSGLAPPQPIRVRAQSIPARHYFPEHAHRWNQVVYA
                     ISGVLTVAVEGHSFVISPEQAVWLPTGLRHRVGSLLGAEFRSLWIADEAGRGLPESPT
                     VFGVAPLLNALIVEAAAIEGEADRDGYASRVSDLILDQLRRARPLPGALPWPRGGSSL
                     TALCEALYADPADARAPAAWGRELGMSERTLARRFETEVGMSFRSWRRRLRLFKAIEL
                     MGGGLDVTRTAMELGYGSTSAFVYAFRTEMGFSPQAYMRGRTPDQGTHC"
     gene            101433..101624
                     /locus_tag="MNOD_RS38905"
     CDS             101433..101624
                     /locus_tag="MNOD_RS38905"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753917.1"
                     /db_xref="GI:760071107"
                     /translation="MGASRLPFGLLVDPVHVGALRSREPAAPTRNGSSVEAMYPCMAL
                     RPVIDQTDATDAWAPGEAV"
     gene            complement(101676..>101912)
                     /locus_tag="MNOD_RS38910"
                     /pseudo
     CDS             complement(101676..>101912)
                     /locus_tag="MNOD_RS38910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012779142.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="disulfide bond formation protein DsbA"
     repeat_region   101904..102722
     gene            101969..102670
                     /locus_tag="MNOD_RS38915"
                     /old_locus_tag="Mnod_7870"
     CDS             101969..102670
                     /locus_tag="MNOD_RS38915"
                     /old_locus_tag="Mnod_7870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631082.1"
                     /db_xref="GI:501739595"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGAPA"
     gene            102839..103069
                     /locus_tag="MNOD_RS38920"
     CDS             102839..103069
                     /locus_tag="MNOD_RS38920"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753920.1"
                     /db_xref="GI:760071110"
                     /translation="MNATILWNTKYLARTVHYVRGQGVELDDELLSHVGPVKWDHIAL
                     TGDYLWSEIEHPRERFRPLRTGRFNPARFRFA"
     gene            complement(103841..104125)
                     /locus_tag="MNOD_RS38925"
                     /old_locus_tag="Mnod_7872"
     CDS             complement(103841..104125)
                     /locus_tag="MNOD_RS38925"
                     /old_locus_tag="Mnod_7872"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RND transporter"
                     /protein_id="WP_012631100.1"
                     /db_xref="GI:501739632"
                     /translation="MRKLIIAVAAAAFSTAVSAQTVPSNGQVTKIDAAQNKLTLKHGP
                     IKNLDMDGMTMVFSVADPAMLKTLKVGDKVKFDADRVNGRLTVTKIEKSK"
     gene            104294..104563
                     /locus_tag="MNOD_RS38930"
     CDS             104294..104563
                     /locus_tag="MNOD_RS38930"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753924.1"
                     /db_xref="GI:760071114"
                     /translation="MLHVRIFSHFLTVLKILLKRSEDDLVIEFAVIAKNKPDLLSAEN
                     LKAIWDELHLSVRLAHGDLDDACRLLWVARLAIGAVIAMGVARVC"
     gene            complement(104633..106027)
                     /locus_tag="MNOD_RS38935"
                     /old_locus_tag="Mnod_7874"
     CDS             complement(104633..106027)
                     /locus_tag="MNOD_RS38935"
                     /old_locus_tag="Mnod_7874"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631102.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper oxidase"
                     /protein_id="WP_012631102.1"
                     /db_xref="GI:501739638"
                     /translation="MSVSRRNFLSAAGGITLVSASAVSGRTAFASVPEAPTMKSPQMQ
                     PPLVPKTGPDYNPVVTLNGWTLPWRMNGDWKEFHLVAEPVVREFAPGMVGHLWGYNGQ
                     SPGPTIEAVEGDKVRLFVTNKLPEHTTIHWHGQLLPSGMDGVGGLTQPHIPVGKTFVY
                     EFQLQKSGTFMYHPHADEMVQMAMGMMGFFVVHPKDPAFRRVDRDFVFLMASYDIEPG
                     TYVPRVAEMTDFNMWTWNTRVFPGIDHIVAGKGDKVRIRFGNLTMTNHLIHMHGYDFK
                     VSCTDGGWVPEEAAWPEVTIDCAVGQMRAFDFVADKPGDWAIHCHKSHHTMNAMGHDL
                     NTFIGVDKRKVAKKIKRLVPDYMPMGTAGMADMGEMEMPLPDNTLPMMTGWGQFGSIE
                     MGGMFSVVKVREGLAANDYKDPGWFKHPEGTVACEWKGEPKKTERAPSPTPARRTAEF
                     NVVKPGRKSPHDNH"
     gene            complement(106041..107492)
                     /locus_tag="MNOD_RS38940"
                     /old_locus_tag="Mnod_7875"
     CDS             complement(106041..107492)
                     /locus_tag="MNOD_RS38940"
                     /old_locus_tag="Mnod_7875"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper tolerance protein"
                     /protein_id="WP_012631103.1"
                     /db_xref="GI:501739641"
                     /translation="MKPPIRNHADSRLAVPAKRLSLIGTITLALGGCVTVTPDGGMQP
                     VAQEVAAAISKETVKIASQADAADAQARAKALLNKPLTAGTAVQIALLSNRGLQAEYN
                     ALGLSEVDFVEASLPPNPTVTLGRAVVDGTLDVERRIIANLLALLTQPTRRAIGELRF
                     EAARYRAIDGTFRTAANARKAYYAAVAARQKVNFLEQARASADAAADLTRSLGETGAA
                     KKLDQARTAAFYAEVSNELAAARLEAGTTREALTRSLGVWGSDINYKLPSELPRLPQR
                     LLSQQTAEADAIRKRVDLIASRLDLDALATSLRLDQATRYASAFELAGLSRFERSKVD
                     GIVEKTSSAGHSLDLAIEIPIFDLGETTRRRAVETYMQAVNRFAEQAVNIRSEARAAY
                     LTYRAAYDIALAYRNKIVPLRRTVNEQSLLEYNGMLIDIFVLLTTFREGIDSNIAAIG
                     AQRDFFIARVDFDAAIQGGGSGPGAAIRVAAGQ"
     gene            complement(108531..108740)
                     /locus_tag="MNOD_RS38945"
                     /old_locus_tag="Mnod_7878"
     CDS             complement(108531..108740)
                     /locus_tag="MNOD_RS38945"
                     /old_locus_tag="Mnod_7878"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal transport/detoxification protein"
                     /protein_id="WP_012631106.1"
                     /db_xref="GI:501739651"
                     /translation="MYHFNIPDMTCGGCARSVTKALQSVDANARIDTDPAKREVRVES
                     SADEAAFRAVLMQAGYPADEKLPAA"
     gene            109153..110604
                     /locus_tag="MNOD_RS38950"
                     /old_locus_tag="Mnod_7879"
     CDS             109153..110604
                     /locus_tag="MNOD_RS38950"
                     /old_locus_tag="Mnod_7879"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="copper oxidase"
                     /protein_id="WP_012631107.1"
                     /db_xref="GI:501739654"
                     /translation="MTRRDFLQGLSAGAVASGAVGLTHPFGAAAFAAAPNSASLTLVS
                     RTLDVNGRSARVFGLVGPHGRSGLTFNAGDRFDVALESKIDAPTLIHWHGLTPPWEQD
                     GVPNNPAAMLEPAETRRYSFPVGKGGTHWMHAHTLQEQDLLAAPLIVRTAEDLKQDEQ
                     EVVILLHDFSFKSPEELLADLKGKEGHGGAHGGTNMSTMNHGAMKPGALGSGTMDHGT
                     MDLNDIEYDAYLANDRTLADPEVVQVEKGGRVRLRIINGATATAFTVDTGSLDATLIA
                     VDGQDVQPVAGRTFPVSMGQRIDLRVEVPRDGGALPVLALREGAPERTGIILASAGAS
                     VRKIDTTGAGKGPVLDLALEQRLRPVQPLAVRQADRTFALMLTGTMSGYTWNIEGAGD
                     GLGVKQGDRVEISMHNMSMMAHPMHLHGHHFQVVDINGARFSGAVRDTVLVPPMATVT
                     VAFDADNAGHWPLHCHHLYHMAAGMMTSVAYAR"
     gene            110618..112984
                     /locus_tag="MNOD_RS38955"
                     /old_locus_tag="Mnod_7880"
     CDS             110618..112984
                     /locus_tag="MNOD_RS38955"
                     /old_locus_tag="Mnod_7880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631108.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="WP_012631108.1"
                     /db_xref="GI:501739657"
                     /translation="MSNHQHAHHREGHGSHHHKKSPPAGTAKDPVCGMDVDPATTPHH
                     TEYGGQTHHFCSVRCKGQFDADPAAYAAGKAMPRKAAPVAEGVIYTCPMHPQIRQPQP
                     GNCPICGMALELETPTLETGPSAELLDMRRRFWVGLVLTLPVFLLEMGGHLIDLHMWL
                     SPQISNWVQLVLATPVVLWAGWPFFERGWQSLVTRHLNMFTLIAMGTGVAWVYSVVAT
                     VMPGIFPETLRTMGGSVAVYFEAASVITVLVLLGQVLELRAREQTGGAIRALLDLAPK
                     TARRVKADGTDEDIELDAVVVGDRLRVRPGEKVPVDGTLLEGRSSVDESMITGESMPV
                     TKAPGAKLIGGTMNQTGGFVMEAAKVGRDTMLSQIVRMVADAQRSRAPIQRLADDVSG
                     WFVPAVIVIAIIAFFAWFLVGPEPRLAHALVAAVAVLIIACPCALGLATPMSIMVGVG
                     RGAGLGVLIKNAEALERFEKVDTLVVDKTGTLTEGRPKVTAIVPAEGISETELLRQAA
                     TLERSSEHPLALAVVNAALERNLALGDAQDFDSPVGKGVTGMVEGRKLILGSHTIMGE
                     EGVDISAMSAEAEELRDEGATVIFMATDGVLSGLFTIADPVKATTPQAVRELTARGIR
                     VVMLTGDNRTTAQAVARRLGISEVEAEVLPEDKSAIVARLRKEGRVVAMAGDGVNDAP
                     ALAAADVGIAIGTGTDVAIESAGVTLLKGDLQGIERALQLSRATMKNIRQNLFFAFIY
                     NAAGVPVAAGILYPSFGILLSPIIAAAAMALSSVSVIGNSLRLRSVRL"
     gene            complement(112985..113230)
                     /locus_tag="MNOD_RS38960"
     CDS             complement(112985..113230)
                     /locus_tag="MNOD_RS38960"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753928.1"
                     /db_xref="GI:760071118"
                     /translation="MLARSVAKLTETVSTPGMAFRALSTRPTQDAQVMPLMGSEIDAV
                     ERFAGRTGAFIATSFLVREFCVSGFQSWEVGSDTPAT"
     repeat_region   113033..114130
     gene            complement(113365..114066)
                     /locus_tag="MNOD_RS38965"
                     /old_locus_tag="Mnod_7882"
     CDS             complement(113365..114066)
                     /locus_tag="MNOD_RS38965"
                     /old_locus_tag="Mnod_7882"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631082.1"
                     /db_xref="GI:501739595"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGAPA"
     gene            114113..114832
                     /locus_tag="MNOD_RS38970"
     CDS             114113..114832
                     /locus_tag="MNOD_RS38970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015932523.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_043754153.1"
                     /db_xref="GI:760071346"
                     /translation="MNGTSPFKGRHFQATLIVQAVSWYLQYALSYRDIEEMLLERGLE
                     VDHSTLNRWVLAYAPALERRLRRFRKPHCGSVRVDETYIRVRGQWRYLYRAIDKHGEA
                     VDFLLTAHRDLDAAKRFFRKMLSAEPLLAPDRIGTDGAGPYPPAIAESHEEGLLPRAP
                     THHVTKHLQQGIESDHVRVKRPMPRVGGFRSFNTARRTIQGVKAMRWLRKGFGFAGAW
                     TVREQNQLLAHCFGLPVANKA"
     gene            complement(115061..116293)
                     /locus_tag="MNOD_RS38975"
                     /old_locus_tag="Mnod_7884"
     CDS             complement(115061..116293)
                     /locus_tag="MNOD_RS38975"
                     /old_locus_tag="Mnod_7884"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_043754156.1"
                     /db_xref="GI:760071349"
                     /translation="MTSSAPGRSVSTFVPDSPAAWRRLLIALAIAAVGTVGTWSVVVV
                     LPMVQAELGVTRGAASLAYTLAMIGFALGGVVTGRLTDRLGIIPAMGMGILSLLFGYL
                     GAGISTALWQFAVAHFFIGLGASATFAPLMAEASRWFVRRRGIAVGIAGSGYYLSGAF
                     WPPLIERGIAQYGWQMTHIALGILCGAAMTVLLLILRLSIGRSQQRSLGTEGRPSVDI
                     DLSPNALTAVLSVASFFCCTAMAVPQVHIVALCGDLGYGVARGVEMLSLMLAFGAVSR
                     IGSGLIADRLGGLATLLIGSVAQASALTMYLFFDGLTPLYVVSALFGLFHGGIVSSYA
                     IIVRETMPTREAATRVGTVIMVSLFGMSFGGWISGVIFDMTGSYKVAFLNGLGWNALN
                     VATVLLLLLRSRRRAAFA"
     gene            complement(117146..118510)
                     /locus_tag="MNOD_RS38980"
                     /old_locus_tag="Mnod_7886"
     CDS             complement(117146..118510)
                     /locus_tag="MNOD_RS38980"
                     /old_locus_tag="Mnod_7886"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783618.1"
                     /db_xref="GI:915398233"
                     /translation="MPDLGEIYTLVLLESIAKACEHAQESMIAKARVVATSLSSAQLD
                     SYGPREASFSPTNVNCDEIMAQAFAIVEAQSLSRAEAAKRKRCIRESLFNRKAHKIRD
                     ARSFAELLAALSKWSLSLEAFAAFRNGEVVPVSILAIQDAERYPCYSDLSHAVVAEYR
                     SFLMKMTDLLDIERRHLDLVAYRDVAERTDETAQRRRDAFYENRLQALRAPIAAGLSR
                     LLLCCGKEKFTQCLREVDADGIVGPLFEPLLLSVQHPRLAECALKWDREYEEVFFQCM
                     TNIYDPSEDAELEQLRQHLIQRTLEAACQYCAAYEANTGLKNGDRFDDVSIRFPNTLR
                     MSIHSKSESMGQFSISVSPTKTRTPWHGTAALSGSSDGAPIVLSIDLAGGLEATGKYA
                     AVVVEAEDGSQRSGPFEGHAYCGQPIFYLSADLLSTDREGGPGAIWRELAFRGLRGFT
                     QAAQ"
     gene            complement(<119031..>119583)
                     /locus_tag="MNOD_RS42225"
                     /old_locus_tag="Mnod_7887"
                     /pseudo
     CDS             complement(<119031..>119583)
                     /locus_tag="MNOD_RS42225"
                     /old_locus_tag="Mnod_7887"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013651388.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_except=(pos:complement(<119223..>119225),aa:OTHER)
                     /transl_table=11
                     /product="transposase"
     gene            complement(120898..121797)
                     /locus_tag="MNOD_RS38990"
                     /old_locus_tag="Mnod_7889"
     CDS             complement(120898..121797)
                     /locus_tag="MNOD_RS38990"
                     /old_locus_tag="Mnod_7889"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017737304.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase small"
                     /protein_id="WP_012631111.1"
                     /db_xref="GI:501739667"
                     /translation="MIGVSDKSWLVDLLSTVAPDRPDLVPEIAADSDKHIYSTYFGLG
                     HQLKMHDRPGVFKVSLAGMALGSYLLKGLAQDELTGRLLDLGTGSGILALLLRSLGAH
                     DITASDVSTSAVGLALENESLNFRSSRIRFFSGDLFVGLPEGDRYDTVIFNPPGWRTP
                     SEKLLDRLRGNEDGIGMTPETMFYGDELLLRFLKDLPDRMNRTGRAIVGLNSLVGIRD
                     VLARYKAFYPTGAPLQFQLLERHSLPLLFYSPGWKRAEPFLREEFEAWRDSYGAAYTI
                     DGQGRLYWSYEVVECRRAPTALG"
     gene            complement(121794..122624)
                     /locus_tag="MNOD_RS38995"
                     /old_locus_tag="Mnod_7890"
     CDS             complement(121794..122624)
                     /locus_tag="MNOD_RS38995"
                     /old_locus_tag="Mnod_7890"
                     /EC_number="1.5.1.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010954608.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="WP_012631112.1"
                     /db_xref="GI:501739670"
                     /translation="MKTTLVLFGVGHMGSAIARGMLQTGNTDLRIIDPDLSALQEFSA
                     LGIRTDTACLSLAPNDVLMLAMPPQVFGAFSSDTPCVHHHQGLVISVMAGIRISSIQQ
                     MLGTQNVVRSIPNTPSEVFEGMTVYCRSSSVGENLARKARDVLESFGRAVEVSDEALI
                     DPATALCGGGPAFVAYFADALQEFGIKAGLSKDAALAITIQLLRGTSALLATTGKPVM
                     QLCREVMTPGGTTERGIWHFDDEGVGRTVLDALSKSSARSRELGLAITESLSQFEVAK
                     "
     gene            complement(122714..124389)
                     /locus_tag="MNOD_RS39000"
                     /pseudo
     CDS             complement(122714..124389)
                     /locus_tag="MNOD_RS39000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018974243.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_except=(pos:complement(124303..124305),aa:OTHER)
                     /transl_table=11
                     /product="AMP-binding protein"
     gene            124727..125896
                     /locus_tag="MNOD_RS39005"
                     /old_locus_tag="Mnod_7892"
     CDS             124727..125896
                     /locus_tag="MNOD_RS39005"
                     /old_locus_tag="Mnod_7892"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631113.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carnitine dehydratase"
                     /protein_id="WP_012631113.1"
                     /db_xref="GI:501739673"
                     /translation="MGPLKGFRVIEMAGIGPGPFCGMLLSDLGAQVLRVERHGASADA
                     HDPLQRNRLRLALDLKDPQQVGVLLDIVEHADALFEGYRPGVAERLGFGPDDCLQRNA
                     KLVYGRMTGWGQDGPLASTAGHDINYIALSGALHAIGRSGERPVPPLNLVGDFGGGGM
                     LLAFGMVCALLERERSGQGQVVDAAMVDGSIALMAMFLGMQARGLSCNQVGSHFLSGA
                     AHYYDTYQTKDGKFMAVGALEPQFYGELIAKAGLDPNVFGGSSFMSPAGHDPRRWAEL
                     KPLLAEQFMTRTRDEWCAVFAGSDACVAPVLTLEEAAQHPHNRARHAFVTVAGVTQNA
                     PAPRFSRTPAAHPELATADSTAVDALLSQWGCNREQLVNIAALSAQRAVAADSAS"
     gene            complement(127536..128231)
                     /locus_tag="MNOD_RS42230"
     CDS             complement(127536..128231)
                     /locus_tag="MNOD_RS42230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012452059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783619.1"
                     /db_xref="GI:915398234"
                     /translation="MRAIRRHWPSTAITIRGDGHYGRPEVMDWCEDNGVVSVCGLSGR
                     RALAAKVEDVADPIRVERAIGNKEAVRGFAETRHTARSWRQERRVVARIEATRLGLDI
                     RSIVTNVTTGTPQWLYAKVSCARGQAENLIKLHKTQLASDRTSCRSAAANQMRLVLHT
                     AAYWLILTAREAVPKAHPLACAEFATIRLRLLKLGARIQESASRIRLAFAAACPEAGL
                     LRHLAGVLAPAPA"
     gene            complement(128293..128652)
                     /locus_tag="MNOD_RS42235"
     CDS             complement(128293..128652)
                     /locus_tag="MNOD_RS42235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012452059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783620.1"
                     /db_xref="GI:915398235"
                     /translation="MPQRRDRPYAASGHLRTDPAFKLACGRLPESGPDLMSQPTISRL
                     ENTPALRDLIRLGRVLVDVFCARYPAPPASLTLDIDDTLDVVHGHQQLSVFNAHHDER
                     CFLPLHVYDTTAAGPSR"
     gene            128880..129188
                     /locus_tag="MNOD_RS39015"
                     /old_locus_tag="Mnod_7897"
     CDS             128880..129188
                     /locus_tag="MNOD_RS39015"
                     /old_locus_tag="Mnod_7897"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA damage-inducible protein"
                     /protein_id="WP_012631115.1"
                     /db_xref="GI:501739680"
                     /translation="MPANALVQTRIDADVRDRASAVLENMGLTVSDAVRILLTRTANE
                     GALPLELVTNSEAHDAWFRAKVLEALDDTRPDVPDDQAEAHFAQRRAAARRRAGELKS
                     "
     gene            129185..129478
                     /locus_tag="MNOD_RS39020"
                     /old_locus_tag="Mnod_7898"
     CDS             129185..129478
                     /locus_tag="MNOD_RS39020"
                     /old_locus_tag="Mnod_7898"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RelE/StbE family addiction module toxin"
                     /protein_id="WP_012631116.1"
                     /db_xref="GI:501739684"
                     /translation="MKLVWSAFALSDRGGIFTHIEADNPAAAIVIDERIVAATRRLRD
                     FPESGRPGRIAGTRELVVTGTPYIAAYQVTGETVRILRVLHGAQQWPDDLPEG"
     gene            complement(<130245..130379)
                     /locus_tag="MNOD_RS39025"
                     /pseudo
     CDS             complement(<130245..130379)
                     /locus_tag="MNOD_RS39025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011504797.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(130527..131762)
                     /locus_tag="MNOD_RS39030"
                     /old_locus_tag="Mnod_7901"
     CDS             complement(130527..131762)
                     /locus_tag="MNOD_RS39030"
                     /old_locus_tag="Mnod_7901"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015822440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631117.1"
                     /db_xref="GI:501739687"
                     /translation="MRSPYAIDELFTGSTWRRLAGPAERAAEALLRLDERLARTEPAL
                     ADGVRARAHFVDAQAALGLEGRLVLMEDLVLHDAAMPVRQPTPELARAMHVLAIRRRI
                     AAARPDWPFAREGWSALFGAVGRDPDGTEAPLESPRVEAPRRGDATEPQPWAMPRFGQ
                     DSFDDEDDGATSSGDEDELWTADEASDPAFAGIDRLLARSRRTLADYNDLTTDEGRAA
                     LRVRDPQYGEAERLAAWRRIALKDVRELPAVLAAAVVLDAWFVLDPSERQPFLGPLLA
                     AALLHQRGTARHHLPALALGLRESRTRWLTVHPAPERLGAILRAAEAAAHAASRDLDR
                     LSLARALMLRRVQAKRRTSRLPQLVEVFLASPLVTVQSAAQRLGTSAQVVEAMLTGLG
                     PACPRELTGRRRYRAWGIV"
     gene            131937..132998
                     /locus_tag="MNOD_RS39035"
                     /old_locus_tag="Mnod_7902"
     CDS             131937..132998
                     /locus_tag="MNOD_RS39035"
                     /old_locus_tag="Mnod_7902"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015934124.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012631118.1"
                     /db_xref="GI:501739690"
                     /translation="MEFDPADPAPAPPHGSSFALSVPLAAALPPGPALLERLEAYARA
                     AQGAFAPNTLRALAADSRIFAAWCRAHGRSVLPAAPQTVADFIDAQAARKSRATVERY
                     RSSIAMLHRAAGLPNPCTDERVRLAVKRMSRAKGRRQKQAEPLNRPSIDRMLAVKTPE
                     RLHRRVAEGDREVPLIALRNAALMAVAYDTLLRRSELVSLLIEDLERVEDGSGTILVR
                     RTKTDQEGEGAVKYLAPDTVGHVSAWLEAAGLTSGPLFRPVTKGGRVGAAALGDAEVY
                     RLYREIALAAGVKLARPPSGHSTRVGATQDMFAAGFELLEVMQAGSWKTPAMPARYGE
                     RLRAQRGAARKLATLQNRA"
     gene            complement(134289..134909)
                     /locus_tag="MNOD_RS39040"
     CDS             complement(134289..134909)
                     /locus_tag="MNOD_RS39040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004704635.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783621.1"
                     /db_xref="GI:915398236"
                     /translation="MFKSLPIEDPESLVERDISTPIPGDADLLVRVEAIAVNPADYRV
                     RRRKADDGAFAVLGWDVAGELVATGSAGAGVSVGDAVSYAGDLPRPGGTSEFHAVNAA
                     IVGHRPTLLTPAQAAALPLTALTAWEALFDRFGLSPDASSERRTLLIVGGAGGVGSIA
                     IQLARLVPGLTVIATASRPLSRAWCERLGAHGRRYERIETGRSRLP"
     gene            135039..135875
                     /locus_tag="MNOD_RS39045"
     CDS             135039..135875
                     /locus_tag="MNOD_RS39045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003265948.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753935.1"
                     /db_xref="GI:760071125"
                     /translation="MRYFLALSRGGSLSAASRALGVEHSTVARRVGQLETELQVRLFD
                     RLARGWSLTSEGEALLRRAEAVEQEVLALRQAASGVDLLAGKVRISAPPLLLSHLILP
                     GLRAFSSAHPGVTLELAGERRDADLARAEVDIAIRLGRPTEPDLVARPLGEISYGLYG
                     LAEEIGRPGEEQVLVGFDDSMPDLPQKLWLDGHVAGRRFSVRSNDMATLLQAALSGFG
                     IALLPDFLARAHDRLKALPLDSQAPVRPVFLVMHADIRRSQRVRLVADRVAQELAAAL
                     PV"
     repeat_region   136772..136886
     repeat_region   137102..138577
     gene            137164..138498
                     /locus_tag="MNOD_RS39050"
                     /old_locus_tag="Mnod_7909"
     CDS             137164..138498
                     /locus_tag="MNOD_RS39050"
                     /old_locus_tag="Mnod_7909"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631034.1"
                     /db_xref="GI:501739547"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     gene            complement(138712..140028)
                     /locus_tag="MNOD_RS39055"
                     /old_locus_tag="Mnod_7910"
     CDS             complement(138712..140028)
                     /locus_tag="MNOD_RS39055"
                     /old_locus_tag="Mnod_7910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016428646.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753938.1"
                     /db_xref="GI:760071128"
                     /translation="MLSSDQLPAGVLAGPITDITFHDGEIWVAHRQVGANGWLVGAIS
                     KFDPANPVDTFTTVLTNLPSTGDHYTEEITFDASGRLYFSQGSATNSSVVGPDNELVS
                     GWLSQFPDFHDFAAHDVVLNGTEFHAPVSIPGLNPENQVTAPFMPFGSGPIAPGTVIP
                     AATPDAPQEGMIAGNAAVYSFDPTADDPASTLQLEGWGFRNPFGIGFDPFNPDLLFAT
                     NNGADIRSAPLDGLQVVESRPIANDFDDLFVMNAGGTAEFFGWPDFFHDPNTGAVLPV
                     TDPLFAQGDLPIPPPGFVLDENFRSGLQTEPAVAQFEYHSSANKFDFSTDDQFGSVGD
                     LFVAETGSFVPVTGAQDLVGYKVVQVDRDTGTVSDFITHTSNTVDDIFDPNGFNKPID
                     IKFQDSTMFIVDFGVFEPGLNLAQPETGKVWILSPTTNDPNGALLE"
     repeat_region   140607..140721
     gene            complement(140845..141411)
                     /locus_tag="MNOD_RS42240"
                     /old_locus_tag="Mnod_7911"
     CDS             complement(140845..141411)
                     /locus_tag="MNOD_RS42240"
                     /old_locus_tag="Mnod_7911"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018351699.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="WP_012631122.1"
                     /db_xref="GI:501739704"
                     /translation="MPLPRFERLPIETRTAFLAVARSHFARDGRDGASLNKIIGDSGF
                     SKTSAYNYFDGKDDLFEAVVADSFRRVSEVLGEWPVARDEAALWRNFHAANDRLNRFL
                     LANPDDRSLLAGAGSRSEPPKWLHAFFTNAVELGLVDVSPGRELLESATLAVLRSFDE
                     WALGRLPAEADAGATARVKELLRRLWAC"
     gene            complement(141418..141969)
                     /locus_tag="MNOD_RS39065"
                     /old_locus_tag="Mnod_7912"
     CDS             complement(141418..141969)
                     /locus_tag="MNOD_RS39065"
                     /old_locus_tag="Mnod_7912"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631123.1"
                     /db_xref="GI:501739707"
                     /translation="MIPLKLALTAVIVALLTQPLWAPQWGGGILAEIGAFGPAGAAIV
                     VLVFFSLVALYCLSLQRMLEAIAPAKRAASPRSVWLMFVIPSNFVEDFFIVGSIAASL
                     RNDGRTHARTQLVWLILGMSWCGLQIVSLLPGPVGVVSGGIALLAWAAHWMLTNHMTR
                     ALLDSSPSEVPAPSAGQAPASRA"
     gene            complement(141986..142261)
                     /locus_tag="MNOD_RS39070"
                     /old_locus_tag="Mnod_7913"
     CDS             complement(141986..142261)
                     /locus_tag="MNOD_RS39070"
                     /old_locus_tag="Mnod_7913"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631124.1"
                     /db_xref="GI:501739710"
                     /translation="MIRPDSPTVAEAEQKIAEHFHFVPPDHRAAEAGRLIEWWDRRIV
                     YSLCGERERVIVLSLRAALLDRPVGNEGILTSLLRRRERACTGGTHR"
     gene            complement(142258..142614)
                     /locus_tag="MNOD_RS39075"
     CDS             complement(142258..142614)
                     /locus_tag="MNOD_RS39075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011509893.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783622.1"
                     /db_xref="GI:915398237"
                     /translation="MDHDLVGETEAGNSRNGSGTRPSPPIPAKVDLAVPRDRQSPFDP
                     QLIARTSAAFPASNEKIIALDARGMSTREIVGHVRDLYGVEVSPDLIGAGTDAVLEEV
                     ATWQARPLEPVYPPPP"
     gene            complement(142838..143773)
                     /locus_tag="MNOD_RS39080"
                     /old_locus_tag="Mnod_7915"
     CDS             complement(142838..143773)
                     /locus_tag="MNOD_RS39080"
                     /old_locus_tag="Mnod_7915"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019333703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753941.1"
                     /db_xref="GI:760071131"
                     /translation="MCWQALVGEHLADVELDASPDIPAGEAFAGTLRIRSFERGTLAD
                     IASGGQVLTRTADRIRRAKSDAVLFNIILSGHCRLEQDGRQAVPTAGSLFLYESARPY
                     HIETSPDFRTIVVMIDRGRLERSLGNLRFYTGRAMCSVDTVARIAGSFWQTLSSQLDG
                     VPDAAANTLIEAGIDVVIPALRSMAGDRAEGSEACELTVMRATAFIASAFHRESLTVD
                     DIAAAAGVSTRRLQECFKEKGLTPMEQLRKHRLKHAHDRLNDGHCQNLSVLSIMSQSG
                     FSDPAHFSRAFRKEYGISPSAARSASQRRPAVRVA"
     gene            144069..145202
                     /locus_tag="MNOD_RS39085"
                     /old_locus_tag="Mnod_7916"
     CDS             144069..145202
                     /locus_tag="MNOD_RS39085"
                     /old_locus_tag="Mnod_7916"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009334421.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753944.1"
                     /db_xref="GI:760071134"
                     /translation="MAFGAFVVGVSELMTAGISDVMATDLGVSVASVGSLIFWHAVAY
                     AVAPPLLLSLRPRRERRTLLLVSAAIFTLASVAVAGAPGIGTALVGRVVQGGASGIVL
                     AIAISCAGESVPGNQRGRAMATVLMGLSLALVAGVPLGVLIAEVSGWRSAFYGVAAGG
                     AGLCGLLIAQPDLGQAGPHGRHEGGGHPQPMGRRQVAALVVSLAWMSAYSTMFSYAAP
                     LLKHRFDLDGAGLSVAIVAFGTACMGGGYLGGALSDAISEHRAAILAIVLNALVIAAF
                     PFLAGGLASAVTFMAAWGLSSWMVVAPVQAILASGEGSVDVALGLNNSGIQVGIGIGA
                     LIGGILHEQHPAHHASASLLLLLLALGACLAVPRMQARAAPMT"
     gene            145266..145655
                     /locus_tag="MNOD_RS39090"
                     /old_locus_tag="Mnod_7917"
     CDS             145266..145655
                     /locus_tag="MNOD_RS39090"
                     /old_locus_tag="Mnod_7917"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019400058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="WP_012631127.1"
                     /db_xref="GI:501739719"
                     /translation="MYSHIVVGTDDLQTALAFYDRVLAVLGLRRIAADDVSGAIGYAA
                     DGGSRAPMFFVGPPLNGCAAAPGNGTTVAFLAQDEEVVRQWHAAALAAGGSDEGPPGL
                     RPQYHPGYYAAYSRDPDGNKLCCVFHG"
     gene            145853..146581
                     /locus_tag="MNOD_RS39095"
                     /old_locus_tag="Mnod_7918"
     CDS             145853..146581
                     /locus_tag="MNOD_RS39095"
                     /old_locus_tag="Mnod_7918"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631128.1"
                     /db_xref="GI:501739722"
                     /translation="MTNAFYLARNESIVPLKIGLNLTYDEVASSYPETLYEDLATKLV
                     SRFGLDLRISKCFDHGIKAVIKGRSFHYLHEISSPTKIFMLLHTLGHYQFITRAARLG
                     IQRYDYIYETSEDGDAHVYRYRAASGGGPVVTPKILCDRIEFEVRANDFAVETARALG
                     LGQLVPLIRLYEPADIRYIIDVMDGGVDAIVSDRDYVEGYVLSGLGVPQQHNEEKIFD
                     RRFFSVEDIDWELLRTRKIEIHFL"
     gene            146689..147234
                     /locus_tag="MNOD_RS39100"
                     /old_locus_tag="Mnod_7919"
     CDS             146689..147234
                     /locus_tag="MNOD_RS39100"
                     /old_locus_tag="Mnod_7919"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631129.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase"
                     /protein_id="WP_043754173.1"
                     /db_xref="GI:760071366"
                     /translation="MAASVRSLLVCVGEDVDREGLRDTPARVARMYEEVFSGLNEDPV
                     LHLKTQFCDDGHEEIVVVRDIEFYSMCEHHLVPFFGKAHVAYVPQGGRLTGLSKIARC
                     VQTIARRPQLQERLTSQIVAALEEALTPLGAMALVEAEHLCMAMRGVRSSHSFTRTLV
                     ASGCLKTDPEQRAEAFQMLKG"
     gene            147242..148018
                     /locus_tag="MNOD_RS39105"
                     /old_locus_tag="Mnod_7920"
     CDS             147242..148018
                     /locus_tag="MNOD_RS39105"
                     /old_locus_tag="Mnod_7920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631130.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_012631130.1"
                     /db_xref="GI:501739728"
                     /translation="MCIRFTDRRGVALVTGGAKRIGRQISKRLYLEGYAVAIHSHRSY
                     GEACALAHEIAGSRGDAVALRADLACPASIATLVNRAEQALGPVTLLVNNASEFENDS
                     ADDLCRRQWNRHFDVNLAAPAFLMSDMAQRLPPAATGAIVNIIDQRVWKLTPQFISYT
                     LSKSALWTATRTFAQALAPRIRVNAVGPGPTLGNARQSFEDFEMQRSACLLGNGSSAD
                     DVAEAVAFLAAAKSITGQMIAVDGGQHLAWRTPDVDGIAE"
     gene            148072..148800
                     /locus_tag="MNOD_RS39110"
                     /old_locus_tag="Mnod_7921"
     CDS             148072..148800
                     /locus_tag="MNOD_RS39110"
                     /old_locus_tag="Mnod_7921"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631131.1"
                     /db_xref="GI:501739731"
                     /translation="MQNRKYLLLLAGVFCGTLVCTIILSGKIVSIFGLTFPASIVLFP
                     ATFMFGDILTEVYGYSVTRQVVWAGLISEIVWVAGYWTAAALPPAPFWSAQDAFVTVL
                     GLTPRIAVAGMTAYVVGEFVNSYVLAKLKVMTGGRYLAVRLVGSTVFGAAADTVIVLG
                     IAFAGIYTISQMFWMGLSVWFLKVVWELVALPVSMPLIAWLKRQENEDYYDRDTDFSP
                     FTLADRKRSLERARPAAGSAVSPL"
     gene            148816..149586
                     /locus_tag="MNOD_RS39115"
                     /old_locus_tag="Mnod_7922"
     CDS             148816..149586
                     /locus_tag="MNOD_RS39115"
                     /old_locus_tag="Mnod_7922"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008931931.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="O-methyltransferase family protein"
                     /protein_id="WP_012631132.1"
                     /db_xref="GI:501739734"
                     /translation="MTNCIADARSQEYIRAHYTRETPVLRELREYNATRPDSFLQITP
                     DQGAALRMLVGACGAKRILEIGVYTGYSAIWMASVLPEDGFLLACDIDPGVLAIAEPY
                     LRKAGLIDRIDFAVGPAQATLAKLLDQGAEGSFDLAFIDADKEPMNVYYEACLRLVRT
                     GGLIVVDNVLWEGRVADPDSTDPDAAAMRAIAARITADSRVDSCVLSVGDGLLVARKL
                     REAETVGIATGALSQELERGRSVGRSCLLSEPGRKEIE"
     gene            complement(150098..151816)
                     /locus_tag="MNOD_RS39125"
                     /old_locus_tag="Mnod_7924"
     CDS             complement(150098..151816)
                     /locus_tag="MNOD_RS39125"
                     /old_locus_tag="Mnod_7924"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase"
                     /protein_id="WP_012631133.1"
                     /db_xref="GI:501739737"
                     /translation="MRSVLSVSIGQYSSAGRKAANQDFHGALIPDGAMLAAKGIAVAL
                     ADGISTSRVSHVAAETAVKSLLTDYYCTSDAWSVKTSVRRVLNATNSWLHAETKRGQH
                     AYDLDKGYICTLSALVLKGRRAHLFHVGDCRVFRLSRGTLEQLTEDHRVILSSQESYL
                     GRALGMAPHVEIDYQAFDLDEGDIFILATDGVYQHAAPGFMARAVQDAGDKLDAAARR
                     IAEEAFARGSPDNLTVQAVRIDSLPDWDASAFAGFSQTLPAPPLLEARAVLDGYTILR
                     PLHHSHRSHLYLASDDASGSLVALKIPSVDLRDDPAYLQRFMMEEWIARRLDSPYVAK
                     APAQDRRRTQLYTVIEYVDGQTLAQWMTDHPEPDLETVRRIVEQIAAGLHAFHRREMV
                     HQDLRPENIMIDRHGTVKIVDFGSTRVLGVEEAQPLPHTDEGLGTLQYAAPEYFVGEV
                     GTPSSDLFSLGVIGYQMMTGRLPYGVEVARARTHKQQKRLTYIPAENLPDWIDGALRK
                     AVHPDPFRRYRALSEFLYDLRHPNPAFLGRGRIPLYERNPLLVWQALCFFLVLIIVCL
                     LTVHSR"
     gene            complement(151868..152713)
                     /locus_tag="MNOD_RS39130"
                     /old_locus_tag="Mnod_7925"
     CDS             complement(151868..152713)
                     /locus_tag="MNOD_RS39130"
                     /old_locus_tag="Mnod_7925"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate transporter"
                     /protein_id="WP_012631134.1"
                     /db_xref="GI:501739740"
                     /translation="MAYLAPSEFVTKMVDAGESKIFMSTRDTVIRAYMAGALLALAAV
                     FAVTVTVQTGSPLVGAILFPVGFCMLYLLGFDLLTGVFVLAPLALIDRRPGVTLGGVL
                     RNWGLVFIGNFAGALTVAVMMAIIFTFGFTTPPDPVGQRIGSIGESRTVGYAAHGAAG
                     MLTLFIRGMLCNWMVSTGVVGAMISTTVPGKVIAMWMPIMVFFFMTFEHSVVNMFLFP
                     SGLMLGGKFSIGDYLIWNEIPTVLGNLVGGLAFTGLTLYTTHIRTGEKRPARDARGAV
                     VYPAE"
     gene            complement(153048..154472)
                     /locus_tag="MNOD_RS39135"
                     /old_locus_tag="Mnod_7926"
     CDS             complement(153048..154472)
                     /locus_tag="MNOD_RS39135"
                     /old_locus_tag="Mnod_7926"
                     /EC_number="3.5.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631135.1"
                     /note="catalyzes the hydrolytic cleavage of imides that
                     range from linear to heterocyclic and that include
                     hydantoins, dihydropyrimidines, and phthalimides; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropyrimidinase"
                     /protein_id="WP_012631135.1"
                     /db_xref="GI:501739743"
                     /translation="MSKYDLIIRGGTVVTAADTIRADVAIHAGRIVAVADRLSGGTRE
                     IDAGGLLVMPGGIDSHVHLAQPAFGGPAMADDFESGTRSAIAGGTTTILPFALQPRGA
                     SLRQSVLDYHKEADGKSYCDYGFHLIISDPTPSVLGQELPALVADGYTSFKVFMTYDD
                     LVLNDRQLLEVFDCARDCGALVMVHCEGYDAIRFMTEKLERAGKTAPYYHAASRPASV
                     EREATHRAISHAELVEVPIMIVHVSGREPMEQIRWAQQKGLKVYGETCPQYIALTADD
                     LKGLNMDESGGKYVCSPPPRDRASWDAIWEGIRTGVFQTFSSDHCPFFYEGNQGKLNP
                     KARTSFRWVPNGIPGVETRLQILFSKGVVEGRITLNDFVALTSTNHAKMYGLYPGKGS
                     IAPGFDADIVIWDPNRKETIRQELMHHGADYTPYEGIAVTGWPIMTILRGKLVAEEGR
                     ILGTPGRGRFLKRSLSPFAEPRHS"
     gene            complement(154603..155409)
                     /locus_tag="MNOD_RS39140"
                     /old_locus_tag="Mnod_7927"
     CDS             complement(154603..155409)
                     /locus_tag="MNOD_RS39140"
                     /old_locus_tag="Mnod_7927"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_012631136.1"
                     /db_xref="GI:501739746"
                     /translation="MTDAEPIAVDGNRRLAGQTCIVTGAASGIGRAIARVFARHGAHV
                     VVADISETVLEGGEPTVKLIAHEGGSASFRKTDVSDATAVDALVADTSRLTGRLDVIV
                     NNACIRHARRLAELEEGDWDRMMAVNLKGVFLCCRAAVRQMLTQEIRNEARGRIINLS
                     SQHGMIAAPDDLAYGVGKAGIAYLTRQVAADYAADGIICNAVAPGKIVTGQGGRLLDE
                     AVLDRARRRTPWPRFGRPDDVAQAALFLASGEASFVTGINLMVDGGWMAA"
     gene            complement(155406..156374)
                     /locus_tag="MNOD_RS39145"
                     /old_locus_tag="Mnod_7928"
     CDS             complement(155406..156374)
                     /locus_tag="MNOD_RS39145"
                     /old_locus_tag="Mnod_7928"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018420232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase"
                     /protein_id="WP_012631137.1"
                     /db_xref="GI:501739749"
                     /translation="MTTLITGVSGFVGGALAAALVARSEDVIGVDRAPSPADPREGHG
                     TYRFQAADLRQNGALDPILAEARVDRLIIGAAITADAARERSDPVGVITVNVAAVADA
                     VRSAARHNVGRVLYLGSGAVYGDSAAGAGALVEDETPLRPRSLYAITKQAGEATALRL
                     ADTFGLDLVAARLGTCFGPYERDTGMRDTLSAPYQILRLAASGEPVRLPRPGRRDWLY
                     IRDAVSGLLDAERLNHPVYNVAAGHEWPLTEWCAHVASAYSDFRWSVSGPETANVNLY
                     DAFDRAPMSVARITADTTYRPAFDLAAVARDFLQEPFLQEPWSARQ"
     gene            complement(156393..157400)
                     /locus_tag="MNOD_RS39150"
                     /old_locus_tag="Mnod_7929"
     CDS             complement(156393..157400)
                     /locus_tag="MNOD_RS39150"
                     /old_locus_tag="Mnod_7929"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012631138.1"
                     /db_xref="GI:501739752"
                     /translation="MKAVRRWLACLAMIPLMAAAASAQDKPKIKLGFAKCAHCTPLVL
                     TPEYAKDIDLEVVPFNTGNDVLTALVSKSIDVGQITYLHYATALDKGFDVMAISGQVN
                     GGSQILLSNDLPVEPNDWAGLKTMIAERKAAGKPLKVAASRGNAQDIHMRGAFAKQGI
                     DIAKDVEFVNIPNPSDHAQALRRGEVDLICSVEPFATQIRQVKAGKFFTYPYDQSAGE
                     LTNLMLTRSDVIVANRKGLQSTVGAIVKVDDFVAKNHDAWVGVITKVTGLDKTIAEGA
                     IENLKPDYRMYKPQALAIAAMMKELKYISKDVSAEVSKNMDYSFLQAASGLSAADLGN
                     K"
     gene            complement(157429..158196)
                     /locus_tag="MNOD_RS39155"
                     /old_locus_tag="Mnod_7930"
     CDS             complement(157429..158196)
                     /locus_tag="MNOD_RS39155"
                     /old_locus_tag="Mnod_7930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_050783623.1"
                     /db_xref="GI:915398238"
                     /translation="MQRPPPTPTEAAAPRRRGRPRKRLEPAIGADQRVVRAGLHERAA
                     ERLRNMIVRGDLAPGAALIEVELSEMLGISRTPIREAIKLLAQQGLVELRANRSPCVR
                     PLRVAEIRELFEALAGIERIAAEFAAMRITEAELKRLHELQAEIVREHKAGRRDSYSA
                     ANRTIHRTIVLAARNAPLAEAHAALLSRAEQVRVFALGLEDRWEQSILEHQAILDALE
                     TRDSGQAGRLLQEHVGQTADVVAASLAGRNSPTSSAA"
     gene            158397..159248
                     /locus_tag="MNOD_RS39160"
                     /old_locus_tag="Mnod_7932"
     CDS             158397..159248
                     /locus_tag="MNOD_RS39160"
                     /old_locus_tag="Mnod_7932"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631141.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012631141.1"
                     /db_xref="GI:501739761"
                     /translation="MQTASERLPAVRHAAAWRIWSKLERVVVPVLILAGWEAFSRSGY
                     LPQSLLPPPSAVLHALGDWVLGVDGSTQDYSGTWLRHALSSTWRVLAGFVIAGLSGIL
                     IGTAIGWSRSAEKTLEPTLQMLRPVPPVSWIPLAIIWFGIADKPAIFLVFLGAFFPTL
                     MNTIHGVKTIDRNLIRAGAMMGATGRQLLMHIVVPAALPSIFAGLRIAIGSAWMLTVT
                     AEMVAVKSGVGYVLWDSYYFLRYDMVIASMVSIGLLGYLSDFAIKQLMSVVLRWQRNT
                     TVQGREG"
     gene            159251..160027
                     /locus_tag="MNOD_RS39165"
                     /old_locus_tag="Mnod_7933"
     CDS             159251..160027
                     /locus_tag="MNOD_RS39165"
                     /old_locus_tag="Mnod_7933"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="WP_012631142.1"
                     /db_xref="GI:501739764"
                     /translation="MAEIAIRNIVKTFTDRARGREVMALDNVSLNIGDHDFVCLLGPS
                     GCGKSTLLNMIAGFEGPSSGRVEVGGSLVTRPGADRGVVFQQPTLMPWLNVADNVAFH
                     LKLRGVRRAERRERAQHFIDLVGLNGFEGHYPSELSGGMNQRVGIARVLLMNPRVILM
                     DEPFAALDAQTKLDMQEELVAIWQRIRCTIVFVTHSVDEALVLGNKIAVMTRRPGRIR
                     DYFDFDMPRPRDITSPEFNDAKRRVLGLIREEAGTSRKAA"
     gene            160045..160491
                     /locus_tag="MNOD_RS39170"
     CDS             160045..160491
                     /locus_tag="MNOD_RS39170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006815847.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753950.1"
                     /db_xref="GI:760071140"
                     /translation="MTDKGDPRQACDLLLTGGTVLTLDAEDRIVADGAVVDGRIAAIA
                     SADRLGLGEKIGSLAVGKRADILVMDTDAPTMAPLIDGWGILVYGANGMNVRSVVVNG
                     RLVLEDGTLLTADGPAIVREAQAVAENLWSRAGQRPITGPAHRPAH"
     gene            160527..161279
                     /locus_tag="MNOD_RS39175"
                     /old_locus_tag="Mnod_7935"
     CDS             160527..161279
                     /locus_tag="MNOD_RS39175"
                     /old_locus_tag="Mnod_7935"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="WP_050783649.1"
                     /db_xref="GI:915398264"
                     /translation="MRLGMLTPSSNTVLEPVLARMTAQTDISVHYSRFRVTEISLSQQ
                     GLGQFAFDAMVQAAELLAHAKVDVIAWNGTSAGWLGFPQDEELCARITATTGILATSS
                     VLAFRDAFRSLGTKRVGLVTPYTTDVQRRITANWEAAGFPCTAERHLGLADNFSFAET
                     TGEVIADLVRQVARDGCEAAAIVCTNMRGAAVAPMLERELGIPVIDSVAVTLWASLRL
                     IGAATGDFVDWGQIFSISNAASGASLNVKAIA"
     gene            161324..162046
                     /locus_tag="MNOD_RS39180"
                     /old_locus_tag="Mnod_7936"
     CDS             161324..162046
                     /locus_tag="MNOD_RS39180"
                     /old_locus_tag="Mnod_7936"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="WP_050783650.1"
                     /db_xref="GI:915398265"
                     /translation="MTERMLAAGQSAAAPGTTLVPLTAGRGVPYIATRAEAQIGGAIA
                     LEMLAEHHREVDAAIIAAFGDPGLFGARELFDIPVVGLAEAAMLTACMLGRRFAIVSF
                     ARALGPWYEECVAMHGLAGRCAGIRLLDSPFQQVAEVQEEKEDLLVQLANKSVREDEA
                     DVVILAGAPLSGLAAKVAHRILVPVVDQVAAAVKQAEALLALKPRKATEGTFKRPPAK
                     RVIGLPDSLAARITHSDGNFET"
     gene            162142..162525
                     /locus_tag="MNOD_RS42245"
     CDS             162142..162525
                     /locus_tag="MNOD_RS42245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015586861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783624.1"
                     /db_xref="GI:915398239"
                     /translation="MWTDRHRTRHEARLKDMLMPAGLDEVARFLARADPPGRANAQPA
                     RWVLAAVAWHLRVGGAWRALPAGLPPWRTVCGWFRRWIDKGLFARLMRALARRQRRRC
                     GRRSAPGDHRHAKRQVHRRARPARR"
     gene            162503..162988
                     /locus_tag="MNOD_RS42250"
     CDS             162503..162988
                     /locus_tag="MNOD_RS42250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013039115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783625.1"
                     /db_xref="GI:915398240"
                     /translation="MRGPRGDDGAKKRVGRTRVALVDGEGHILALAVVPAHGQGRDPL
                     PALDTGKVEWTSLRLAILAGAFTAERCEDGCHRHGMRCRVVEMDPDQKGFVVLERRWL
                     VERTFGWFSHGGGLHRERAGRLDGATGRRACVASLMAANALNNPARDHALKQALRGRS
                     G"
     gene            complement(163127..164074)
                     /locus_tag="MNOD_RS39190"
                     /old_locus_tag="Mnod_7938"
     CDS             complement(163127..164074)
                     /locus_tag="MNOD_RS39190"
                     /old_locus_tag="Mnod_7938"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="WP_012631145.1"
                     /db_xref="GI:501739775"
                     /translation="MATLLLVEHAHGAPKDGSLKALTAARQLGAPVHALVTGAGSRPA
                     AEATARLEGVEKVLLAENAAFDHLLAEPTAALLAELAAGYDAVIAAASTEGKNVLPRV
                     AALLDVAQVSDITKVVAPDTFERPIYAGNAIQTVQVSEPKKVITVRTAAFKAAEAGGA
                     PAPIEAAAAAVAPEVKSAFKGEEIAQSDRPELASARIVVSGGRSLGSAEKFRELIEPL
                     ADALGAAVGASRAAVDAGYAPNDWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKV
                     IVAINKDEEAPIFQVADYGLVGDLFQIVPELMDAIEHGR"
     gene            complement(164106..164855)
                     /locus_tag="MNOD_RS39195"
                     /old_locus_tag="Mnod_7939"
     CDS             complement(164106..164855)
                     /locus_tag="MNOD_RS39195"
                     /old_locus_tag="Mnod_7939"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit beta"
                     /protein_id="WP_012631146.1"
                     /db_xref="GI:501739778"
                     /translation="MNILVPVKRVVDYNVKIRVKPDGSGVDLANVKMAMNPFDEIAVE
                     EAIRLKEKAKVSEIVAVSIGPQQAQETLRTALAMGADRGILVRTDAPVEPLAVAKLLR
                     ALVDKEQPQLVILGKQAIDDDANQTGQMLAALLGWPQGTFAYRIELGEGSLEVTREID
                     GGLQTLTLALPAIVTTDLRLNEPRYASLPNIMKAKKKPLDTLEPAALGVDVAPRLKVL
                     KTVEPGGRQAGVKVASAAELVSKLKGEAGVL"
     gene            complement(164878..165798)
                     /locus_tag="MNOD_RS39200"
     CDS             complement(164878..165798)
                     /locus_tag="MNOD_RS39200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007014712.1"
                     /note="catalyzes the thiolytic cleavage of
                     beta-ketoadipyl-CoA to succinate and acetyl-CoA; Derived
                     by automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoadipyl CoA thiolase"
                     /protein_id="WP_050783626.1"
                     /db_xref="GI:915398241"
                     /translation="MEAVAQAARAIASGQGDFYIAGGVESMSRSPFVLPKAETAFARE
                     ATIQDTTIGWRLINPRMEARYGVDPLGITAENVAEEYGVGRADQDAMALRSQERAARA
                     QANGWLAREIVPVRARRGREMVEVSADEHPRATSLEQLAKLKPAFRPDGSVTAGNSSG
                     VNDGAAAIVVASERAVRAHGLMPRARFLGAASAGVAPRVMGIGPVPATMKLLDRLGLT
                     LGETDLIELNEAFAAQGIAVLRAQGVKEDAEHVNPNGGAIALDHPLGMSGARLIMTAT
                     EELVLSRRQRALCTMCIGVGQGIASVIERV"
     gene            166254..166727
                     /locus_tag="MNOD_RS39205"
                     /old_locus_tag="Mnod_7942"
     CDS             166254..166727
                     /locus_tag="MNOD_RS39205"
                     /old_locus_tag="Mnod_7942"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631148.1"
                     /db_xref="GI:501739786"
                     /translation="MSEGYPSMTALLGLLALAGYQNRDKLAELFGGGGQQSAPVAGAP
                     SGEGNSGGLGGLLGSLGGAPGGAGAGRFLHSGLAEMLERFQQSGHGPIAQSWVNHGPN
                     QEISPQQLEQAIGPDVLATLSQRTGLSREELLSRLSRDLPQAVDRYTPDGRVPAY"
     gene            166871..167134
                     /locus_tag="MNOD_RS39210"
                     /old_locus_tag="Mnod_7943"
     CDS             166871..167134
                     /locus_tag="MNOD_RS39210"
                     /old_locus_tag="Mnod_7943"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017983728.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631149.1"
                     /db_xref="GI:501739789"
                     /translation="MGQDVVFDLPLADLPAVGTEPSDRLAMTKSWIVREVTQAAGEVI
                     GMPCFTDGSVLQGAFGRCPTVILGPGEHSQAHQTNECYGIQWA"
     gene            complement(167122..168561)
                     /locus_tag="MNOD_RS39215"
                     /old_locus_tag="Mnod_7944"
     CDS             complement(167122..168561)
                     /locus_tag="MNOD_RS39215"
                     /old_locus_tag="Mnod_7944"
                     /EC_number="3.5.2.2"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="WP_012631150.1"
                     /db_xref="GI:501739792"
                     /translation="MSTDYDLLIRGGEAVLPGRGRTACDIAVRDGRIAAILAPGAPAT
                     APSELDARGLVVMPGAIDVHLHLGHGRDIARPRVPEDAARESAAAASGGITCFIPYLM
                     TSEPFSTVLPEVIAVTQAGSRIDFSYHPIISTEEQLAEVERCAREFGAPTFKIFMNNR
                     GGEGARLGLPDIDDGFLLRLCEAAARAGGMVCPHPETIELAWVTRDRAKAADPDGIGG
                     LATWNASRPPFVEADAVQRAGYVAKTAGAPLYVVHTSSAEALAAGLRQRQAGATLFLE
                     TCPHYLTHDIGWTGGDLGKINPPLREAADREALWAGILSGAIDTIATDHVHRGLEAKA
                     GGIWAASPGCPGLETLLPVLLSEGYHARGLSLERVVDLVSTNPARLMGLAHRKGAIAP
                     GLDADLAVIDLDAAWTFDRGAVLSSAGYSLYEGWQFRGRVVHTAVRGHLVLRDGALQD
                     ERIGIGRYVSRSLATQHRCAAPSGLLHAH"
     gene            complement(168558..169955)
                     /locus_tag="MNOD_RS39220"
                     /old_locus_tag="Mnod_7945"
     CDS             complement(168558..169955)
                     /locus_tag="MNOD_RS39220"
                     /old_locus_tag="Mnod_7945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014200020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="WP_012631151.1"
                     /db_xref="GI:501739795"
                     /translation="MTIARSLARRVRALARDKLPPAVDAAARLHLLDAIGVGLAAAAS
                     EAGAPYRRYAAGVARGGPAPILGLSATAAPADAALVNGGLIHGLEFDDTHTGSIVHGS
                     AVLAPAALAAGQAAGSSGAAVLSGYALGWEALIRIGLAAPGAFQAWGFQITSVGGALV
                     AALIAAELAGLSEDETVAAVGIALSGASGGFEFLTNGASVKSLHPGFAAHAGLTAAAL
                     AQAGLTGPETAFEGRCGLFAAFAGDARAAEAFAASLDDLGTVWHLQDAAFKFHPCCHY
                     LHPFVEAAGMLAARGVEADDIASLTCRVPAGAGPVICEPWEAKQAPVTGHAARWSLPV
                     VVAARLVEGRVDLATFEAPAGEAVRALSRRIGWEPLAGARFPAVFEAEILALMRDGEQ
                     HHVRVDDVYGNAGRPAEAAAVREKFRSNAARALASDAIRGVEAAVDELTAAPSLDALE
                     AALSKAASHPARSDA"
     gene            complement(169952..171322)
                     /locus_tag="MNOD_RS39225"
                     /old_locus_tag="Mnod_7946"
     CDS             complement(169952..171322)
                     /locus_tag="MNOD_RS39225"
                     /old_locus_tag="Mnod_7946"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase"
                     /protein_id="WP_012631152.1"
                     /db_xref="GI:501739798"
                     /translation="MSEDDLDILVIGAGACGLAAAVAGHDAGASVAVIEKQERPGGNS
                     SLSTGSVPAAGSRFQREAGIDDDPARMVRDLMAIARETDDRALVERLAGVSAETVEWL
                     VDTVGARLALITAYKHIGHSVPRLHAPVSRRGQDLVDDLVAAAERRGIPIAVGNGATD
                     LLVEDGAVRGAIVSVEGERTEIRAGKTILALNGFAANPDLVRRFCPEIAGAQYFGARG
                     STGEAVLWGERLGAALANMAAYQGYAAVAYPQGSLLSWTTVEKGGIIVGDDARRFGDE
                     SLGYSGYARIVLSRGGDAYVVFDQKIFDVAAAEEEFMELWTYGGLKRGETPAEIARPF
                     GLDAAALGEEIAMRNAAAAGTAPDRHGRRDFGLGPLEPPFYIGRVVPGLFHTQGGLKV
                     DGDARVLRPDGTPVPNLFAGGGAAAGISGRSGALGYASGNGLLSAIALGRLAALAAAR
                     ELGRTP"
     gene            complement(171319..172710)
                     /locus_tag="MNOD_RS39230"
                     /old_locus_tag="Mnod_7947"
     CDS             complement(171319..172710)
                     /locus_tag="MNOD_RS39230"
                     /old_locus_tag="Mnod_7947"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003819771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="WP_012631153.1"
                     /db_xref="GI:501739802"
                     /translation="MKARRDAGLRARTAEAARALAAWAAEAVRGDLPDAVRDRAALIL
                     ADDLGAMVAAADEPPVARMRAVLARSSGVPEATVFAPGAPRLDRASAASANGLAATWC
                     ELDEGYRGAPCHAGAYVLPALLAEAEARSETVSAVLAALAVSYEIAVRCARAFPFETM
                     TVHPHAAFATIGAAAGIGLIRGFDAERLLDAVSAAATMAFAGPYDHAIEGALVRNAWT
                     SAGAWIGLRAADGAEAGIAGLPESFYDVFAGAFGTGCVPQALAEGLGTDWAVLGGYHK
                     VFACCQYAHAAIEATLALRQRFAGCRPEEIEEIVVETHPRGLTLTNVEPATVLAAKFS
                     MPHAVAASAITGTGGQGAFDQRTLDDPQIAALRRRVRLEALPEIGPPPHDRPSRVTWR
                     LRDGAWLTELCESARGGADQPFDTGTMLEKLRETTRGFPRMASCLGAIVQGGRGAAPW
                     RDCVAEMTSEVVR"
     gene            complement(172714..173397)
                     /locus_tag="MNOD_RS39235"
                     /old_locus_tag="Mnod_7948"
     CDS             complement(172714..173397)
                     /locus_tag="MNOD_RS39235"
                     /old_locus_tag="Mnod_7948"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012631154.1"
                     /db_xref="GI:501739805"
                     /translation="MLEIRSLSAGYGTLTALDGISARLSAGARLGIFGHNGAGKTTLL
                     RCIVGAHAARAGEVVFDGEPVRPGNVPATIRRGIAFVPQGHNVFPNLTVAQNLATAGL
                     LFDRGFVGEVLKIFPLLEERRSQRAGSLSGGEQQMLALGMALMTQPKWLLLDEPSTGL
                     APVIVRNVMSQLAKVNAAFGTGLIIVEQNVPATLKVVEHCLILKSGRTVFEGTAETLS
                     AKPDLWEWF"
     gene            complement(173402..174160)
                     /locus_tag="MNOD_RS39240"
                     /old_locus_tag="Mnod_7949"
     CDS             complement(173402..174160)
                     /locus_tag="MNOD_RS39240"
                     /old_locus_tag="Mnod_7949"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012631155.1"
                     /db_xref="GI:501739808"
                     /translation="MTPVLEIAGLDKRFGGIVVADGIDLTLPAGRIVGLIGPNGAGKT
                     SLFNLISGVFPSDAGTIRLDGQRLDGLPMHRRAGLGLARTWQNLRLFPSLSVLDNLMV
                     GPRRYPGDRLLRLALDPFGVRAQEAETRRRAREILERTRLAAVAATRAADLTFGQQKL
                     VGVARALMNDARCLLLDEPMAGVEGQAYEVMQQVVRDVAAGGVAVCVVEHNVAFIRDL
                     CDEGVFMFAGKVLARGPVADLIADPRLTELYFGT"
     gene            complement(174160..175041)
                     /locus_tag="MNOD_RS39245"
                     /old_locus_tag="Mnod_7950"
     CDS             complement(174160..175041)
                     /locus_tag="MNOD_RS39245"
                     /old_locus_tag="Mnod_7950"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012631156.1"
                     /db_xref="GI:501739811"
                     /translation="MDYLFTLAILIGLSIALASSFNLIIGYAGLISIAHPVFYAIGAY
                     VSALLARDLGVPVPLAMLCGALAAAAASAAVALPSLRVSGDYLLIASIGFQLGVLEAI
                     KNIAVTGGAGGLTNIPPFLVHEAGRGAYVALVLGFAALTVWLNWTIAHGPYGRALSAM
                     RDDELAFAGLGRNAVSMKVAVFAFGSAVAGLAGALYAHYFRFVTPEQFEILQSAALLT
                     MVVVGGIRTTWGPVLGAVLLQALPQAITFLDLPPALLGPLQGLMFTGLVLVFMFWRPQ
                     GLIAAGDAWRPSKRETA"
     gene            complement(175044..176012)
                     /locus_tag="MNOD_RS39250"
                     /old_locus_tag="Mnod_7951"
     CDS             complement(175044..176012)
                     /locus_tag="MNOD_RS39250"
                     /old_locus_tag="Mnod_7951"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011578919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="WP_012631157.1"
                     /db_xref="GI:501739814"
                     /translation="MLTFDILAQVLWTSFATSTYLVLFAVAFALVLKVNRIFNFAQAA
                     VMTVAFYAAHATVSMAGLPGWLGCLLALVAAVTASALLELVGFRSLRRRRATPMFVFI
                     FTLIVSEMVAYLAMLIFGTWPTTIFPSLFWPVTLVGNVAVSDWDLPAIASMVGALALL
                     FGFLRYAQTGRFMIAVADNPDLAELYGIEKDRVYLATIVTAGLLVGIGMCLYGSRAQV
                     QPTTSIELMLFAVAATIIGGIGNLWGAALTAVALGVVQNASVLFIPAEWQGFLLYVFL
                     FLAIVFLPNGIRLPDRRRGLARRIARVDLGETKPAETAAASGRGKA"
     gene            complement(176048..177202)
                     /locus_tag="MNOD_RS39255"
                     /old_locus_tag="Mnod_7952"
     CDS             complement(176048..177202)
                     /locus_tag="MNOD_RS39255"
                     /old_locus_tag="Mnod_7952"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012631158.1"
                     /db_xref="GI:501739818"
                     /translation="MRQSAPSVSRRAFLAASLAAAAIGPARAEEALRFGMAMPLSGGQ
                     ATYGQDQVKAAEWAVAAINERGGVAGRKLEMIVLDTRADPQAGIQAANRLISVDKVPV
                     FVSAWSAVVKAVAPVANDSRTVQLSVGANSAEIARLGDYTYTTFPLASVDITAVATYA
                     AKQMGKKRAAVLYINNETGTVAAQIYRDVFAKSGGQVVAYEAYDPRASDWTGPLLKVR
                     AAQPDIVHIQGLVADTPQVIAQMRQLGLTLPVSSYSAVYNPKLIEQLGKAAEGVIATS
                     LAPGVTDSPAVAAYVERWKKEVGREPNGLPYTQYLYDAPYIVAEVYRSLIEKKIPLSG
                     ENFRKEMLAIRSFDLPLTGKLVINDDHTVNKPVFLMEVKGGRWVQKAVVE"
     gene            complement(177279..177962)
                     /locus_tag="MNOD_RS39260"
                     /old_locus_tag="Mnod_7953"
     CDS             complement(177279..177962)
                     /locus_tag="MNOD_RS39260"
                     /old_locus_tag="Mnod_7953"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_012631159.1"
                     /db_xref="GI:501739821"
                     /translation="MDRKPWDGLISEEEQRAYNAAGFGRATGLGRRPALLIIDVQYRT
                     TGTTPMPFWEAIKEYPTACGDVAWAAVERIERLLGLFRERGWPVLYPLVAPKAAFDRG
                     RLSDKVPAIMTVAAKGYEFPPEIAPREGDILLPKKHPSAFFGTPLTSYLINLQADSLV
                     VTGCSTSGCVRGSVVDAFAYNFRVLVPHDAVYDRSATSHAVNLFDMASKYADVMSTDE
                     ALEALRALV"
     gene            complement(177974..178840)
                     /locus_tag="MNOD_RS39265"
                     /old_locus_tag="Mnod_7954"
     CDS             complement(177974..178840)
                     /locus_tag="MNOD_RS39265"
                     /old_locus_tag="Mnod_7954"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631160.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /protein_id="WP_012631160.1"
                     /db_xref="GI:501739823"
                     /translation="MRATQTLKSILARREAVSVPGAANALFARVIEDLGFEAVYVTGA
                     GVANMQLGAPDIGLTSITEVASTVAAVADAVALPIIVDADTGFGNAVNMIRTVRLLER
                     AGAAGIQIEDQVFPKKCGHFTGKDVIPRDEMVQKVKAAVDARRDGDLQIIARTDARAV
                     EGLERAIERAQAYIEAGADATFVEAPVSAEELGRIARDLKVPQVANIVFGGKTPDPGR
                     ERLAEMGFSIVLYANAALQAALKASYEVLGALKRDGSLSAVADRLASFEERQRAVAKD
                     EWDALEARYRAA"
     gene            179328..180029
                     /locus_tag="MNOD_RS39270"
                     /old_locus_tag="Mnod_7955"
     CDS             179328..180029
                     /locus_tag="MNOD_RS39270"
                     /old_locus_tag="Mnod_7955"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007671307.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012631161.1"
                     /db_xref="GI:501739826"
                     /translation="MTALFPIAATSLVDEAFTKLVAAITSGEFAPGERLSEAELARQL
                     GISRGPLREALHRLEGRLVVRTPRIGVRVVEFDRDTLEQLFLVREALEGMAARLAAER
                     MTSREQDEIANLLDRHAGQPDVASGKSYVQVSTDEDFHFAIVRSSRNPRLEQLLLDEV
                     YYQLRLHRLRSSTRPGRAQAALAEHREILAALQSRDPDRAEEAMRKHIRSARFSALAD
                     LEATGTSKSRSKHKA"
     gene            complement(180031..180330)
                     /locus_tag="MNOD_RS42255"
     CDS             complement(180031..180330)
                     /locus_tag="MNOD_RS42255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007676741.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783627.1"
                     /db_xref="GI:915398242"
                     /translation="MVVSIQGRRLHLWRAVDAEGEVLDLLVQPRRDQKAALKLLRKLI
                     MKQGFAPEKLVTGKLRADAAAHRELGLSAQQEQGLRQNARAENPSHIHLLIKFQN"
     gene            180347..180628
                     /locus_tag="MNOD_RS42260"
     CDS             180347..180628
                     /locus_tag="MNOD_RS42260"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783628.1"
                     /db_xref="GI:915398243"
                     /translation="MLAGRGRRRRRVRAKAGPDLDRPSPDTPVRDTDAALGQEFLGIA
                     VAEAQMQPDGVADDLGWERVAGVRDGLQAPCPTAAGAGVPSLRATMPLG"
     gene            complement(181615..181989)
                     /locus_tag="MNOD_RS39280"
                     /old_locus_tag="Mnod_7958"
     CDS             complement(181615..181989)
                     /locus_tag="MNOD_RS39280"
                     /old_locus_tag="Mnod_7958"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012631163.1"
                     /db_xref="GI:501739834"
                     /translation="MTGERVSRGCILIAEDEALIGIELADQLELRGFAAAGPFTTCSE
                     AEQWLRYNEPVAAILDNTLADGPCDALAQDLESRGIPFIVYSGYDHTASLPSVFQRAP
                     WIVKPASVETVLDHLSGLLGDK"
     gene            complement(182143..183393)
                     /locus_tag="MNOD_RS39285"
                     /old_locus_tag="Mnod_7959"
     CDS             complement(182143..183393)
                     /locus_tag="MNOD_RS39285"
                     /old_locus_tag="Mnod_7959"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631164.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_012631164.1"
                     /db_xref="GI:501739837"
                     /translation="MPEAGIWRKRLPRLNPGLSCVVAVYPALRVPRVAGASECAAWDE
                     EKRLAALRAYQVLDTPNEDGFDEIVQLAAQICQTPMAAISLVEDRRQWFKAEVGLGIR
                     ETPIDASVCATTVLAPGLTIVPDMILDARFATNPLIASCPYLRFYAGARLETPDGLPL
                     GSLCVLDRNPRPGLSSEQASALMTLSRQVTNQLELRRTVIERDEALSRVRQTETRQHL
                     LVRELHHRTRNNLAVLQALFGVTTRASGSVDELYRSFADRIASLARTQALLSDDYWQT
                     ARLHDMLAHEFEWHIKHRNGRVVLDGPELDLAADLAVPFGMALHELRSNAERHGALSS
                     ADGKVEVKWSLIRQDGKRLLHLNWSEQGGPRARKPFRAGVGMKIQRMLEVQCGAEVKT
                     EFLTEGLHVSITAPLIEARLVPEY"
     gene            183767..184327
                     /locus_tag="MNOD_RS39290"
                     /old_locus_tag="Mnod_7960"
     CDS             183767..184327
                     /locus_tag="MNOD_RS39290"
                     /old_locus_tag="Mnod_7960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015932727.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631165.1"
                     /db_xref="GI:501739840"
                     /translation="MTRKRVQRPFTVEVKGRSRLQPAGQEISKPSTSSPPPSVLWAGT
                     DLGRELARAGEKFSNLVSARPAEKQKVEARRVLPSLLVAEPITVEPDPEPTLEPRLPR
                     VRRVTSAKKVTKTTRSKRNAASPANSQPPIRVEPAPQPTPATPARSAAPPIPLRVTRS
                     RRSRAEAVQPLKPGQRWKRRLSRFCR"
     gene            184573..184947
                     /locus_tag="MNOD_RS39295"
     CDS             184573..184947
                     /locus_tag="MNOD_RS39295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012251909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783629.1"
                     /db_xref="GI:915398244"
                     /translation="MDVPGLGCFQVAPRECQAAVLEQVLDQAVTGSRSVITPAESLRQ
                     LRQRGWVRNRFLRLTAAEASALTGIEFSFAPPAAAISAWATAVARSGILVPAGGAERW
                     TLWNGIIPALRDIRRPRSAFTT"
     gene            185004..185276
                     /locus_tag="MNOD_RS39300"
                     /old_locus_tag="Mnod_7962"
     CDS             185004..185276
                     /locus_tag="MNOD_RS39300"
                     /old_locus_tag="Mnod_7962"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631167.1"
                     /db_xref="GI:501740095"
                     /translation="MSDTAGIPGDRIRTIIERVEKLEEEIKDLTEAKKEIFLEAKSDG
                     LDVKILKEIIKLRKQDQDERDEHETLLDVYLRAMDAPTPTPSAQAA"
     gene            complement(185405..185659)
                     /locus_tag="MNOD_RS39305"
     CDS             complement(185405..185659)
                     /locus_tag="MNOD_RS39305"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753956.1"
                     /db_xref="GI:760071147"
                     /translation="MPAYATMIHKSQGSEYPAVVIPITTQHWTMLARNLLYTGVTRGK
                     RLVVLIGQRKAIDMAVRGRTAKWRYTKLGKWLTSCQARQP"
     gene            complement(185692..185943)
                     /locus_tag="MNOD_RS39310"
     CDS             complement(185692..185943)
                     /locus_tag="MNOD_RS39310"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753958.1"
                     /db_xref="GI:760071149"
                     /translation="MFLKGLHAAERSIAERLSARAAGAPPWPDINLGNARPWAEQKTG
                     KVLSPSQAEAVRLMLGAKLSILTGGPGVGNPPALVERFG"
     gene            186105..187151
                     /locus_tag="MNOD_RS39315"
                     /old_locus_tag="Mnod_7964"
     CDS             186105..187151
                     /locus_tag="MNOD_RS39315"
                     /old_locus_tag="Mnod_7964"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631168.1"
                     /db_xref="GI:501740098"
                     /translation="MKYYAGLDVSLEETAICVVDDTGRIVREARAASEPGALVQALNQ
                     IGLPLERIGLEACSLTAWLHDGLREAGLPAICIETRQANAAMKTMPNKTDRNDARALA
                     QIMRTGWFRQVHVKSRQCRPWRSLLVARRTVLNEMRSIENVVRGILREAGLKLGTPGR
                     AAFAGRVRELAEGVPLMTQLVEPLLEVLASMLTALAGLTKQVMDLVKKEAVCQRLMSV
                     PGVGPITALAFRATIDRPDRFRRSRDVGAHLGLTPARYQSGETDIQGKISRCGDELAR
                     TALYEAAHTLLVRSQKWSSLRAWGMKIARRRGMARARVAVARKLAVILHRMWSDGTAF
                     RWGKEPAEGATLAG"
     gene            187221..187415
                     /locus_tag="MNOD_RS39320"
     CDS             187221..187415
                     /locus_tag="MNOD_RS39320"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043747842.1"
                     /db_xref="GI:760064987"
                     /translation="MGTMGLAISLRVQNLRVQTRKVVKQIETPRPPDPIMRRPSADRE
                     EKRVTHGATQAGETTTSSLT"
     gene            187488..187847
                     /locus_tag="MNOD_RS39325"
     CDS             187488..187847
                     /locus_tag="MNOD_RS39325"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753960.1"
                     /db_xref="GI:760071151"
                     /translation="MLAPRLEGLFQGPKQFLGLRGVLALLGHPLDQGDLLDHALLARG
                     DIHISLGEMIAFCPNMGHGTADHAPDRARKPEISRKAALWNAKQLLRTGFARFRAGLP
                     GRQSKASLPASGGASRR"
     gene            complement(187848..188387)
                     /locus_tag="MNOD_RS39330"
                     /old_locus_tag="Mnod_7965"
     CDS             complement(187848..188387)
                     /locus_tag="MNOD_RS39330"
                     /old_locus_tag="Mnod_7965"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012631169.1"
                     /db_xref="GI:501740103"
                     /translation="MDGSGSRHSRGPTAAAILFGLGLGGFFDGSVRHQILHGPHMLTS
                     AGYPADRVGNLKANTLGDGLFHASTSLVTWAGLFILWRDARQNHIRWSGLLLPGGILM
                     GFGIFNLVEGTVDHHLRGPHQVNQTVPRETWIYWDGGFLLWGAAMLIGGWAMLRQGQA
                     STRAKAASKPLWTAKITSD"
     gene            complement(188635..189660)
                     /locus_tag="MNOD_RS39335"
                     /old_locus_tag="Mnod_7966"
     CDS             complement(188635..189660)
                     /locus_tag="MNOD_RS39335"
                     /old_locus_tag="Mnod_7966"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding protein"
                     /protein_id="WP_012631170.1"
                     /db_xref="GI:501740105"
                     /translation="MAIINGTPGPDQLVGTNGPDLINGLAGDDILLGLAGNDEINGGP
                     GFDRIDGQDGNDILDGGDDVDYIAGGLGNDTIYGRGGADQLIGEAGDDLIFGNEGDDY
                     AAGNPGNDILYGGDGNDFFVGEAGFDYVSGDNGNDFVKGGDDDDTVLGGTGDDLVEGD
                     LGNDFLDGGAGRDVLYGDAGNDRILAGLDDDQALGGLGDDVLFGEFGNDFLRGEDGND
                     FIGAGAGNDDLSGGAGNDALYGEAGNDLLFGNAGNDELVGGTGSDTFGFGRGDGQDLI
                     RDFVTGGPERDVIAFNGGVFTSFAAVQAATQQVGADAVISYGAGDTIRLQNVQASSLT
                     AANFTFS"
     gene            191330..191533
                     /locus_tag="MNOD_RS39340"
     CDS             191330..191533
                     /locus_tag="MNOD_RS39340"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753963.1"
                     /db_xref="GI:760071154"
                     /translation="MQVRELRSARQTSLAYRLTGSHHVPRAYPQAVPGEMAVLRLVAP
                     SVSDHEAIAALDTGDSSTPGLTY"
     gene            191705..191926
                     /locus_tag="MNOD_RS39345"
     CDS             191705..191926
                     /locus_tag="MNOD_RS39345"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753966.1"
                     /db_xref="GI:760071157"
                     /translation="MVHIVLHEAGVPWLAGERQTQRNALGAGYRDLRKEYRNGQSRSE
                     YRSHENRNSASGIMANREGASAIVDQWQP"
     gene            192617..192892
                     /locus_tag="MNOD_RS39350"
     CDS             192617..192892
                     /locus_tag="MNOD_RS39350"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753970.1"
                     /db_xref="GI:760071161"
                     /translation="MRRCQRSSSAWGLVPLGLRDALCAILRREDHVGAFADGFGAGET
                     EKALGTRVPAGGNAALIDGKDREIEGTLDDDLEQLSLVSQQVLRGGA"
     gene            192903..193343
                     /locus_tag="MNOD_RS39355"
     CDS             192903..193343
                     /locus_tag="MNOD_RS39355"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753971.1"
                     /db_xref="GI:760071162"
                     /translation="MRGSARRWRTTTMPSARDLMLLDRAVTLRGQVTACIYVCEGAAM
                     PAASLRTQQQGTALRRIFPAVSPAAFFRLLHDLRQSSGEVLWFERFLPTRHILVGARY
                     GGLIVACGEDERHAILPQSIREGEDELAFQVDVQYSCVHRLIGG"
     gene            194814..195053
                     /locus_tag="MNOD_RS39360"
                     /old_locus_tag="Mnod_7972"
     CDS             194814..195053
                     /locus_tag="MNOD_RS39360"
                     /old_locus_tag="Mnod_7972"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631176.1"
                     /db_xref="GI:501740123"
                     /translation="MPLLEAYNLFRRKGKPALCCAVRQDRPVPTFVQSEAWEEAWEYA
                     GTVSASDSTPAGFKAKAAREATAVSGYYLFYALNG"
     gene            195800..197407
                     /locus_tag="MNOD_RS39365"
                     /old_locus_tag="Mnod_7974"
     CDS             195800..197407
                     /locus_tag="MNOD_RS39365"
                     /old_locus_tag="Mnod_7974"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-amylase"
                     /protein_id="WP_043753979.1"
                     /db_xref="GI:760071171"
                     /translation="MNDAHSPADRPWWQQEVIYQIFTPSFQDSNGDGIGDLAGILSRV
                     DYLARLGIGAVWLTPIYPSPLLDAGYDIADFTGVGSCFGDLATFDRLLTALHDRGIRL
                     ILDLVPNHTSDQHPWFIESRSSRYNPKRDWYIWADPVPGPLPPNNWLSRFGASAWAYD
                     PTTGQSYYHAFLPEQPDLNWRNPQVRAAIHDAMRFWLRRGVDGFRVDAAAVLAEDALL
                     RDEPPNPDFDGDTPRPERFRRTRTDSQAVTRGYLTELRRVVDEFPDRVLLGEVDTTPD
                     KLPSFYGEDEPRLHLPLNYRLLEVPWKPDAVGRAVQAFLDTMPESAWPDWVLGSHDKP
                     RIASRLGPEQARVAAMLLMTLPGTPILYAGDEIGMENVPVPPALGQDPFERCVPGYGL
                     SRDPFRVPLRWAPESGAGFTTGEPWLPTGPLPLGSTVAEQEEDPCSLLALYRRLTGLR
                     RDRPELQAGRYRRILSEGGVLAYARWLDGSGLVIALNLSASDVAPTLDCRGRVVLGTV
                     LDRDGERIDGCIRLSPHEGVIIAAEDG"
     gene            197587..198126
                     /locus_tag="MNOD_RS39370"
                     /old_locus_tag="Mnod_7975"
     CDS             197587..198126
                     /locus_tag="MNOD_RS39370"
                     /old_locus_tag="Mnod_7975"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631179.1"
                     /db_xref="GI:501740136"
                     /translation="MAAKPKTLQDAFYETLRDVYYAERQSVRALKNSAKAAENEELRQ
                     AFETHAEESANQVERLQEVFDLIGKPARGKTCEAMQGLTAEMEEDLEDFGDSPAADAV
                     LVGCAQAVEHYEIARYGTLKTWAIQLGYKDAAKLLDETLQEEKKTDQLLTQIAERINV
                     EATGTTQGGGAQGKSGKEA"
     gene            complement(199097..202216)
                     /locus_tag="MNOD_RS42265"
                     /old_locus_tag="Mnod_7977"
     CDS             complement(199097..202216)
                     /locus_tag="MNOD_RS42265"
                     /old_locus_tag="Mnod_7977"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009565854.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="WP_012631180.1"
                     /db_xref="GI:501740138"
                     /translation="MLSATRGDLPIGVDDVLITAELASRPSRTPDYEAESRALGLLAQ
                     EMATNPDRVLQRCAELVIELCHADSAGISILEPGGTTGIFRWHAAAGRFAANLHGTMP
                     REASPCETVIARNSVLLFNEAERFFPDQRRVVPPVYESLLAPWQLNGKPIGTLWALKH
                     TPEGRFDAEDARLLQSLARFASAAYQMTSALKEAKAGREELEWRVAERTIAYSQAYNA
                     AQTSEARLRAALEIETVGAIYLAPEGLIIDANGAFLAMGGYSRADLEGGRLTWQTLTP
                     PEWMAASERALAELKATGQSPPYEKEYFRKDGSRWHALFAGKLLPDGLIFEFVLDITA
                     RKQAEQALATELKAMTRLHELSRQVVNGAGLQAALDAILDAAMDLHGADFGDIQLYDE
                     ETRTLRIAAQRGFGQPFLDHFAEVDAAEDSACGVALARRERVVIEDVEQEPAFAPSLE
                     AARAAGYRAVQSTPLFTPTGETLGMLSTHFRQPHRLSDLDLRLIDVYGRLASDTIAWM
                     RAETALRESEARLAHELDGARQLQRISSELLPEQRPAALYEQILDAMMAVMGSQAASM
                     QILDPDTGTLKLLAWRGFHPDAAAFWDRVDSNSASTCGEALKTGRRTLVSDIESCGFM
                     AGTKDLEAYRRSNLRAVQSTPLMSRTGRALGMVSTHWREPHEPSIDDFSRFDVLTRQA
                     ADLIERAQTEAALRESEERFRQFGETSSDLLWIRDADTLRFEYLNPAFDTIYGECRDR
                     VMGDNTIEQWAELTHPDDRKQALNTLDRLRRGEFVEHEFRIVRPSDGQVRWIRDTDFP
                     LLDVAGQVQRIAGIAKDVTKQKETAERMKVLVAELQHRTRNLIGVVRSTFDRTLAKSS
                     SLDEHRDAFHGCLAALARVNGLLSRLNEGDRISFDELLQAELAGQGVMDREEHGPQVT
                     LAGPKGVRLRSSTVQTLALGLHELVTNAVKHGALSQPEGRLLVQWCVIHGDHGEPRLR
                     VEWQDSGVPVALSPEGQPPRQGYGRELIERALPYQLGAETAYELTPDGVRCTITLPIS
                     TRQVEIVDA"
     gene            202714..202956
                     /locus_tag="MNOD_RS39380"
                     /old_locus_tag="Mnod_7978"
     CDS             202714..202956
                     /locus_tag="MNOD_RS39380"
                     /old_locus_tag="Mnod_7978"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012330629.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631181.1"
                     /db_xref="GI:501740141"
                     /translation="MSQPDQIAIFVDADACSVKDKVYRVAARYGLHVFMVANSFMNLP
                     REPWIERVVVQQRSSATHRRHGRRPPRSGRWWWSIP"
     repeat_region   202952..203063
     gene            complement(204059..204538)
                     /locus_tag="MNOD_RS39385"
                     /old_locus_tag="Mnod_7980"
     CDS             complement(204059..204538)
                     /locus_tag="MNOD_RS39385"
                     /old_locus_tag="Mnod_7980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metal-binding protein"
                     /protein_id="WP_012631183.1"
                     /db_xref="GI:501740148"
                     /translation="MISRPPLTRRTLLAGLGSLVAVVPLRAAAGSLPRVAVTKDPNCG
                     CCEAWVAHLRTAGFPVAVTTGPVAPLKATLGVPRALASCHTAQVGGYVIEGHVPAEAI
                     TRLLTEKPAATGLAVPGMPIGSPGMEVEGMDPDTYEVVLFGPAGTRTFARYRGATLL"
     gene            complement(204560..207733)
                     /locus_tag="MNOD_RS39390"
                     /old_locus_tag="Mnod_7981"
     CDS             complement(204560..207733)
                     /locus_tag="MNOD_RS39390"
                     /old_locus_tag="Mnod_7981"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_012631184.1"
                     /db_xref="GI:501740152"
                     /translation="MIARLIGWSARNLVLVLIGTVFAVAAGLHALRTLPLDAIPDLSD
                     VQTIVYTEYPGQAPQVVEDQVTYPLTTAMLTVPKSKVVRGFSFFGVSFVYVIFEDGTD
                     PYWARSRVLEYLSTAASRLPAGVTPGLGPDATGVGWVYQYAILAKQKTLAELRSLQDW
                     VVRFGASRAEGVAEVASVGGFVKQYNVVVDPNRLRALGLPLTKLREAIRASNTDVGGR
                     TVELSEFEFMVRGRGYLKSPADLENIVLKTEGGTPLRLRDVARVELGPDERRGLTELN
                     GDGEVAGGIILQRFGANALTVIESAKQRLAEIAHSLPAGTEIVPVYDRSQLIDAAIET
                     LKSTLIEESLIVALVCVVFLLHLRSALVAILMLPVGILMALGAMRFLGIGANIMSLGG
                     IAIAVGAMIDAAIVMIENAHKHLERAPPDAPRTQILIDAAGEVGPSLFFSLLVITVSF
                     LPIFTLESQEGRLFGPLAFTKTFAMAAAALLSVTLVPALMVVFVRGRIIPEHRNPLNR
                     LLIRLYRPVIRGVLRARLLTILLAVVALGATVWPARQLGSEFMPELNEGTLMYMPTTL
                     PGVSITKAAELLATQDRIIKSFPEVASVYGKAGRANTATDPAPTEMFETIINLKPKAE
                     WRPGVTLASLKAEMDAALQFPGVSNAWTQPIRARIDMLATGIRTPVGVKIFGTDLGAM
                     EQVARQVEAVIRAVPGTASAYAERVIGGYFLDITPDREALGRYGLMVGDVQDVIAMAL
                     GGESVTTTVEGRERYTVNLRYPRAFRASPQAIAGEVQVPLPAGGTVPLGEVAKVQLTR
                     GPTSIRTENGRLAVYLFVDISGRDLGGYVAAAQAAVAHEVKLPPGMSLQWSGQFEYLE
                     RAEARLRIVVPLTLLVIVLLLYLNFRRLTETLIVMLSLPFALVGGVWLLWWMGFNLSV
                     AVVVGFIALAGVAAETGVIMLVYLDHALAEVRAVRDKAGQPLTRDDLRQAIMVGAVER
                     VRPKMMTVAAIMAGLLPILWSTGAGSEVMQRIAVPMIGGMVSSTVLTLVVIPAVYALI
                     KGRGLPRAAGTAAPPAVAAQSYRHAAE"
     gene            complement(207730..209190)
                     /locus_tag="MNOD_RS39395"
                     /old_locus_tag="Mnod_7982"
     CDS             complement(207730..209190)
                     /locus_tag="MNOD_RS39395"
                     /old_locus_tag="Mnod_7982"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cation transporter"
                     /protein_id="WP_012631185.1"
                     /db_xref="GI:501740155"
                     /translation="MSRSAWLAGTLAALAAGGAGYWAGHGSNPAPALLDRARTEFALW
                     LPPAAAPPPAAPAPAPRGPVVYYQDPDGRPAYSLEPTRTPDGRAFRPVHASEDIHFET
                     DDMEADGPADRPPDAPAGGEKKRILYYRNPMGLPDTSPVPKKDSMGMDYLPVYAGEDT
                     DGSAVTISPGKIQRTGVRSETIERRVLSQPVRAPGTVEEDERRVSVIATRTDAFVETV
                     ESVTTGDHVHKGQPLLRLFSPEINAAAAQYLSAIGYEGARRRLENLAIPPEVIDEIER
                     TRKVPAAITWTSPRDGVVVERNVSDGMRAQAGAVLFRIVDHSRVWVLADVPERDLAAV
                     AEGQRAIVRARAFPDRAFTGTVTRIYPHLSTGTRTARLRIELPNPNGDLRPAMYADVE
                     ITTGSDAPVVAVPDDAVIDTGTRQVVILDKGEGRFEPREVKVGRRGDGYVEIREGLQA
                     GAQVVTAANFLIDAESNLKAALQSMAAATPAPEAAR"
     gene            complement(209187..209543)
                     /locus_tag="MNOD_RS39400"
     CDS             complement(209187..209543)
                     /locus_tag="MNOD_RS39400"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018044309.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal RND transporter"
                     /protein_id="WP_050783630.1"
                     /db_xref="GI:915398245"
                     /translation="MLGCALIGVARADIKDYEFQLVKNEVKQGDATLDVRLVDKRTGK
                     PVPDAVIFAKRIDMAPDSMEEMTSKIEQLPSPEPGIYRFKAKLSMAGGWRLSLGAKVQ
                     GETGTVENKLVLKAVK"
     gene            complement(209668..210060)
                     /locus_tag="MNOD_RS39405"
                     /old_locus_tag="Mnod_7984"
     CDS             complement(209668..210060)
                     /locus_tag="MNOD_RS39405"
                     /old_locus_tag="Mnod_7984"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753985.1"
                     /db_xref="GI:760071177"
                     /translation="MMFWKALMRLLATLAVVSLALAPVTTSVAAAAPGMSAAMVDHAV
                     DPAEPMDGMAATAMDDMPCCPPAKPAMPDCQKGCPLAALCLAKLAPALPAGIGVPMPV
                     AVAQTAPWWVSAAFRSLAPPPPSEPPRA"
     repeat_region   210388..211862
     gene            complement(210467..211801)
                     /locus_tag="MNOD_RS39410"
                     /old_locus_tag="Mnod_7986"
     CDS             complement(210467..211801)
                     /locus_tag="MNOD_RS39410"
                     /old_locus_tag="Mnod_7986"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012779118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631188.1"
                     /db_xref="GI:501740169"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDVMAVTGLNRPD
                     FRTIAEFRKRHLAALSDLFVQVLRLCQAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKTTEAALAAEVEAWLAQAAEMDAAEDRAHGMDRRGDETPDWMADKQRRLAAIRAAKA
                     ALEAEAADPPAPEDESGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTEPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAQRLVTNAADYRALVPLIDDVSAHLGRKPREVSGDAGF
                     ATEANLTALQARRIRGYLPPGRARHGEAHAAGRRKLTKMPLMSAMAQRLKRAGRRSRY
                     RLRKQVVEPVFGQMKQARGFRQFLLRGLEQVRGEWAMICTAHNLLKLAQAAR"
     gene            212109..>212891
                     /locus_tag="MNOD_RS39415"
                     /pseudo
     CDS             212109..>212891
                     /locus_tag="MNOD_RS39415"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020493661.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_except=(pos:212727..>212729,aa:OTHER)
                     /transl_table=11
                     /product="integrase"
     gene            complement(213276..214346)
                     /locus_tag="MNOD_RS39420"
                     /old_locus_tag="Mnod_7988"
     CDS             complement(213276..214346)
                     /locus_tag="MNOD_RS39420"
                     /old_locus_tag="Mnod_7988"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631189.1"
                     /db_xref="GI:501740172"
                     /translation="MSDTNPHPFKMAIVWWGDAEERAAARPETSRLKAIFAALERHGI
                     TAEPAVWSDALTDKVRAQLMSVDGVLVWVNPITTPGGEGRGVLDDLLREVAAAGIFVS
                     SHPDIIARMGVKEVLYRTRKLGWGTDTHVYGTYVAFRAEFPERVATGPRVLKQNRGNG
                     GLGVWKIERAAGVDVVVQEAWGSRRVRTIPLDVFMEERAVNFTAAGTLIDQPFQARHL
                     EGMIRCYLSGDQVVGFGHQLVRALAPPEAGPAGPRLYFGPDDPRFQRLRGLLEQEWTP
                     QMAHLLGLGLGDLPVIWDADFLLGPQTPTGEDTYVLCEINASSVFPIPDEAPEAIART
                     TFRRLEATPRSRASHSSTQADQ"
     gene            complement(214458..215465)
                     /locus_tag="MNOD_RS39425"
                     /old_locus_tag="Mnod_7989"
     CDS             complement(214458..215465)
                     /locus_tag="MNOD_RS39425"
                     /old_locus_tag="Mnod_7989"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631190.1"
                     /db_xref="GI:501740176"
                     /translation="MLPKPFGSALVRTAAGLLLAVQLAPGRAADTAPMLLDQKIPLGN
                     VRGRIDHLAFDAARHRLFIAELGNDSIGIVDVSDGKLVHRIPGLHEPQGIAYLASNDT
                     VFVANAGDGTVRWYNGSDYASLGAMRLGEDADNIRLDQRTGQVIVGYGQGAIAVLAPD
                     GTKLEEIRLAGHPESFQLGPQGSQIYVNVPDAHEIAVLDRDNGRQIAHWSLPSARANF
                     PMALDPSGERLLVVYRKPALLAVFDIKDGSALAQVPTCGDADDIWVDRKRRRIYISCG
                     EGALDVLQEEGRSYRELARIPTVSGARTSLFLPKLDRLFLAVRASNREGAAIWVFRPA
                     D"
     gene            complement(215495..216112)
                     /locus_tag="MNOD_RS39430"
                     /old_locus_tag="Mnod_7990"
     CDS             complement(215495..216112)
                     /locus_tag="MNOD_RS39430"
                     /old_locus_tag="Mnod_7990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="superoxide dismutase"
                     /protein_id="WP_012631191.1"
                     /db_xref="GI:501740179"
                     /translation="MTYAIKPLGCDPARIKGMSERLIVSHYENNYGGAVKRLNLIEEQ
                     LAGLDYETTPGFVINGLKREQLIAMNSMILHELFFGGLGQESEPGPVLRKALARSFGS
                     FERWRSEFIAMGKALAGGSGWVLLSWSPRDGQLVNQWAADHAHTLAGGVPILALDMYE
                     HSYQIDYGSKAATYVDTFMQAIRWENADRLFFSLREGERTTMTPG"
     gene            complement(216223..217185)
                     /locus_tag="MNOD_RS39435"
                     /old_locus_tag="Mnod_7991"
     CDS             complement(216223..217185)
                     /locus_tag="MNOD_RS39435"
                     /old_locus_tag="Mnod_7991"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="WP_012631192.1"
                     /db_xref="GI:501740184"
                     /translation="MRRQIASLFALSLVALAPPVQAAETWQQAIATGLGKPGTEMPGG
                     VYRVSLPRTDLAVTLDGVSIKPALALGSWLAFRKAGENQVMVMGDLVLTEDEVNPVMT
                     RLVEGGVEITALHNHLLRASPNPLYMHVSGHGEPETLAATLMGALGASRTPFGAETAT
                     GTPPAGHPGPASAGASPAPARATASDQAQPLDTAAIEAALGRKGKLNGGVYAVSVPRA
                     ETPRDHGMDVPEAMGSAIAINFQPTGGGKAAITGDFVLTADEVNPVIKTLRQNGIEVT
                     ALHNHMLGDEPRLFFMHFWANDDTAKLAKGLGAALKHVKVASGG"
     gene            complement(217226..217594)
                     /locus_tag="MNOD_RS39440"
                     /old_locus_tag="Mnod_7992"
     CDS             complement(217226..217594)
                     /locus_tag="MNOD_RS39440"
                     /old_locus_tag="Mnod_7992"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631193.1"
                     /db_xref="GI:501740188"
                     /translation="MRPWHRGLWQGGAVLLFSLGLAHPAPAAETFRQLTGPQIRARLT
                     GKEVTDEVHWAYRFEPGGRLQTVSMGRARTGIWRLQGDALCLNADPCLQVWMAGTHVE
                     FRRDGALPEEGVLQAPARRP"
     gene            complement(217594..>218232)
                     /locus_tag="MNOD_RS39445"
                     /pseudo
     CDS             complement(217594..>218232)
                     /locus_tag="MNOD_RS39445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015928900.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="chromate transporter"
     gene            complement(<218178..218582)
                     /locus_tag="MNOD_RS39450"
                     /pseudo
     CDS             complement(<218178..218582)
                     /locus_tag="MNOD_RS39450"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015928901.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(218737..219528)
                     /locus_tag="MNOD_RS39455"
                     /old_locus_tag="Mnod_7995"
     CDS             complement(218737..219528)
                     /locus_tag="MNOD_RS39455"
                     /old_locus_tag="Mnod_7995"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012631194.1"
                     /db_xref="GI:501740190"
                     /translation="MTPITLSATDLALAASLVVLDAGLSLALRLNLHRQLVLAAARMV
                     VQLIGVGYLLRFVFALNDPVATLLLVLVMSLVAAREVAARPERRFRGFVTLAISLGSV
                     LVATLATAGLALSTAIRPTPWYDPRYAVPLAGIVLGSVLNAASLTLDSLLGGVRRERS
                     AIEAQLGLGVPFRQAAAGLFRTAVRRGLLPIINQMSAAGIITLPGIMTGQILAGMDPV
                     EAVKYQILLLFLLTGASGLAALATAGLALRCLTDDRQRLRLDRLA"
     gene            complement(219525..220145)
                     /locus_tag="MNOD_RS39460"
                     /old_locus_tag="Mnod_7996"
     CDS             complement(219525..220145)
                     /locus_tag="MNOD_RS39460"
                     /old_locus_tag="Mnod_7996"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015928902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_012631195.1"
                     /db_xref="GI:501740193"
                     /translation="MRCDRDRGLHIEDLRSDLAGPFDLVVPKGQIVTIAGPSGSGKSL
                     FLRMIADLDVNTGRVRLDGRWRSEMPAPEWRRQVPYVAAEPGWWSDAIADHVAPEHRA
                     AAEALAARLGVGARPFAGLVANLSTGERQRLALVRALVRETPALLLDEPTGPLDPVST
                     TAVEALLRERAAAGAIILMVSHDPGQSERLSARALRMAARRLEAVP"
     gene            complement(220142..220477)
                     /locus_tag="MNOD_RS39465"
     CDS             complement(220142..220477)
                     /locus_tag="MNOD_RS39465"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010666955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753989.1"
                     /db_xref="GI:760071181"
                     /translation="MDQLFGGRWRAAFGPVGLTASVCELGDFYATIAEKKRITFTVAA
                     ELTIVHGDGELLFETGGNLIDNAVKFTPAGGRVSLTLPSQDGAHRRCLGKTVRCRCEG
                     RASPGPDLP"
     gene            complement(221150..222100)
                     /locus_tag="MNOD_RS39470"
     CDS             complement(221150..222100)
                     /locus_tag="MNOD_RS39470"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_012631196.1"
                     /db_xref="GI:501740197"
                     /translation="MLAIHSDVLDLLRLIRESGNPPLEALPPEQSRRLYLAGRRSLQP
                     PPDQVSLVRDLHAPSQDGPVPLRLYRGMGTADDAVLPCLLYLHGGGWVVGSVESHDGV
                     CRQLANLTAGCVISVEYRLAPEHPFPAAVEDAAAALTYVVAQAESLMIDPARIAVGGD
                     SAGGNLAAVLALMGRDGVVPRTVFQALLYPAVDLTMTSDGYRRVTEGMPLTAATMRYF
                     VSHYVPHHPERLDWRASPLRTTSLAGAPPALVLTCGHDPLCEEGRLYAKRLEDEGVPV
                     TALHLSDQTHGILTMGKIIRATASTLTFMAHALCDAWTAL"
     gene            222892..223107
                     /locus_tag="MNOD_RS39475"
                     /old_locus_tag="Mnod_7999"
     CDS             222892..223107
                     /locus_tag="MNOD_RS39475"
                     /old_locus_tag="Mnod_7999"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012336502.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754219.1"
                     /db_xref="GI:760071413"
                     /translation="MQRFYFDLTDGLTTIRDNEGVEADDLADALEQAEAALEEMSASG
                     ELTDLEEGWRLVIRTGADTVLATIPIV"
     gene            complement(223635..223991)
                     /locus_tag="MNOD_RS39480"
                     /old_locus_tag="Mnod_8001"
     CDS             complement(223635..223991)
                     /locus_tag="MNOD_RS39480"
                     /old_locus_tag="Mnod_8001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cro/Cl family transcriptional regulator"
                     /protein_id="WP_012631198.1"
                     /db_xref="GI:501740204"
                     /translation="MYAHHQRLDSEEVQGLRREGGRFLKDLREARGLSQRQLATLVGA
                     EYYTFISQLETGRGRIPPDRYRAWAEALGIEVRHFVQTLMRFYDPLTYEILFGAETDA
                     EHLQGDADRPQRTTGG"
     gene            224358..226124
                     /locus_tag="MNOD_RS39485"
                     /old_locus_tag="Mnod_8002"
     CDS             224358..226124
                     /locus_tag="MNOD_RS39485"
                     /old_locus_tag="Mnod_8002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="WP_012631199.1"
                     /db_xref="GI:501740206"
                     /translation="MISSNASSALTNGIRSMRPMLVTAFIFSFFANILLFVSPLYMLQ
                     IYDRVLASRNEATLFGITLIAAFALAVYSILEMLRSRILVRGGMIFDQRIAGPIFDSV
                     HCSTLRKPGTGHETALRDVDTLREFLTGSGLLAFCDAPWTPIFLLACFILHPWFGWMA
                     LVGGSVILGLTLINEVATRRSLDAANQASNAAGQQARATFRNAEVLQSMGMLAALREL
                     WRSRHNEVLLLQARASDRAGIIVATTKFVRMFLQTMVLGLGAYLAIHREISAGSMIAA
                     SIIIGRALAPIELIVANWKGFTAARASYRRLADLVSLAGPEPHRMILPRPQGQVEADN
                     VSVAAPGTATPILRGVSFRLQPGSVVGVIGPSAAGKTTLARALTGVWPLLSGTVRIDG
                     SELGHWDPQALGRHVGYLPQDVELFDGTVAQNIARFAVEDEAAIIEVAQKAGCHTLIQ
                     GLPDGYNTRIGVGGHGLSGGQRQRIALARAMYGNPSLVVLDEPNASLDQAGEAALMQA
                     VSGLKCRGATVIIVTHKFSILIEADQVLVMDGGCVQAFGAAAQILSQVAGPKPAASLV
                     SATGPDGVVGRRLPDRQRASAG"
     gene            226128..227510
                     /locus_tag="MNOD_RS39490"
                     /old_locus_tag="Mnod_8003"
     CDS             226128..227510
                     /locus_tag="MNOD_RS39490"
                     /old_locus_tag="Mnod_8003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin secretion protein D"
                     /protein_id="WP_012631200.1"
                     /db_xref="GI:501740209"
                     /translation="MTIWSAETLPAARPSHSVGERPDAAGEQQSLIGLTSWRRYAIAG
                     YAVILATFGVMGSWAAVVRLDRAVISPGVIVAESSRKIVQHFEGGMILEVLVKDGQSV
                     QEGDVLLRIDPLQSRASADLFRTQLDAALILEARLRAEQNQASELELPPELIARRNEP
                     AIARMIKDQTIQLAERQRSLKSQLDLIDARVKQLKTEMVGLAVEKASVQAQVGFINQE
                     LEGLRSLREKSLIPLSRLLVMERERTRLEGVIGRSVAETAKAQNAIGEAGMQITQLKQ
                     KMQEVTTAQLLETRQKIAELREKLLVAQDVLRRHEIRASHSGVVQGLKVYTIGQVVRS
                     GEPLMEIVPTSDRLVISVQFSPNDLEAIHAGMRAEVKFPTFQTRRTPAIFGTLKTVSR
                     DRLIDDTTKQAYFSGIVEIDEHQVPNDIKHRLLAGLPAEVVVSAGERTALDYMVAPLF
                     DAMGHAFHER"
     repeat_region   228951..232185
     gene            complement(233386..234546)
                     /locus_tag="MNOD_RS39495"
                     /old_locus_tag="Mnod_8006"
     CDS             complement(233386..234546)
                     /locus_tag="MNOD_RS39495"
                     /old_locus_tag="Mnod_8006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="WP_012631203.1"
                     /db_xref="GI:501740216"
                     /translation="MRVKQVRIYVVESGGIRPVILEMTTDDGTVGLGEAAVAYGLGGT
                     AAAAMIRELCERCVIGRDPFRVEAIWTEMYDCSFWAKGGGPIVFGAMSAIEQALVDIK
                     ARALRVPAYELLGGRVHDALRTYANGWYFGCADLADLPRFAEATVADGYDALKLYPFA
                     TILETGRLRHPSRRGTSDGDVRRRAVAAVASVRAALGPGPKIMLDLSGGLTPDETIRF
                     CREVEEFDITYVEEPADPFDPHALSKIASGISQPIAVGERIYTRYGFRDLLAGRAVDI
                     LQPDLGNTGGILEGRKIAAMAEAYGVKVQPHVCASALSTVIAMHFSAATPNFYMQEHF
                     PYWDRIPGYTQVLEDPIEPQVKAGTIPVLDAIGYGVTLRNRSLLDCLWTECR"
     gene            complement(234551..236611)
                     /locus_tag="MNOD_RS39500"
                     /old_locus_tag="Mnod_8007"
     CDS             complement(234551..236611)
                     /locus_tag="MNOD_RS39500"
                     /old_locus_tag="Mnod_8007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631204.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="N-methylproline demethylase"
                     /protein_id="WP_012631204.1"
                     /db_xref="GI:501740219"
                     /translation="MPLVEAITGPAAIARDPLLQPLRIKNLVLRNRVMSTSHASGLEE
                     GGMPKERYQLYHLEKAKGGIGLSMFGGSSNVAPDSPNIFRQLNVGTDEIIPWLQQFSA
                     RMHAEGAALMVQITHLGRRGEPYADKWLPTIGPSAMRETLHRSFPKEMDEHDIRRVVK
                     AYAAAVRRCREGGLDGVETLAGGHLIGQFLSPSTNRRTDRYGGSLENRCRFGLMVFEE
                     IRKEVGDDYIVGMRYVIEEGETGLTMGDAIKVAHIFERTGMLDFFNAIVGRMDTERAL
                     AVDNMPGMASPIAPWLRQVGAFKREVGLPVFHAARISDIATARHAIREGLLDMVAMTR
                     AHIADPHIVRKIEAGQEDRIRPCVGATHCQSPYRPHCIHNPSTGRESQLPHEIARSER
                     AGRKVVVVGGGPAGLEAARVSALRGHEVVLFEAAAKLGGQLLLSQRASWRRDVIGIVD
                     WRVEEIRRLGVRVELNRYAEVDDVLAENPDAVVVATGGVPDIDWIAGAEHCDSVWDVI
                     GGTTPLAAEVIVYDGTGRHPGPQAAELAAQDGRKVQFVSIDAQIAQELTYAERIIWKK
                     RIYELGVPMTFDHEIVKVERRGNRIVATFRNLASEQLTERMADQILVEHGTRPADDLY
                     QALRPHSANDGVTDIDALLAGEAQPLTWRPELRMELHRVGDAVASRNVHAAVLDALRL
                     CKDL"
     gene            complement(236602..237513)
                     /locus_tag="MNOD_RS39505"
                     /old_locus_tag="Mnod_8008"
     CDS             complement(236602..237513)
                     /locus_tag="MNOD_RS39505"
                     /old_locus_tag="Mnod_8008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADP oxidoreductase"
                     /protein_id="WP_012631205.1"
                     /db_xref="GI:501740221"
                     /translation="MKPSARPLDPAPTVGLIGLGRIGMVLLAALRRFAPETRVIAAGR
                     DPARVAAATAAWPGVEVMDSERLAVHANVVVPCLPPEAYRDGVSAVAPHMRADAVLMS
                     VTNAVPLPDLGCRCARPIVKVILSPAHAAGRGVCLVTPSPGAGPEQVERICALLQRFC
                     RPVLADPADGRIASNLAGSAPAILAAFCSAFLEANAARARAFGPTELRAMMTESVAAL
                     AAILDEGLSFEDVVARTATPGGTTEAAIAALNAEAPALCGRLVDATFQREAQLLAIPP
                     RTRDRPHAGSACKADPSDIPSGELPCR"
     gene            complement(237804..238586)
                     /locus_tag="MNOD_RS39510"
                     /old_locus_tag="Mnod_8009"
     CDS             complement(237804..238586)
                     /locus_tag="MNOD_RS39510"
                     /old_locus_tag="Mnod_8009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate ABC transporter ATP-binding protein"
                     /protein_id="WP_012631206.1"
                     /db_xref="GI:501740224"
                     /translation="MSLADRSAAEESQTCLGHRAIVSLRNVHKSYGAFEVLKGISLDV
                     RKGEVVCIIGPSGSGKSTLIRCINGLSAIQSGSITVDGQEVNDPKLDKLALRKKVGIV
                     FQQYNLFPHKTALENVMMAPLKVLREPRAQVEERARALIAKVRLTGKENAYPGQLSGG
                     QQQRVAIARSLAMRPDVMLFDEVTAALDPETVKEVLVTIKELAAEGMTCILVTHEMGF
                     AREVANHVYFTDGGIIVEHGKPDQLFKNAKDPRTRQFLSQVL"
     gene            complement(238573..239409)
                     /locus_tag="MNOD_RS39515"
                     /old_locus_tag="Mnod_8010"
     CDS             complement(238573..239409)
                     /locus_tag="MNOD_RS39515"
                     /old_locus_tag="Mnod_8010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter"
                     /protein_id="WP_012631207.1"
                     /db_xref="GI:501740228"
                     /translation="MRQPAFQLNMARLREGQFLRGLRAGHVILLLLALGVSLAFAVSR
                     SFVLGSGPTALTTLLEWSPFILQGFALNLAMSFLAMAMATILGTGLGLLQISTISAVR
                     LPARFVTHLLRNSPWLVILFLVTYFMPVEIRLPHGLRVPVPDWSKATLAFALPVMGNI
                     SEILRGAVRSIPSGQWESAEGLAFTRAQTLRYIILPQCVRRCIPPWMNWYAMLTLSTP
                     MASIFSVHEAVANAQAGMEAAGSRPELLLPFYLFLLCLFFLYIYPIALWTRRLERRYV
                     VG"
     gene            complement(239406..240152)
                     /locus_tag="MNOD_RS39520"
                     /old_locus_tag="Mnod_8011"
     CDS             complement(239406..240152)
                     /locus_tag="MNOD_RS39520"
                     /old_locus_tag="Mnod_8011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631208.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter permease"
                     /protein_id="WP_012631208.1"
                     /db_xref="GI:501740231"
                     /translation="MLEIIGPFFRGMYERTGMNFNIFYDPYEYGRFVSGASTTLQLIF
                     WSLSLSLVIGVLGAWAQGAKSPALRVGVGAYIQAFRNTPPMIQLLFFYFGLGAFTPAI
                     DMGGYSQPVVSSFAWAVISLGIFGGAFNVEIFRAGIEAVPDSTLEAAESLCFSRLQTY
                     LYITLPLAFRISLPALTNNLVSLAKTTSLAYIITVPEMTYVLNQVWSDNLNVPEMMLV
                     LFGFYIVVVTLLAAGLHAIERKLVLPGYGQ"
     gene            complement(240197..241042)
                     /locus_tag="MNOD_RS39525"
                     /old_locus_tag="Mnod_8012"
     CDS             complement(240197..241042)
                     /locus_tag="MNOD_RS39525"
                     /old_locus_tag="Mnod_8012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_012631209.1"
                     /db_xref="GI:501740234"
                     /translation="MMKGKLMKMAAVAAAVLGVALGAAPVRAADGRLKDILDRGVVRV
                     GVQGAFKPWAFPAPDGTLQGIELDLAKSVADTLGVKLEPVIITSANRIQFLQQGKIDL
                     IIGGMYDATDRRKVVGIIEPAYWSSGPTLLAKKGAIKDWKDIANKPVCGKQGNYYNKQ
                     VQTELHANLIAFAGNTEGKEGLRAGKCIAWLYDDVSIMADLALPEWEGYEMPVPVLYN
                     NPWAAAVPLDELNRGWGAFMAGMAYRWQAEGKLIELGKKWGVNTSDWFVQQQQKLHWD
                     TSYLK"
     gene            complement(241084..242604)
                     /locus_tag="MNOD_RS39530"
                     /old_locus_tag="Mnod_8013"
     CDS             complement(241084..242604)
                     /locus_tag="MNOD_RS39530"
                     /old_locus_tag="Mnod_8013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_012631210.1"
                     /db_xref="GI:501740236"
                     /translation="MDTHSRRDAKGDSRYDVVIIGGGINGTSAARELAAGGYKVLLTE
                     MSDLANGASSRSSRILHCGLRYFETAHPVRTFLSSPRRLAGAMTMARAAMQARAELSD
                     LKPDNCKPFTMCFPLYSDGDVKGWHLDLGFGLLKRLGPARPPLDYRRITRDFDQLVPF
                     AGDLRDRESLRSIATYREYIIDSPDRLCVEAALEAERNGAELRLFTKAGFAGRSADGH
                     WLLQLSSDGGTDLVEAPVVLNLAGTWSDGVIAGIVDEPRSPLVTGTKGSHIVVRLPQR
                     YAGHGIACLHRGGMPFYCLPLDGDLFYFGPTETKYDGDAGDAVATDDDISFLLEEANF
                     LLPGLGLRKSHVEFTWAGVRPLGFDARQPMGRRIREIHDLADRGMPGVFAMTAGPVMS
                     HLSAGRELRDVVARALKPSGQPRARRPGTPSSRPRPDPAQGSAALLRHAVIAEHARDL
                     KGILYTRTGMGWGRHLDRDTVQSAAEAVSDLLGWSQSDVSAQVESFLRYQNSRFAR"
     gene            complement(242707..243609)
                     /locus_tag="MNOD_RS39535"
                     /old_locus_tag="Mnod_8014"
     CDS             complement(242707..243609)
                     /locus_tag="MNOD_RS39535"
                     /old_locus_tag="Mnod_8014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012631211.1"
                     /db_xref="GI:501740237"
                     /translation="MKLLYLAAFRAVMLTGTVSAAAEVLGRSQPAVSRLLDKLEAELG
                     AKLFERRRGLVVPTRTAQLLLDEVERAYVSLESLKTFASRVAEGESSRISAAVLPALG
                     LNFIPATLAAFAREWPKTRVLLNVQMSVQVEEWAAAQQVDFGLAEMPFKRSGFRTEIF
                     SDQPYLLAVPRDHPLAQRSQVGPSDVRGVPFIVGSSFTAMGQLLAQAFRTCGVPLEAQ
                     YEAPLSMTVYELVKQGVGIGLVDPYTALKQLDSRVQLVRFVPTIPFNVALLRPESRPA
                     NPAADALLDFLASERDRLMSGFPG"
     gene            complement(244012..244242)
                     /locus_tag="MNOD_RS39540"
     CDS             complement(244012..244242)
                     /locus_tag="MNOD_RS39540"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753991.1"
                     /db_xref="GI:760071183"
                     /translation="MRPVGEVDGIGVFLARHPNRKDDLFEVVIGPASCSECEVVATLP
                     TTRAGKTEAIRISMAILRTLDLISSINDRPPV"
     gene            complement(244393..245070)
                     /locus_tag="MNOD_RS39545"
                     /old_locus_tag="Mnod_8016"
     CDS             complement(244393..245070)
                     /locus_tag="MNOD_RS39545"
                     /old_locus_tag="Mnod_8016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631213.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="WP_012631213.1"
                     /db_xref="GI:501740239"
                     /translation="MLSNIEIIARLALSALLGSLVGLERERLLWAAGLRTHMLVAVGA
                     CLIMIVSAFGFSDVLSENHVVLDPSRVAAQVVSGIGFLGAGTILLRGEVVRGLTTAAS
                     LWAVAAVGLAVGGGLYVAAVATTLIVLIILAGVKPIEEHYQARMQTRPLRLVARTGEM
                     SIDVLQEVTGERSSRIKQFVVRQSGSEGLDEVTVTFVRLSQRSIEAIAERLRQHPGVI
                     SVETDVS"
     gene            245228..245872
                     /locus_tag="MNOD_RS39550"
                     /old_locus_tag="Mnod_8017"
     CDS             245228..245872
                     /locus_tag="MNOD_RS39550"
                     /old_locus_tag="Mnod_8017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease PIN"
                     /protein_id="WP_012631214.1"
                     /db_xref="GI:501740240"
                     /translation="MLGWFRALMPKEDRFFDLFERHARTLVAGAEALQELLKGGEAVP
                     RYCQIIAEREHEADDISREVLLAVRRSFITPFDRGDIKDLIQSMDDAIDQMHRTAKAI
                     ALFELREFDPVMREMGGTILEAAKLTAEAVPLLHKVGTHAARLAALTEQVVRVEGRSD
                     ALHEQGLKSLYLTHGRTDPMAYIVGSEILGHLEDAVDRFEDVANEISGIVIENV"
     gene            245881..246888
                     /locus_tag="MNOD_RS39555"
                     /old_locus_tag="Mnod_8018"
     CDS             245881..246888
                     /locus_tag="MNOD_RS39555"
                     /old_locus_tag="Mnod_8018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631215.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic phosphate transporter"
                     /protein_id="WP_012631215.1"
                     /db_xref="GI:501740241"
                     /translation="MSDAALAFPILAGLIAVALLFDFLNGLHDAANSIATIVSTRVLR
                     PHYAVFWAAFFNFIAFLFFGLHVAQTLGTGIIDASLVDARVIFGALSGAIVWNVLTWI
                     LGIPSSSSHALIGGLVGAGVAKAGWQAVVWGGLGKTAAAIVLSPLLGFLLALLLVLIV
                     SWLFVRSTPFAVDRAFRLLQFVSASLYSLGHGGNDAQKTMGIIAVLLYSQGHLGREFH
                     VPLWVVLSCQAAMAAGTLFGGWRIVHTMGSRITRLTPMQGFCAETGGALTLFAATWLG
                     VPVSTTHTITGAIIGVGAARRTSAVRWGVASNIVVAWVLTLPAAAAIGAGAYVLTALL
                     P"
     gene            248181..248639
                     /locus_tag="MNOD_RS39560"
     CDS             248181..248639
                     /locus_tag="MNOD_RS39560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014281372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043753992.1"
                     /db_xref="GI:760071184"
                     /translation="MRKAGFGPGRHAAEPQGDLLLPARDAVVLWHYKHLGFERNATRE
                     AAQAARLGRADVAQGLGQHYLWGRERLCAFWDEMERESVDLGRVVPDTACIWPLWREE
                     RGLPRVDPAPLPPLAAALPAVAPAVSVLVKACNHAPYVRQIHAGPESLGG"
     gene            248913..251390
                     /locus_tag="MNOD_RS39565"
                     /old_locus_tag="Mnod_8022"
     CDS             248913..251390
                     /locus_tag="MNOD_RS39565"
                     /old_locus_tag="Mnod_8022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="WP_012631219.1"
                     /db_xref="GI:501740245"
                     /translation="MVALRRGLLVTTILVPCGAVGLAGRAAAQGDTIALEQIDVVPVT
                     PVGGAGGAARAETGAAGGALPLSKVPFTAETVTARQFEQDRATLDPTFTLARTTPGVS
                     LSDGQGNSFRQTLTYRGFDASPLQGAPQGLAVYQNGTRINEAFGDVVNWDLIPQVAIN
                     RIDLVTGNPIFGLNALGGAVNIAMKNGFTWQGQEVSVMGGSDGRILGTLQYGEVVGPW
                     SFYFAGEGLKDDGWRFRSPSEIGRVYADIGHRTPDSEFHLIASGAKTFFGATSAAPVD
                     LQRLTERAIFTNPQTIDTEAGQIQVTGKVNLSPTWDLAGNAYVRRFSQFVVDGNDGNF
                     ENCSTRSSFRGFLCFEDDGFSPAPGQTQAQFRNQFLILGPNGQPIPFRAGIPYGTHDT
                     VRTEATGYGGTLQATNRDRVFDHANTFILGGSIDAASYTFKSASTLGVINPDLSVTTD
                     PNNPTYGLIPGLGTGPIRTAAALGVAPSQVIGSNLYMGLYALDTFDVTDQLSLTAGAR
                     LNFARISTQDLTGFSPDVTGTHFFTRLNPVAGLTYRFFPWLTLYGGYSESNRAPTPLE
                     LACANPNRPCLLPNSLVADPPLQQVEAHTYEAGIRGTVPDVAEGGLLTYKLGFFRTDL
                     TNDILQIAVPGNAARGYFVNVPATQRQGIEVAAEYVGERLRLYANYALIDATFQFRGD
                     LSSPNNPLADDGLITVRPGNKLPLVPEHQIKAGFEYAITPQWKFGLNVAAFSSSYFRG
                     DESNLNRKLPAYAIANLNTSVQLTRNMEVFALVTNLFNTRVPNFGTFLERTEPGELFA
                     NRYALNDPRTTALIQPLSVYGGMRVTW"
     gene            251419..252072
                     /locus_tag="MNOD_RS39570"
                     /old_locus_tag="Mnod_8023"
     CDS             251419..252072
                     /locus_tag="MNOD_RS39570"
                     /old_locus_tag="Mnod_8023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="WP_012631220.1"
                     /db_xref="GI:501740246"
                     /translation="MTGVLIIDDRPIVLDTLRRLLAPTGITVHTTTSPAEGERLAREF
                     ALTLVVTDLAFPGTPLGGLALIRRLRSRPPAPRVLVFSMYDEAPVARQALQAGALGYV
                     CKTAGLEEFAQAYRYVLSGKGYLNPDLAFALAVPPPPPADPLDRLTGRQLRILQLLAG
                     GQTYRRIADLLLLSVKTIANEVATIGRQVQVPDKAGMVRFAIRYRDAIVARQAADLP"
     gene            252268..252672
                     /locus_tag="MNOD_RS39575"
                     /old_locus_tag="Mnod_8024"
     CDS             252268..252672
                     /locus_tag="MNOD_RS39575"
                     /old_locus_tag="Mnod_8024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding protein"
                     /protein_id="WP_012631221.1"
                     /db_xref="GI:501740247"
                     /translation="MTSALRTAAVLTAMLGLMPAAPVLAASPAAAIKAMDPDNDGTLD
                     LAEVKAAATALFAALDPDKDGTLDAKELKGRVSAKQLKALDPDKDGTLDQAEYLALVE
                     AAFQAANPDGDGTVDAKELSTSKGKALLKLIQ"
     gene            253172..253393
                     /locus_tag="MNOD_RS39580"
     CDS             253172..253393
                     /locus_tag="MNOD_RS39580"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754008.1"
                     /db_xref="GI:760071200"
                     /translation="MSGEEFDRYAGAGILSCQGKTQAVCILAFNLEQMPFTSQTIGRS
                     WDCAGASKPQHRNLFQMQGPFQPVPSEFL"
     gene            complement(253707..253973)
                     /locus_tag="MNOD_RS39585"
                     /old_locus_tag="Mnod_8026"
     CDS             complement(253707..253973)
                     /locus_tag="MNOD_RS39585"
                     /old_locus_tag="Mnod_8026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012452436.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631222.1"
                     /db_xref="GI:501740248"
                     /translation="MSDAAIKLSGLVRFVAEDCPDDKPDYDRFRQVMMSLGIDLEALS
                     SGAYVIKSMRYTEKYKENRQINCKLAHEKFGKEGNVIPGLLIPK"
     gene            complement(254131..254766)
                     /locus_tag="MNOD_RS39590"
                     /old_locus_tag="Mnod_8027"
     CDS             complement(254131..254766)
                     /locus_tag="MNOD_RS39590"
                     /old_locus_tag="Mnod_8027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012631223.1"
                     /db_xref="GI:501740249"
                     /translation="MSGSVLIIDDHPVVLQGCRVVLEDAGLATIHVATGVEEGYQSFY
                     RNRPGLVVADLTFQDSGLTGLSLIRRIRALEPATRILVFSMHDDPVIVARALEGGAIG
                     YLLKDTPSVDFATAVARVQAGEPYIDHRLAMKVAILQSSQRVSPLLALTGRELQIFLL
                     LSRGKSYEMIAKYLSLSYKTVANTCSSMRRKLGAESLSELIRLAIRHHSQS"
     gene            complement(254829..255335)
                     /locus_tag="MNOD_RS39595"
                     /old_locus_tag="Mnod_8028"
     CDS             complement(254829..255335)
                     /locus_tag="MNOD_RS39595"
                     /old_locus_tag="Mnod_8028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007565443.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631224.1"
                     /db_xref="GI:501740250"
                     /translation="MRRGAQLAAACLLLSACGEAGEGGSQPATVVARHDAGAMPAWLA
                     PDDRTDPALWLAARAAGRLVPAKDPAVARLRAALARAAPRFIKDPRMIANRTAQVLDM
                     LHAAGLPGEAEPILDGLMGIAAAAGARQLYGSLGQHYVNTRIAGAAHRDAVDRLSTKY
                     APQSLKQP"
     gene            complement(255332..256276)
                     /locus_tag="MNOD_RS39600"
                     /old_locus_tag="Mnod_8029"
     CDS             complement(255332..256276)
                     /locus_tag="MNOD_RS39600"
                     /old_locus_tag="Mnod_8029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019904712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631225.1"
                     /db_xref="GI:501740251"
                     /translation="MGRRFAAPVVALLAGTPAAAPAQAGDAYVVSQEGGVVTRIDVAA
                     GRVAAMIPVGPGPAGIAPGPDGRLYVTHPDHRLISVIDAAAGRVVARLPHAGTPFGIA
                     VAPAGDVLFVGDWVRHEVARLDARTGAPVGAPVPVQDPAGLVLDRAGGRLYVAEREQR
                     RVVVIDARALRVLGAVPTGEGPFALALSPDETRLYVANVRSRDLTVIDTGTLRPLATV
                     AVGPMPYGVAPTPDGRFVVVSNQQAGTVSIVDAATLAVAGEVAVGRYPEGVLAVAADR
                     VAVANWFSGDLSLVDPAARREVARLGLAEGPRSLAGAP"
     gene            complement(256276..256803)
                     /locus_tag="MNOD_RS39605"
                     /old_locus_tag="Mnod_8030"
     CDS             complement(256276..256803)
                     /locus_tag="MNOD_RS39605"
                     /old_locus_tag="Mnod_8030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631226.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MxaD protein"
                     /protein_id="WP_043754011.1"
                     /db_xref="GI:760071203"
                     /translation="MRLFGAALILGLLATLAPAHGPTPQKIEASTAIAAPPQKVWAVL
                     GDFGGIGGWHPAVVTSEGSGGTANGATRAVTLKRGGVLRESLDEYDAGRMTYSYRLSE
                     PDLAALPVSSYSATIAVTPDGAGSRVAWFGRFYRGDTGNEPPEELNDAAGRAAMKAYF
                     ETGLAGLKAKVEGGS"
     gene            complement(256806..257810)
                     /locus_tag="MNOD_RS39610"
                     /old_locus_tag="Mnod_8031"
     CDS             complement(256806..257810)
                     /locus_tag="MNOD_RS39610"
                     /old_locus_tag="Mnod_8031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631227.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_012631227.1"
                     /db_xref="GI:501740253"
                     /translation="MTGRLAAILRAGLRRLRSDPHGRLLAGAALLTGLALAMPPVALT
                     RSRVEALVVVDITGSMNTRDYARDGRPASRLEITKAALRWMAADLPCGSRLGLALFSE
                     RRVFLLFEPVEVCADFAPLDGAIAGLDWRMAWDGDSRIAAGLHRAIALAGELGSDLAF
                     VTDGHEAPPLPAGGPPPFEGRAGAVRGVILGTGGYGLSPIPRYDDRGRETGFYGPGDV
                     PHENRFGPPPPDAETREGYNPRNAPYGALPAEGSEHLSSVREAYLRRLAGETGLAYAH
                     LAGPDGLAEPVTAAATPRPVRAVVDLRPIPGALALACLVALYGLLPWRDRRRLQYGKV
                     "
     gene            complement(257807..258412)
                     /locus_tag="MNOD_RS39615"
                     /old_locus_tag="Mnod_8032"
     CDS             complement(257807..258412)
                     /locus_tag="MNOD_RS39615"
                     /old_locus_tag="Mnod_8032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631228.1"
                     /db_xref="GI:501740254"
                     /translation="MIASGFPAARRPGLRPIWLRLRSPLLLVLPGLLAAAALGAVALA
                     WRDIAANRTIAALEAGKDAAVASGALPEVLLARIRFLARRERFEEAEPLTDALDRRGP
                     ARLRGEARRVLGDARLRQAFGRLEAGDLEKAGPLVVLAREAYRRALTLRPDDWDAKYN
                     LDVASRLVRDFPERGRTEGEEMPADPRKIWTDIPGQPRGLP"
     gene            complement(258409..259470)
                     /locus_tag="MNOD_RS39620"
                     /old_locus_tag="Mnod_8033"
     CDS             complement(258409..259470)
                     /locus_tag="MNOD_RS39620"
                     /old_locus_tag="Mnod_8033"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="VWA domain-containing protein"
                     /protein_id="WP_012631229.1"
                     /db_xref="GI:501740255"
                     /translation="MSLLARLAATTPDLLWLLPLALLPLLGPALRRHPLPAAAMVPAD
                     GLSRAIGLGLTLAGIGAIGFTLVAVAGPFLRGERIHRTGTGAQVSLLIDRSGSMNESF
                     AGRQPSGAEESKAAASRRLLAEFVGRRPHDQVAVSVFSTAPIAVLPMTDRSEAVRAAI
                     RAIDRPGLDATNVARGLGLALSQFGAGASTGRVLLLVSDGAAVIDRRTQDTLRAAFAQ
                     LRPTLYWLFLRTAGSPGLADRPSGEDTPQAAPERHLDLFFRGLGVPYRAFEAESPQAV
                     EEAIREIDRLERHPIALVEERPRRDLTGLAYGLAGLCIGILLLAKLIEADLAAPCRAS
                     DAADVVRAGSAPADARRVA"
     gene            complement(259467..260399)
                     /locus_tag="MNOD_RS39625"
                     /old_locus_tag="Mnod_8034"
     CDS             complement(259467..260399)
                     /locus_tag="MNOD_RS39625"
                     /old_locus_tag="Mnod_8034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MxaA protein"
                     /protein_id="WP_043754223.1"
                     /db_xref="GI:760071417"
                     /translation="MPALLVLLAILTAAPAAAQVGDVVVRSPRPFGLFAGDLFTAEVE
                     IAVADGLSLEPASLPKPGPLTRWLDLRAVAVTAGPVKDGERRWRLTLTYQTFYVALDA
                     RKLEVPGFPVTFAAQTAAALTTASAEVPGWPVGVSPLREVQPAPVDDPADHMRPQAPA
                     PRRDPGPATVAALGLSALALAALGLLAHDRAWWLFRRRPARAFAAALRQLRRLARSPD
                     PDAAYRGALLALHRGLDRTAGRRVLADDLGAFLDRHPVYRPLAQPLARFFQASRETFF
                     GRDPAGARAAWPLAEAETVARRLAAVERIAERPA"
     gene            complement(260411..261262)
                     /locus_tag="MNOD_RS39630"
                     /old_locus_tag="Mnod_8035"
     CDS             complement(260411..261262)
                     /locus_tag="MNOD_RS39630"
                     /old_locus_tag="Mnod_8035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631231.1"
                     /db_xref="GI:501740257"
                     /translation="MSAPDILYRLRDPAAGPGPGAHRARDTGGPGIFRDQVPFWRHPD
                     ARRIDLRATLRDPFGTTMVRRFEQPRAVEVWVLLDLSASMRFCGRSEPWRLACDLCVA
                     LAHSATRIGDAFGLIGCDAGPREDVTLPATRRRCAAARVTAMLDAVVPHGRGAAGLVA
                     AAGRLAGRRRLVLVVSDFRMPEAQVAALFDRLAPHDLVPVLVDDDALGADLPDFGLLA
                     LDDLEGGGRRLVLMRPALKARWLAREAAFRTALHRLALARGRPPYRLAGRLDADELSR
                     HLLGTAA"
     gene            complement(261259..262290)
                     /locus_tag="MNOD_RS39635"
                     /old_locus_tag="Mnod_8036"
     CDS             complement(261259..262290)
                     /locus_tag="MNOD_RS39635"
                     /old_locus_tag="Mnod_8036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_012631232.1"
                     /db_xref="GI:501740258"
                     /translation="MNQIRPADAMLTDWREAALRFEREVGKAVIGQERAIRLVTIAIF
                     VRGHVLLEGDVGVGKTTLLRAVARALGGSYERIEGTVDLMPADLIYHTFLADDGRPRV
                     EPGPVLRRAEDLSVFFFNEINRARPQVHALLLRLMAERSVQAFEREYRFPHLLVFADR
                     NRVEREETFELPAAARDRFLMEIGLEAPRDPELRRRLAFDPRFHDTDRLIGEVAPGIL
                     DHAAIGGIAAAIQHGIHASPDLEAYVVALWAALLDPAAAGIRLPDIAMEALVQGGASP
                     RGIAFLIRAARVRAWLEGRDMLVPEDVREVFLETMAHRVFLEPVYEMRRERLVPELCR
                     AVLAAVPVP"
     gene            complement(262424..262723)
                     /locus_tag="MNOD_RS39640"
                     /old_locus_tag="Mnod_8037"
     CDS             complement(262424..262723)
                     /locus_tag="MNOD_RS39640"
                     /old_locus_tag="Mnod_8037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methanol dehydrogenase"
                     /protein_id="WP_012631233.1"
                     /db_xref="GI:501740259"
                     /translation="MRMTLAAAAIAAGTLVAGTALPALAYDGTKCKAAGDCWEPKPGF
                     PDKIAGTKYDPKHDPKELNKQADSIKAMEERNRKRVEAFKRTGRFEYDVTKLASQ"
     gene            complement(262817..263425)
                     /locus_tag="MNOD_RS39645"
                     /old_locus_tag="Mnod_8038"
     CDS             complement(262817..263425)
                     /locus_tag="MNOD_RS39645"
                     /old_locus_tag="Mnod_8038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcdA"
                     /protein_id="WP_012631234.1"
                     /db_xref="GI:501740260"
                     /translation="MMKRWTALSASLGLVVTITALGPLAGALSPRATAQSSSVDLRSV
                     VTGEKLDLNEALPEGRDTEGVKRFLASGRNPYLFDASCLKKGEQTFLAACSGCHGHVG
                     EGKIGPGLNDNYWTYPQGTTDAGLFSIVFGGAQAQMGPQSLSLTLDDILQAMAWVRHL
                     YTGPAQDAEWLSEDQKKSYTPYKLGETFPDDPPGMCRGSGKS"
     gene            complement(263488..264333)
                     /locus_tag="MNOD_RS39650"
                     /old_locus_tag="Mnod_8039"
     CDS             complement(263488..264333)
                     /locus_tag="MNOD_RS39650"
                     /old_locus_tag="Mnod_8039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein moxJ"
                     /protein_id="WP_012631235.1"
                     /db_xref="GI:501740261"
                     /translation="MLRSLVGGLAGLTALAAAAGAAPATAPATGQPALRVCAAASQPP
                     LSLRDGSGLENKVAAAVAAAMDRKVEFVWSDKPAIYLVRDFLDKKLCDVIAGLDTGDA
                     RVLTTRPYYRSGYVFISRQQDGLDVASWTDPRLKQVGHVAVPFGSPSEAMLKRIGRYE
                     EDMAYLYSLVNFRSPRNQYTQIEPARLVEEVATGKAAIAAPFAPEVARFVKASPVPLR
                     MTLIADDASRDGQKITMQFDQSMGVRRGDETLLKELEAGLAKAKPAIEAILKEEGVPT
                     LPTGS"
     gene            complement(264401..266275)
                     /locus_tag="MNOD_RS39655"
                     /old_locus_tag="Mnod_8040"
     CDS             complement(264401..266275)
                     /locus_tag="MNOD_RS39655"
                     /old_locus_tag="Mnod_8040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631236.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methanol dehydrogenase"
                     /protein_id="WP_043754224.1"
                     /db_xref="GI:760071419"
                     /translation="MVRCRTGVSVAALAALLPLAGPSALANDKLVELSKSDGNWVMPG
                     KNYDSDNYSKLKQINAENVKNLKVSWQFSTGLLNGHEGAPLVVDGTMYVHTSFPNNTF
                     ALGLDDPGKILWQDKPKQNPAARSVACCDLVNRGLAYWPGDGKTPSLILKTLLDGHVV
                     ALNAQTGETVWKIENSDIRVGSTLTIAPYVVKDKVIIGSSGAELGVRGYLTAYDVRTG
                     EQKWRAYATGPDSDLLLAKDFNIHNAHYGQKGLGTSTWEGDAWKIGGGTNWGWYAYDP
                     GTNLIYFGTGNPAPWNETMRPGDNKWTMTIFARDVDTGEAKFGYQKTPHDEWDYAGVN
                     VMMLSTQKDRSGKERKLLTHPDRNGIVYTLDRTNGDLISAHKIDDTVNVFKTVDLKSG
                     LPVRDPEYGTRMDHLAKDICPSAMGYHNQGHDSYDPERKLFYMGINHICMDWEPFMLP
                     YRAGQFFVGATLNMYPGPKGDRQNAEGLGQIKAYDAITGKFKWEKMERFAVWGGTLAT
                     AGNVVFYGTLDGFIKARHSDTGELLWKAKLPSGAIGYPVTYTHKGTQYVAIYYGVGGW
                     PGVGLVFDLQDPTAGLGAVGAFKKLANYTQMGGGVTVFSLDGKGPYDDPNTGEYVAAN
                     "
     gene            complement(267121..268188)
                     /locus_tag="MNOD_RS39660"
                     /old_locus_tag="Mnod_8042"
     CDS             complement(267121..268188)
                     /locus_tag="MNOD_RS39660"
                     /old_locus_tag="Mnod_8042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_012631237.1"
                     /db_xref="GI:501740263"
                     /translation="MPADHNFPTDRTKLARLLFPAGVPMLWSPTLVFYDEAGRIDRDR
                     QLAHLAFMAPHVKGYLVPGSTGDAWEMDDAEALTALEVAIPFAVQHGLDLLVGVLRPT
                     TDAMHALIDKVLHYLCRRAGTHSVADAFAASHVRGLTIAAPTTDTPLSQDAIGAALAP
                     VFELGLPIALYQLPQVTGNTMTPELVAGLAERFPNLLLFKDSSGRDEVALSGRMPAGV
                     TLLRGAEGDYAQWSKAHGGVYDGFLLSSANAFPAQLATVLEHLQHGRIAEAERCSAAI
                     SAAVADAFAAVVEVRQGNAFTNANKALAHIMAYGRDALEAPPPRLYAGGHLPHSTLKT
                     VMESLTRNGLLPGRGYLENRG"
     gene            complement(268259..268627)
                     /locus_tag="MNOD_RS39665"
     CDS             complement(268259..268627)
                     /locus_tag="MNOD_RS39665"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009941138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783631.1"
                     /db_xref="GI:915398246"
                     /translation="MRELIQVGRIGTPIIDVTWDGGPTFAKKVATVAEAFAKPVAFHD
                     CSGPVTLAVSTHLAMACPNVVEQEITRGFYYGWYHGCVDQLPPLENGFIRPPEGHGLG
                     LSLAADILTRPDAILRTTEA"
     gene            268948..270168
                     /locus_tag="MNOD_RS39670"
                     /old_locus_tag="Mnod_8044"
     CDS             268948..270168
                     /locus_tag="MNOD_RS39670"
                     /old_locus_tag="Mnod_8044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012631238.1"
                     /db_xref="GI:501740264"
                     /translation="MTRRHLCATLALLGLSLPLAGTAEAQISDDTVKIGLITDMSGMY
                     ADADGPGGAEAIRMAIADFGGTVAGKKIEFVVADHQNKADIGSAKVREWIDRDGVDMV
                     LAGPNSSVGLAVAKIAADRKKPFIAIGSTSSRLTNEECSPFTIHYAYDTVSLSKGTGS
                     AIVAAGGKNWYFLTADYVFGLSIEKDTRDVITAKGATVAGSIKHPLGSSDFSSFLLQA
                     QGSGADTLALANAGADTINSIKAAHEFGISDTMKIVAMNMYLTDVHSLGLPVAKNLFM
                     TDGWYWDLNDESRAWAKKYFAKLGRMPTLLHAADYSAVTTYLDAVKATGTDAGEAVMK
                     QIKATPINDFFAKGGHVRPDGRMIHDMYLVQVKTPEESKYPWDYYKLVKVIPGEEAAT
                     SKAESRCALWTAEN"
     gene            270205..271356
                     /locus_tag="MNOD_RS39675"
                     /old_locus_tag="Mnod_8045"
     CDS             270205..271356
                     /locus_tag="MNOD_RS39675"
                     /old_locus_tag="Mnod_8045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="WP_012631239.1"
                     /db_xref="GI:501740265"
                     /translation="MFNDLTDDESALKRAVEAFAQGQLKARIAPFVEQHEFPSDLVRA
                     FAGLGFMGTAYDPDYEGGGLGTRGAAIVAETLAEVEPGFAAIYLCNSAPMSVIARFGS
                     DALKREWLAPLCRGDCIASFGVSEPHGGSDVASTRTRAVRDGDDWILTGSKVFSTNAG
                     TDLHGLSAVVAVTDPDKGAKGLSTFVVPVGTPGFRVGKAGRKVGWRIAPSVELFFDEC
                     RIPGRLMVGAQGEGLRQILTTLSLGRILVAAAALGLSRKALGLAARYGRDRRVGGRPI
                     FENQGLTFPLADAMTQIHAAELMVRNAACLADAGRPFRLETSMTKLFASEMAGEIVDL
                     AVQVHGGYGIFEDYEVSGLMGEAKVLQIVEGTSEVQRLVIARELLQHVG"
     gene            complement(271385..272059)
                     /locus_tag="MNOD_RS39680"
                     /old_locus_tag="Mnod_8046"
     CDS             complement(271385..272059)
                     /locus_tag="MNOD_RS39680"
                     /old_locus_tag="Mnod_8046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020095363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_012631240.1"
                     /db_xref="GI:501740266"
                     /translation="MLNKTPSISQADAAYCRIEEMIVTRELAPGQMISEKRLSEQLGC
                     GRTPLREALQRLKLEGYVEIHASRGILVAPIDVMRQLDLLEVRRSLEDLMVRLGAERA
                     SAPEREHLRALARDLQDAAAANDRTAFLRLNRAVHHALSRVSHNEMLASTIAVVHGQS
                     RRFWYSQFEGQGLFEQAARFHGATLEAVAGGNADEASRHAAAFLDFLETLTRNAIERR
                     AAYARS"
     gene            272205..273530
                     /locus_tag="MNOD_RS39685"
                     /old_locus_tag="Mnod_8047"
     CDS             272205..273530
                     /locus_tag="MNOD_RS39685"
                     /old_locus_tag="Mnod_8047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="WP_012631241.1"
                     /db_xref="GI:501740267"
                     /translation="MDRRDRMRLQSDVLIVGGGAAGVAAAVTAARQGLKVTLVERYGF
                     CGGGAVAGLSGTVCGLYAATDDRQAPPEQVVFGFADEFCRRLDGLGGLSAPMPYGKTY
                     TRVHDPLIWRETADSFLREAGIEVIFHAVAVGALCEGDRVEGLEIWTKEGPIDARASV
                     VVDASGDADVVALAGLPSFIGDNGTVQNPTMIFRLMGVDVDRFKAEYGEDTIMPERIS
                     ELIRRKDNLGEYHLPRAKIWLFPTTRPGELLCNCTRVLGPDGRELNTLRWLDFTDAEF
                     EGRRQMREYARFFRDNLVGCESAFVNDTGVQVGVRQTRQMSGRSRLMNADVVSGAKSP
                     EGIARSPWPIELHAGQKPRVEWLLNDYYEVPFGCFVPERGEGLLAAGRCLSAEHEAVA
                     SARVTAQCFAYGHAVGHAAAIAVKDKVSTRSISGADLRALLNRDGAALD"
     gene            273606..274349
                     /locus_tag="MNOD_RS39690"
                     /old_locus_tag="Mnod_8048"
     CDS             273606..274349
                     /locus_tag="MNOD_RS39690"
                     /old_locus_tag="Mnod_8048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631242.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="enoyl-CoA hydratase"
                     /protein_id="WP_012631242.1"
                     /db_xref="GI:501740268"
                     /translation="MVRSETRGSVAIVTLDRAARRNALGTESMRALSAALRAADADES
                     VRAIVLTGAPPAFCAGSDLKELGGLSIPAMCDHEAETATVARSIGFLTKPVVAAVEGY
                     ALGGGFILAVSCDVVVSAENARWHLAEVTNGWLPVWGLQALLARVGPVRARLLTWGVE
                     SIDGREALRLGVADYTAEAGGALDRALAVAQGLAKLPPEAVTSTKRFFEPFVMADAER
                     LDNVASRMFARDCESASAQATLARFTVRS"
     gene            274346..275938
                     /locus_tag="MNOD_RS39695"
                     /old_locus_tag="Mnod_8049"
     CDS             274346..275938
                     /locus_tag="MNOD_RS39695"
                     /old_locus_tag="Mnod_8049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="propionate CoA-transferase"
                     /protein_id="WP_012631243.1"
                     /db_xref="GI:501740269"
                     /translation="MTKIVDAARFVETIRDGSTVASVGVIGWITPDRILKALGDRFRE
                     TGSPRDLTFYFPCGTGDAQGIKGMDHVAQEGLMKRIVSGSFINPVDPVTGKRPELMRL
                     VRENRIEAYSWPIGASMHWLREVARKSPGYITRVGLGTYIDPDLGGGKFTAKAAEDLV
                     RAIELDGERLLYYPTWPIDTAIVRASSADEEGNLSFEDEPLTSSSLALVLACKACGGR
                     VVAQVRRIVPHGERPASAVRVPGMFVDAVVVDEDMMMTTGVPYDPSYFSGTRIPLSQL
                     PRPEMGPDKVIAARAAKEVRRHELSIFGFGAAADIPLVMNEQGLFKDGAIKDWWFTTE
                     HGSYGGVVMSGWQFSANVNPDAILDGVTQFDVIDGGLCRFAALAFAQFDEKGRVNVSR
                     FGAANPGAGGFIDIAERAERLVFTGTMTTGGLSIAYEDGRTRVLKEGKVKKFARCVES
                     ITYDVGAGVRERGQTALIVTERAVFEMTPEGLVLTEIAPGIDVERDVLGQMEFAPARI
                     SESLREMDAALFHQRMQLALAG"
     gene            276037..276822
                     /locus_tag="MNOD_RS39700"
                     /old_locus_tag="Mnod_8050"
     CDS             276037..276822
                     /locus_tag="MNOD_RS39700"
                     /old_locus_tag="Mnod_8050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631244.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_012631244.1"
                     /db_xref="GI:501740270"
                     /translation="MQPARAAAPDDRDIVLATEGLTMEFKGFRAVNGVALRVERGTIH
                     ALIGPNGAGKTTCFNLLTKFLTPTAGAIRYNGRDITRMKPADVARLGLVRSFQISAVF
                     PHLTVKENVRIALQRRQRGDSFDFWRSERVLRALNDEALSLIEAVGLADFAEVPAVEL
                     SYGRKRALEIATTLALNPAMLLLDEPMAGMGHEDVDRTAALIRRVSANRTILMVEHNL
                     SVVASLSDRITVLARGQVLAEGDYATVSKDPRVVEAYIGAGHG"
     gene            276815..277549
                     /locus_tag="MNOD_RS39705"
                     /old_locus_tag="Mnod_8051"
     CDS             276815..277549
                     /locus_tag="MNOD_RS39705"
                     /old_locus_tag="Mnod_8051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015930957.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="WP_012631245.1"
                     /db_xref="GI:501740271"
                     /translation="MAEAALTTSAAAAPLLAVQGLEGWYGESHVLHGVSFDVRPGEVV
                     TLLGRNGAGKTTTLRAIIGILGKRKGSIRYAGTETIGMASRSIAKLGLGYVPEERGIF
                     SSLSVYENLMLPPRVKPGGMSVEQIYTLFPNLQERAGSQGTKLSGGEQQMLAIGRILR
                     TGAKLILLDEPTEGLAPVIVQQIGRTLARLKSEGYTIVLVEQNFRFAQTVADRHFVVE
                     QGRVIDMIPNAELDANIDKLHAYLGV"
     gene            277553..278440
                     /locus_tag="MNOD_RS39710"
                     /old_locus_tag="Mnod_8052"
     CDS             277553..278440
                     /locus_tag="MNOD_RS39710"
                     /old_locus_tag="Mnod_8052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_043754015.1"
                     /db_xref="GI:760071207"
                     /translation="MTMIFGVPLQALFGQLLLGLINGSFYAILSLGLAIIFGLLNIIN
                     FTHGAQYMMGAFVAWMLLNYAGIGYWWALLLAPLAVGLFGVILERLLIARLYKLDHLY
                     GLLLTFGLALIIQGLFRNQYGVSGLPYAIPAELSGGQRLPFMFLPNYRGWVVVASLVV
                     CLATWLVIEKTKLGAYLRAATENPTLVQAFGVNVPLLLTLTYGFGVALAAFAGVLAAP
                     VYSVNPNMGADIIIVVFAVVVIGGMGSILGSIVTGFTLGLVEGLTKVFYPEASSTVIF
                     VIMVLVLLVKPAGLFGRTA"
     gene            278483..279478
                     /locus_tag="MNOD_RS39715"
                     /old_locus_tag="Mnod_8053"
     CDS             278483..279478
                     /locus_tag="MNOD_RS39715"
                     /old_locus_tag="Mnod_8053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012631247.1"
                     /db_xref="GI:501740273"
                     /translation="MAHSAATAPDDATPIASALPEGRDTKALHRLVFIGIAVALAVLP
                     LILYPVFLMKVLCFALFALAFNLLLGYGGLLSFGHAAYFGMASYIAAYGAKVWGLSPE
                     LAILAGTLTAALLGLVFGALAIRRQGIYFSMITLALAQMVFFFSLQAAFTGGEDGIQA
                     VPRGQLFGVISLADDRVLYALVALIFFLGLLLIYRIIHSPFGQVLKAIRDNEPRAVSL
                     GYRASQYKLAVFVLSTTLAGLAGATKAIVFQLASLTDVHWSMSGEVVLMTLVGGMGTV
                     FGPIIGAFVIVAMENYLAQFGAWVTIIQGVVFVICVILFREGIVGLCARMLKKPL"
     gene            complement(279974..280549)
                     /locus_tag="MNOD_RS39720"
     CDS             complement(279974..280549)
                     /locus_tag="MNOD_RS39720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_043754227.1"
                     /db_xref="GI:760071422"
                     /translation="MPPGTVLAEQGLAQRLQIGRTPIREALQRLARDGLVVVIPRRGI
                     LVSEINLRTQLRLLETRRVLEHLIARLAAERATAEERRAFAEIAANMRAAADAADDIA
                     FMRLDRQFNELAAAASRNEFAVRSLNSMAALSRRFWYQHYKEAADLPLAANLHAEVCE
                     AIAKRDVKAAGEASDRLMDYIDSFARKTLDT"
     gene            280893..282305
                     /locus_tag="MNOD_RS39725"
                     /old_locus_tag="Mnod_8056"
     CDS             280893..282305
                     /locus_tag="MNOD_RS39725"
                     /old_locus_tag="Mnod_8056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_043754025.1"
                     /db_xref="GI:760071217"
                     /translation="MAGQVALPADTPVLGAATAVAGQGSAAMVAARLERLPMTGFQRT
                     IFIIIATAWFFDSIDLGSLTFLLGSIRTEFGLSTAQAGLLSSMSFVGMFLGAGISGML
                     ADRFGRKLVFQVSMIFWGLGSVWCAYAPDSTALGYARLLLGFGMGMEFPVALAIVSEF
                     LPSAKRGRYLAVLEGFWPLGFIAAGLLSLVLLSTFGWRAVFLAQAVPALFLFVVRMFV
                     PESPRWLADRGRFDEANRVLADIEAKVRARLDGRPLPEPQPLPAQAQGERRFSFLELW
                     SSGYASRTVMIWLTWFFALLGFYGLTTWLGALLQEAGHSVTKSVSYTILISLAGVPGF
                     ISSALLVEGWGRKPTAVLMLLGSAIAAYLYGHSPSFGWLIAFGLVMQFFLFGMWSVLY
                     AYTPELYPTRARATGAGCASAIGRVGSLLGPYAIGVILPVLGQGGVFALGGGSFVIAA
                     AAVAILGVETKGKSLEAISH"
     gene            282595..283386
                     /locus_tag="MNOD_RS39730"
                     /old_locus_tag="Mnod_8057"
     CDS             282595..283386
                     /locus_tag="MNOD_RS39730"
                     /old_locus_tag="Mnod_8057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020095787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid hydroxylase"
                     /protein_id="WP_012631250.1"
                     /db_xref="GI:501740276"
                     /translation="MELAVTNMSERQRNYRANYRQRVAGWYNGFLHIAIIYTIGLTAL
                     YIYISNLHSVTWLEWLTVPVVFLFCNFFEWWLHRYVMHRPSNNPIARAVYNRHTLQHH
                     QFFTDHEMRFADHRDYRVTFFPPYALATFTLMSVPGAIVLGNLFTPNVGWLFITTTTS
                     IYLIYEFMHFCCHVDENWFVRNMPLINTNRRHHTAHHDQSIMMERNMNLTFPIMDWLF
                     GTSDLDRGLLGTLFNGYDTRFVKKDMRKTSRTPGAPAQGCMQPAE"
     gene            283612..283998
                     /locus_tag="MNOD_RS39735"
                     /old_locus_tag="Mnod_8058"
     CDS             283612..283998
                     /locus_tag="MNOD_RS39735"
                     /old_locus_tag="Mnod_8058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631251.1"
                     /db_xref="GI:501740277"
                     /translation="MDMVEPNVVALLWFTIFAGVTCLGFYVLTGAFPLETRPDLKRPL
                     GLALLSINLLLLVALGAGSVAYGVEHLRWTSLVIVGGFAFLFAPGLFNVWPTKWRDGQ
                     AGLAIVLAGFGATLGALQAVGNVFSL"
     gene            284024..284245
                     /locus_tag="MNOD_RS39740"
                     /old_locus_tag="Mnod_8059"
     CDS             284024..284245
                     /locus_tag="MNOD_RS39740"
                     /old_locus_tag="Mnod_8059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631252.1"
                     /db_xref="GI:501740278"
                     /translation="MPFRIKFGLSIAVALAAVAGWFYMGYLGQIGPQRAVAFLGPFMV
                     FSLWIFPEVMRNRSDGRTPRHQLSGARRS"
     gene            284242..284532
                     /locus_tag="MNOD_RS39745"
                     /old_locus_tag="Mnod_8060"
     CDS             284242..284532
                     /locus_tag="MNOD_RS39745"
                     /old_locus_tag="Mnod_8060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631253.1"
                     /db_xref="GI:501740279"
                     /translation="MKVYTGDRTIDGIVVTVDGEPLDDQTSTKCYSRNGFEWSYEGPE
                     PSQLAYAILVDHLGDPAEAARLQDGFMRTVVANFQNEWEMTSADIDRVLRTL"
     gene            284591..285502
                     /locus_tag="MNOD_RS39750"
                     /old_locus_tag="Mnod_8061"
     CDS             284591..285502
                     /locus_tag="MNOD_RS39750"
                     /old_locus_tag="Mnod_8061"
                     /EC_number="2.1.2.11"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631254.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="WP_012631254.1"
                     /db_xref="GI:501740280"
                     /translation="MGATTTASVKALAADGAGRREKRTITDIRNSKRTGEKMVYMSVP
                     DYTSARWAEMAGVDVAVVGDSLAMVAHGHPSTIPATMDMMVLHAQAVRRGTPNTFVLG
                     CMPYQSYNTVERALTNATRFMQDALCDAVKPQGGRSQAHILKALVDAGIPTASHIGLT
                     PHTIATFGGFKIQGRTAEAAMKILEDALAIEDAGCFMLEFEAVPAPIAKLISEQLSIP
                     TIGIGAGAGCDGQILLAYDLLGVFIDFKPKFTKRYANLTEVAVTGIRSYVEEVKTGAF
                     PDDDHSYKVDPAEYERFASLVEKRRHI"
     gene            complement(285905..286096)
                     /locus_tag="MNOD_RS39755"
                     /old_locus_tag="Mnod_8063"
     CDS             complement(285905..286096)
                     /locus_tag="MNOD_RS39755"
                     /old_locus_tag="Mnod_8063"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631255.1"
                     /db_xref="GI:501740281"
                     /translation="MRQERIQFGPDLSKPLSLVPDLYLGLLKGLAEPCCFGHDRVRAL
                     DQGGVLDAHGDTYPPDYHP"
     gene            complement(286128..286394)
                     /locus_tag="MNOD_RS39760"
                     /old_locus_tag="Mnod_8064"
     CDS             complement(286128..286394)
                     /locus_tag="MNOD_RS39760"
                     /old_locus_tag="Mnod_8064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631256.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631256.1"
                     /db_xref="GI:501740282"
                     /translation="MTDYLQQEQEDLIQADRHLAAGEKRVIEQIVLLQRMTEKGYDTA
                     TGKDLLRLLEETMVIWQDHRQLILDAIARHERAISHSPQADPGP"
     gene            complement(286622..287392)
                     /locus_tag="MNOD_RS39765"
                     /old_locus_tag="Mnod_8065"
     CDS             complement(286622..287392)
                     /locus_tag="MNOD_RS39765"
                     /old_locus_tag="Mnod_8065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 11"
                     /protein_id="WP_012631257.1"
                     /db_xref="GI:501740283"
                     /translation="MADIHRAASEGFSAGADAYAAGRPNYPAQIVPWLCAELRLGPGR
                     VALDLGSGTGKLLPSLRETGARLIAVEPVAAMRDRLVRDHPDVQALDGRAEAIPLPDA
                     CVDAVVCAQAFHWFATPEALAEIARVLRPGGALGLIWNIRDERVGWVAALSEIMSRHE
                     GDVPHFHSGAWRRLFPAAGFGPLRETRVPHRHVGPPEAVILDRTLSVSFIAALPDAAR
                     AAVAAEVRALIAATPALAGRDEVVVPYETAAFACTRLG"
     gene            288837..289862
                     /locus_tag="MNOD_RS39770"
                     /old_locus_tag="Mnod_8068"
     CDS             288837..289862
                     /locus_tag="MNOD_RS39770"
                     /old_locus_tag="Mnod_8068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631259.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631259.1"
                     /db_xref="GI:501740285"
                     /translation="MKQLARHQVGGILLAALGSLAAPAQAAEGGFSFYIEGLAVPDAG
                     VLPPPGVYFDSSTYFYNGKIGGNRSTQLGGNVVADVKANIVADFATGLWVTPAEILGG
                     NLAFAFVMPFGTPAVRAGALLNGPLVNQVVGRPVGVSVSDATFNAGDPIVGTSLGWHS
                     GNWHWKVAGLLSIPAGAYEPGQLSNIALNRYIGDISAAATYLDPALGIELSAAAGFTL
                     NGKNPATQYVTGHEFHVEVSASKNLTKELSIGVIASHYQQITGDSGSGARLGPFKGRV
                     TAVGGMAGLTVPVGQIPVTARMKVLREVEVENRFQGTLGFLEVSFPLWVAPPKAAPET
                     KPVVAKF"
     gene            290113..291087
                     /locus_tag="MNOD_RS39775"
                     /old_locus_tag="Mnod_8069"
     CDS             290113..291087
                     /locus_tag="MNOD_RS39775"
                     /old_locus_tag="Mnod_8069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631260.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631260.1"
                     /db_xref="GI:501740286"
                     /translation="MAEAPVLDRPADSPDLLAGMVFVAGGTFRMGSDRHYPEEAPVHR
                     VSVDGFWIDRTPVTNAQFRAFVRATGHVTMAERKPKAEDYPGALPHMLQAGSLVFKPP
                     KGAVDLRDWSAWWRFRFGASWRRPLGPGSSIAGLDDHPVVHVAYADAEAYARWAGKEL
                     PTEAEWEYAARGGLDGAEFAWGDEFTPGGRHMANTWQGAFPHQNLAEDGFERTSPVTT
                     FPPNGYGLHDMIGNVWEWTTDFYAPKHPTDAPKACCIPQNPRGGQEKGSYDPAQPAIR
                     IPRRVVKGGSHLCAPNYCRRYRPAARHPHPVDTSTSHIGFRCVVRRGP"
     gene            291084..292757
                     /locus_tag="MNOD_RS39780"
                     /old_locus_tag="Mnod_8070"
     CDS             291084..292757
                     /locus_tag="MNOD_RS39780"
                     /old_locus_tag="Mnod_8070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631261.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_012631261.1"
                     /db_xref="GI:501740287"
                     /translation="MTDPLPSNAALDEEAAAKTISRRRMLLGGTALAASVAGTAPTIA
                     QAQQPAPAPQPAPVRTGATGRPVNILVMFGDDIGQSNISAYTFGLMGYRTPNIDRIAR
                     EGMMFTDYYAEQSCTAGRSSFITGQSTLRTGLSKVGLPGATVGLQKEDPTLAELLKPL
                     GYATGQFGKNHLGDRDEYLPTNHGFDEFFGNLYHLNAEEEPEQRTYPRDPEFRKRFGP
                     RGVIRSSADGKIEDTGPLTKKRMETIDDETSAAAMDFIERQVRANKPFFCWFNATRMH
                     LRTHVAENHRSPPGLTARTEYADGMVEHDGHIGQLLKKLDDLGIANDTIVLYTTDNGP
                     HMNSWPDSAMTPFRSEKDTNWEGAFRVPCMIRWPGHIQAGSVSNEIVSGLDWVPTLVA
                     AAGDPNIVDKLLKGHTAGAKSFKVHLDGYNQLPYLTGQQDRGARKGFFYFNDDGDLVG
                     MRYENWKIVFEEQRAPGTMRIWAEPFTPLRVPKLFDLRADPYERADITSNTYYDWLIS
                     NVYVLVPAQAEVAKFLDTFREFPPRQRAASFSVDQIVEKMKRATEVPSR"
     gene            292856..293860
                     /locus_tag="MNOD_RS39785"
                     /old_locus_tag="Mnod_8071"
     CDS             292856..293860
                     /locus_tag="MNOD_RS39785"
                     /old_locus_tag="Mnod_8071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631262.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="haloacid dehalogenase"
                     /protein_id="WP_043754232.1"
                     /db_xref="GI:760071427"
                     /translation="MLSGVATLVAAPGILRAGAAEGRADPLPSWNEGGPKQAILDFVG
                     RVTTSGGHDFVPPPERVAVFDNDGTLWAEQPVYFQVAFALDRVKALAPAHPEWKDTQP
                     FKGVIENDPKAVAAAGEKGLLQIVAATHAGMTTAEFDAVVKEWLRTARHPRFGRPYDS
                     LVYQPMLELLGFLRASGFKTFIVSGGGVEFMRTFAERTYGIPPEQVVGSSGVTKFEIR
                     PDGQPVLVKEAKVEFVDDGAGKPSGINRFIGRRPILAFGNSDGDQQMLEWTAAGAGPR
                     FLGLVHHTDGEREYAYDRQSHVGQLDKALDEAAERGWVVVDVARDWKSVFSAEPRTNR
                     "
     gene            293874..294482
                     /locus_tag="MNOD_RS39790"
                     /old_locus_tag="Mnod_8072"
     CDS             293874..294482
                     /locus_tag="MNOD_RS39790"
                     /old_locus_tag="Mnod_8072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007604902.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein FusE"
                     /protein_id="WP_012631263.1"
                     /db_xref="GI:501740289"
                     /translation="MASQPEPVMLPEARQAGVKALLDSQIGGENATVAQLRAQLGDAE
                     WELARTSIRAPADRYVTLSALAVGDRVTPMRSMMSFLIADDIVLLGVFQQNGLKTVIP
                     GAKVRLVLANDPGRIHDAKVLRVGRGVGQGQLSATGTLARIGAVGLTAEFPVEIELPR
                     DLDRNLLRPGMSGAATAFSPDAGPIGVIASILLWVSAYMAYL"
     gene            complement(294807..296189)
                     /locus_tag="MNOD_RS39795"
                     /old_locus_tag="Mnod_8073"
     CDS             complement(294807..296189)
                     /locus_tag="MNOD_RS39795"
                     /old_locus_tag="Mnod_8073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631264.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631264.1"
                     /db_xref="GI:501740290"
                     /translation="MMGPRQVEQGALFYEFSLDTHVPADHLLRAIDRFVDLSGLRAHL
                     RPFYSTTGRPSVDPELMVRMLLVGYCFGIRSERRLCEEVHLNLAYRWFCRLGLDGAVP
                     DHSTFSKNRHGRFRDSDLLREVFETTVQRCIEEGLVGGEGFAVDASLIRADANKQRSA
                     DASEAVDWNDLARIRRSVREYLDTLDEAAWGAASEVQPKFVSRSDPAAQWTGALKGHA
                     FFAYATNYLIDLDHAVIVDVEASRAIRQAEVGAARTMIARAQDRFGLWPARLAADSAY
                     GSAEQLAWLVHERGIEPHIPVFDKSERRDGTFSRSAFTYDPAADAYTCPAGHPLRPRQ
                     KVYRTPFPLVDDDGMMRYRASKRDCDACALKPRCCPTTPARKIPRSIHEGARQMARDI
                     CASEEGRTSRRERKKVEMLFAHLKRILKLDRLRLRGPNGARDEFHLAAAAQNLRKLAQ
                     LIPLQQLSPA"
     gene            296366..297136
                     /locus_tag="MNOD_RS39800"
                     /old_locus_tag="Mnod_8074"
     CDS             296366..297136
                     /locus_tag="MNOD_RS39800"
                     /old_locus_tag="Mnod_8074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_012631265.1"
                     /db_xref="GI:501740291"
                     /translation="MVKITGVLLDLSGVVFSGDEAIGDAVASIKDLRTNGIPFRFVTN
                     TTSKPVRTLAEKLRRLGIDASEEDIFTPASAARKLVHERGLSPYLVVHPDLLEDLDVP
                     SGRNPDAVIVGDAGQTFSYDVLNTAFRLINGGAAFIALARNRTFRDADGQLSLDAGPF
                     VVALEFATRSEAFLVGKPSASFYAAAIADLGTPACETAMIGDDAESDVAGALELGMAG
                     LLVRTGKYKDGDEFRIDRKPTATVPDLRRAVNWVLDRM"
     gene            complement(297207..297497)
                     /locus_tag="MNOD_RS39805"
     CDS             complement(297207..297497)
                     /locus_tag="MNOD_RS39805"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018069816.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754028.1"
                     /db_xref="GI:760071220"
                     /translation="MANSIAGALNLFPERAGAVSALVGAIHHGSGILRAGLVGAFADG
                     TPWPMGLVVTLADLGSAASDGRNRTFASREGPLGVNLVHSAPAARMAPQAPR"
     gene            297970..299070
                     /locus_tag="MNOD_RS39810"
     CDS             297970..299070
                     /locus_tag="MNOD_RS39810"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase"
                     /protein_id="WP_012631266.1"
                     /db_xref="GI:501740292"
                     /translation="MSTIRNVRPADGPSEAGGAQEPPMSSDSDYGDAVCTPPDLLSFI
                     LRESAAAQLWLAILVIAVFLAGVAPLEIQRRAVSQAVKGADPHALLWLAALYALAACG
                     LGLLKLVLNITRGFVSERAVRRLRASIMEDFHRSAEGRRLAQTRGVEIALVLDEAEPV
                     GGFVGVCFSEPLLQTGVLLTTLGYLAFLNPLMALLTLAVFSPQLVFVPLMQRAINRRV
                     SARISLLRRISGGLVGERSGSGALTAAEADQLQGVFLLNMGIFRIKFSMNFLMNMSYH
                     LGVAGILGVGGYAVTTGDTEVSTVVAFVAGLSHMNDPWGDLVNWFRECSVTRTKYALI
                     ARATEAAAGRQEAGRTDYRSSLDTSGGHPCVG"
     gene            complement(299142..300722)
                     /locus_tag="MNOD_RS39815"
                     /old_locus_tag="Mnod_8077"
     CDS             complement(299142..300722)
                     /locus_tag="MNOD_RS39815"
                     /old_locus_tag="Mnod_8077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="WP_012631267.1"
                     /db_xref="GI:501740293"
                     /translation="MPDESQSETVDFLRRCLAGHGRLETIRTHISVVLLAEDRVYKLK
                     RAVRFPFVDFSAPEARLAACEAELALNRRTAPALYRGVHRITRTPDGGLALDGTGPLV
                     DAVVAMRRFPQGDLFDAMTREGRLTPALVAALAHRIAAFHAAAEISRAPGGAAAMAAL
                     VALNDRGLRACGLASAGEADALTARFEAALARHGDRLEARRAAGKVRRCHGDLTLRNI
                     CLYEGVPTPFDCLEFDEALATIDVLYDLAFVLMDLWHRGRRDLANLLFNRYLDESDEA
                     DGAGLLPFLMAIRAVIRAHVTATQAAEAPGETARALRDEARAYLDLAGTLLAEEPATL
                     VAVGGLSGSGKSTFAAALAPWLGAPPGARIVSSDRTRKRLHGVSAVTRLSDSAYAPSV
                     SERVYAAMRDEAARVLATGGAVILDAVFDRPEAREAVEALARRCGVPFRGVWLQAPAA
                     MLAARIRARRDDPSDATIEVLAAQASRDCGPMTWHCLDAQLPAETLRATILASCGTGE
                     AKAEASRGGTAGTEVLPA"
     gene            complement(300749..303328)
                     /locus_tag="MNOD_RS39820"
                     /old_locus_tag="Mnod_8078"
     CDS             complement(300749..303328)
                     /locus_tag="MNOD_RS39820"
                     /old_locus_tag="Mnod_8078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-translocating P-type ATPase"
                     /protein_id="WP_012631268.1"
                     /db_xref="GI:501740294"
                     /translation="MRPNAIDGTPPGSGAVFWACTPEALAARLECRLDGLTSAEAARR
                     LQRYGPNSDGPARSGGTARAILRRLLEPLSLILLAAGCVSIGTGDWAGGGIIIAILVL
                     SIGLDTFQEGHAVRAAEALRRAVALKADAKRDGIFRTVPVDQIVPGDVIRVRAGDIVA
                     ADALVLESTVFAAVEAALTGEPYPVEKRPGPVAAESPAEAANALFRGAVAQSGEAVAL
                     VAATGRATVFGAAAAALAESAAPSPFQRDLREFGLVVARLTLVLVVAVLALRVALGRP
                     VLDSLLFAVALAVGLTPELLPMITTVTLARGALRMAKRRVIVKRLTGIHDLGAMTVLC
                     TDKTGTLTSAEIALARSLDPAGGADPLPARLGAIAAGLGGDRSALDAALIRSVPEAAE
                     GWRLAGRRPFDYARRTGAVVAEGPDGPLLIVKGAPEAVLALCTAQRSGRQAIPMDAAE
                     RDRALARQVRALAEEGLRSIAVASRPVPGAADAAEEGLVFEGFCAFADPPKPTAAAAV
                     ADLAAAGVRVKILSGDDPVVVRRLAGLVGLTSHRILTGPEIAALSDEALAVQVRGVDA
                     FGRLAPDQKARVVKALQADGQVVGFLGDGINDAPALRQADIGLSVEGATGVAQAAADM
                     ILLASDLEVVAAGVDEGRRTFANILKYIRMGASSNFGNMLSMAAASAALPFLPMLPTQ
                     ILLNNLLYDLSEVGIPFDRVDAEATARPQAWDMAALLRFAAVMGPLSSLFDLLTFGVL
                     LLSFGASPEVFRTAWFLESMATQILVIFVIRSRGRPWRDRPSAALAASSLAALTVALG
                     VPFSPLGPWFGFEAPQPMILAAIGIITVAYLAAAEAVKPWAIRARSRPPRRARAGAQA
                     NLV"
     gene            303804..306653
                     /locus_tag="MNOD_RS39825"
                     /old_locus_tag="Mnod_8079"
     CDS             303804..306653
                     /locus_tag="MNOD_RS39825"
                     /old_locus_tag="Mnod_8079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631269.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase/ligase"
                     /protein_id="WP_012631269.1"
                     /db_xref="GI:501740295"
                     /translation="MRDEALHPSSATEPGQQPGAASLLDVIRSLLRELHPERRRPLAV
                     DLDSDLERDLALDSLGRAELLLRLSRAFRVTLPDRLIGEAATPADLLAAVQAAGAARC
                     PGATFPRDEALSPAAEPHGAATLPEVLAFHVRRNPDRPHLRLWQGPDHETIVTYAALD
                     DAARRVAGGLLEAGLAAGGRVAIMLPTGPDFFPAFFGVLLAGGIPVPLYPPFRRAQIQ
                     DHLQRQARILSNAAPEILITDGEIKPFARLLPGLVESLRTLTTVEELATAAPLAATVP
                     ATGTTVALIQYTSGSTGDPKGVTLTHANLLANIRAIGEALGATSADVVVSWLPLYHDM
                     GLIGCWLGSLYFGAPAVIMPPLSFLADPGRWLRAIHRHRATISAAPNFAYELCLKTLR
                     DEDLAGLDLGSLRVLTNGAEPVSSDTLSRFAQRFTAFGLRPSALTPVYGLAECAVGLA
                     FPPPGRGPLIDWIDRTALSRQGEARPAAPGNAKSIAFAACGRPLRGHQIRIVDEAGRE
                     VPERVEGRLQFRGPSATAGYFRNPEKTQALFDGEWLESGDLAYEAGGDVFITGRLKDI
                     VIRAGRKIHPHELEEVAGSVPGVRKGCVAAFASPDPKTGTERLILVAETRLTDASARA
                     GLRRTLAEAAAGVLDQPPDDILLCPPHTVPKTSSGKIRRAAARALYESGGLDRPDSIR
                     AQVAGLALAGIGARLRRIARLAREAGYAAQWWAVLVGLGIVLWPVVIMLPRRAWRHAA
                     LRAGLRAFFRLTGTPVLVEGGTATPPAIIAANHASYLDAAVLAAVLPGTPVFLAKHEL
                     AGQAVAGPFLRRLGTVFVHRGEAAGVSDADVVLDRIRAGEQIVAFPEGTFTRTPGLLG
                     FHLGAFMTACRAGVPVAPIAITGTRSLLRADQWFPRHGAIRVHLGQKIAPEGADFHAA
                     VRLRDAVRAAILARCGEPDLADEPVSLPAAPSAPG"
     gene            306657..306959
                     /locus_tag="MNOD_RS39830"
                     /old_locus_tag="Mnod_8080"
     CDS             306657..306959
                     /locus_tag="MNOD_RS39830"
                     /old_locus_tag="Mnod_8080"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631270.1"
                     /db_xref="GI:501740296"
                     /translation="MAARNETGLCPPEPAEADAGQSPPPAGADRAAAGRHGPDGTAYV
                     AHDPRTDTFTEHSWAEMAGRVAARRAALACEGLHIPTLHTRLLAGVEALNGLLQIG"
     gene            307085..308080
                     /locus_tag="MNOD_RS39835"
                     /old_locus_tag="Mnod_8081"
     CDS             307085..308080
                     /locus_tag="MNOD_RS39835"
                     /old_locus_tag="Mnod_8081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="WP_050783651.1"
                     /db_xref="GI:915398266"
                     /translation="MHHLRSPELTPAEREALAGLEPRLGRLHVRQRLGLERDYEAHVF
                     RRGTHFFHLENWYSIHGLIRGALRLAGLYGRGRRNALAIELRRNEVALPDLPPEFEGF
                     TLLQLSDLHLDINTAFTAALIERVQGLNYDLCVITGDYRARTFGPIAAALEGLRRLRP
                     HLKSPVYAILGNHDTIRLVPPMEELGYALLLNEWVRIERGGAAIYLVGIDDAHFYRME
                     NFHRAAHDIPARAVSILLSHTPEAYRHAAHAGFDLMLCGHTHGGQICLPGGIPVLTDA
                     DSPRALARGPWRYHDLLGYTSVGAGTCIVDVRVNCPPEVTLHRLRKKVDVRAENA"
     gene            complement(308093..308584)
                     /locus_tag="MNOD_RS39840"
                     /old_locus_tag="Mnod_8082"
     CDS             complement(308093..308584)
                     /locus_tag="MNOD_RS39840"
                     /old_locus_tag="Mnod_8082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631272.1"
                     /db_xref="GI:501740298"
                     /translation="MSDPVALFRVLVLLAVANFAPIIATKLLGSRFSTPLDFHQKLRD
                     GNPVFGAGKTIRGLVVSLAATALVAPLLGFPPSAGISLASLSMAGDLTASFIKRRLGL
                     KAHAQAFGLDQIPEALLPLVFLRDRLGLDGIDIVTVVAAFIIGEVILSRILFRLGLRE
                     TPY"
     repeat_region   308902..309136
     gene            complement(308969..309325)
                     /locus_tag="MNOD_RS39845"
                     /old_locus_tag="Mnod_8084"
     CDS             complement(308969..309325)
                     /locus_tag="MNOD_RS39845"
                     /old_locus_tag="Mnod_8084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631274.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_043754242.1"
                     /db_xref="GI:760071437"
                     /translation="MPIFIAEDDPALLNSLAFMLQGEGYRVVTFESGSELLSAFPGAK
                     PGCVLLDYVMPGMSGLEVYHQLRERGVDVPVLLLTGHPDPSIRRRAREAGLPLIEKPL
                     AQDLLSAIEAAASPLH"
     gene            309807..310058
                     /locus_tag="MNOD_RS39850"
                     /old_locus_tag="Mnod_8086"
     CDS             309807..310058
                     /locus_tag="MNOD_RS39850"
                     /old_locus_tag="Mnod_8086"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631275.1"
                     /db_xref="GI:501740301"
                     /translation="MRSLILAGAALAAFATSANAWTQSILHPEQSYKSDFATAFPVTP
                     RYMAAGPQAVRGIPEFRLQPASSSPTVARDGYAGQRSHR"
     gene            complement(310172..310663)
                     /locus_tag="MNOD_RS39855"
                     /old_locus_tag="Mnod_8087"
     CDS             complement(310172..310663)
                     /locus_tag="MNOD_RS39855"
                     /old_locus_tag="Mnod_8087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome condensation protein CrcB"
                     /protein_id="WP_012631276.1"
                     /db_xref="GI:501740302"
                     /translation="MLKRSIPILGGMLTIGTLLPLAGNGAPQTSATSENGVVQVGSAY
                     PMAETLDRLQKDIAAKGIKLFSVVDQSGLAAEAGIALRPSTLLVFGNPALGAQFMTSN
                     PVAGLDWPVRLLVFQDEKGGVWAAYTDFRYIAQRHGIRDRDAAFAKASEVIASITSSV
                     AKR"
     gene            complement(310729..311562)
                     /locus_tag="MNOD_RS39860"
                     /old_locus_tag="Mnod_8088"
     CDS             complement(310729..311562)
                     /locus_tag="MNOD_RS39860"
                     /old_locus_tag="Mnod_8088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C biogenesis protein CcmE"
                     /protein_id="WP_012631277.1"
                     /db_xref="GI:501740303"
                     /translation="MVRILQSAGLDRTGTARPLDGRVAIVTGSTSGIGLAIANTLAEQ
                     GALIVINGLGDEAEIERLCRELSDRHQTPVRYDDADLSQAGAVMDLVDRSARAFGPVE
                     ILVNNAGIQYVSPIEEFPPEKWDAILAINLSAVFHATRCVLPDMRRRGWGRIINVASA
                     HGLIGSPFKSAYVAAKHGVIGLTKVTALEMAEAGITCNAVCPGYVWTPLVEHQVRAQA
                     VAHGISEDEVVRKVLLAEQPNKRFATAEEIAGTVAFLCSPAAASITGASISVDGGWTA
                     H"
     gene            311721..312650
                     /locus_tag="MNOD_RS39865"
                     /old_locus_tag="Mnod_8089"
     CDS             311721..312650
                     /locus_tag="MNOD_RS39865"
                     /old_locus_tag="Mnod_8089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631278.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012631278.1"
                     /db_xref="GI:501740304"
                     /translation="MELHEIRYFLAVSRFGSFTKAAEHCNVTQPALTRAIQKLEDELG
                     GLLFSRERSHVHLTDLGRLLEPEFRQMIEHRERAKRAASRFLRLEGAQLTLGVMCTIG
                     PLRFVGFLNHFRVTHPGIELTLIEGVPARLSEMLLAGELDVAIMAHPDGFPEPLRASP
                     LYEERFMVACGQLHDFACRNAIRMRDMAGQIYLQRINCEYRDHLAELLRAQGTEILRS
                     HRSEREDWIQSMVVAGMGVCFLPEFSATLPGIALLPVLEPVVARQVCLVTVAGRRWSS
                     PLAALVAALGQYAWPPSRFDLSEEQTPEPAVSA"
     gene            312783..313286
                     /locus_tag="MNOD_RS39870"
                     /old_locus_tag="Mnod_8090"
     CDS             312783..313286
                     /locus_tag="MNOD_RS39870"
                     /old_locus_tag="Mnod_8090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_012631279.1"
                     /db_xref="GI:501740305"
                     /translation="MTTIPMIRSAVHRTLCGAVMMTGAFALGAGAAQAGSCPADKVVA
                     SGKGQAESKAAAQGVTDTVIASTDLATERVGIADRQFRLRRLVIEPGGIVPWHSHGDR
                     PAIIYVVSGEVVEYASTCAVPITHKAGEATSETHATAHWWKNTGSTPAVLLSADLFHV
                     KDDPHQM"
     gene            313338..314540
                     /locus_tag="MNOD_RS39875"
                     /old_locus_tag="Mnod_8091"
     CDS             313338..314540
                     /locus_tag="MNOD_RS39875"
                     /old_locus_tag="Mnod_8091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_050783652.1"
                     /db_xref="GI:915398267"
                     /translation="MSGPTPRESTQAGDLVRSLVIGLMAFLTVVDLFATQAILPSLAR
                     AYAVSPAAIGFAVNATTLGMALGGLGVALLGPRIDRRRGVVVSLLLLAIPTALLGTLP
                     DLWLFAALRVLQGICMAAAFTLTLAYLGEACSASAAAGAFAAYVTGNVASNFVGRLAA
                     AALVDHLGLVSNFLAFALLNLAGAGLAALVLRAPKPEPKADIGRHGRASPFAVWAEHL
                     ANPTLLAAFGIGFCILFAFLGTFTYVNFVLTGSPFLVGPMTLGFVYFVFLPSLLTTPL
                     AGRFSGRLGFRRALVMALLIAVLGLPLLTFPALPVVLIGLVLVGIGTFLAQAIATGVV
                     GRSAMGERASASGLYLLFYYLGGLAGTAVLGQVFERLGWGACVVGVTASLALAAALTT
                     HLCEPSAT"
     gene            314651..315799
                     /locus_tag="MNOD_RS39880"
                     /old_locus_tag="Mnod_8092"
     CDS             314651..315799
                     /locus_tag="MNOD_RS39880"
                     /old_locus_tag="Mnod_8092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631281.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="WP_012631281.1"
                     /db_xref="GI:501740307"
                     /translation="MAPEPEPLARSLRRRLGQIVLVLQGGGALGAYQVGVYQALHEAG
                     IEPDWIIGTSIGAINASLIAGNPVERRLERLHAFWNRVEHGPLHQAFAALPLVGTLAA
                     NWLTLAQGIGPFFAPNPFAFAGPHVPLGAEQAGYYSTRPLEATLRELVDLPTLNHGGC
                     RLTVGAANVRTGQMRYFDSREMDLDLRHVMASGALPPAFPAIRIDGELYWDGGILSNT
                     PVEAVFDDNPRRNSLVFAVHIWNPEGPEPGSLWEVMGRQKDLQYASRAHTHIARQKQL
                     HRLRHVIAELARRLPEAERRDAGVRELESYGCLTRMHVVRLLAQRVPGQDHTGDIDFS
                     REGICARREAGYENTRKVLDDAPWERPVDDVEGFILHESAPGLAIQTS"
     gene            316001..316267
                     /locus_tag="MNOD_RS39885"
                     /old_locus_tag="Mnod_8093"
     CDS             316001..316267
                     /locus_tag="MNOD_RS39885"
                     /old_locus_tag="Mnod_8093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631282.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631282.1"
                     /db_xref="GI:501740308"
                     /translation="MTKALLLAGTLVATASGYAWAQQTFTAWGHTFTVSEFAPQQMMV
                     AVATDTKTGRKFNVLKLKNGKMMAVAPINSMRGMPETSQEDMIQ"
     gene            316806..318467
                     /locus_tag="MNOD_RS39890"
                     /old_locus_tag="Mnod_8094"
     CDS             316806..318467
                     /locus_tag="MNOD_RS39890"
                     /old_locus_tag="Mnod_8094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631283.1"
                     /db_xref="GI:501740309"
                     /translation="MSLRPHHPLPPVPEDTARVAQTAFRRGNPYLLLRTRLGTIFADA
                     AFADLYPARGQPAYAPWRLALVTLLQFRESMSDRQAAEAVRARIDWKYLLGLDLADPG
                     FDYSVLCEFRGRLLQHEATGRLLARILDAARDQGVLKARGRQRTDSTHVLAAVRDLNR
                     VELLAETLRAALNAVAALAPDWLRRVAPPDWHERYDRRIEDARLPETGPKREAYVLQV
                     GADGYRLLDALDGASAPPLAVALPAVAVLRRVWARHFERAGDGSPPAGTSVRLRPVQG
                     RGPGDRVESPYDVEARFRAKSGTEWTGYMVHLTETCDPDLPRLVVHADTTPANVHEAM
                     RTGVIHAALAGLDLIPSEHLVDAAYISAEHLVAAHERHGIALIGPARSNQSWQTREEG
                     AFHVTDFAVDWERCRVCCPEGRESTSWGTYRDKVSGRAFIRAGFSPAVCRVCPAKPRC
                     TRAGSRRLSLHPRAEHEALAAARMRQESEEGRQLYGQRQGIEATIAQGVRSFGLRRAR
                     YRGLAKMTLQSVATAAALNLDRLAAWFSHRPLAPTRTSRFEALAA"
     gene            complement(318714..319364)
                     /locus_tag="MNOD_RS39895"
                     /old_locus_tag="Mnod_8095"
     CDS             complement(318714..319364)
                     /locus_tag="MNOD_RS39895"
                     /old_locus_tag="Mnod_8095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RhtB family transporter"
                     /protein_id="WP_043754251.1"
                     /db_xref="GI:760071446"
                     /translation="MPDLSQLALYFAAAFVLAVTPGPGLFYVAARTLAGGRAEGVASS
                     FGTGLGGMVHVLAGSLGVSAIVLASAELFTALKLIGAAYLVWIGLRTFQSARREASTA
                     LNSVPATPPIGPLRAFREGVLVEALNPKTAAFFLAFVPQFVDPAGGHVALQFVVLGFV
                     SVALNTLADIVVAFAASGIREGAAARPAFIRRLREASGTAMIALGIGLALAKRPAT"
     gene            complement(319388..320011)
                     /locus_tag="MNOD_RS39900"
                     /old_locus_tag="Mnod_8096"
     CDS             complement(319388..320011)
                     /locus_tag="MNOD_RS39900"
                     /old_locus_tag="Mnod_8096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012631285.1"
                     /db_xref="GI:501740311"
                     /translation="MYTPPAFRDDDPESLRATMRAARLANLVTATADGPLVTPLPLFL
                     DESEGEHGVIYGHLAKANPQWRVPPVGEGLAIFMGPDAYVTPAWYATKEETGKVVPTW
                     NYVTVHAHGPIEFFHDADRLLDAVTRLTNLHEGPRAKPWAVSEAPAEFIAAQLRGIVG
                     LRMPISRLEGKRKLSQNRNATDRAGVAAGLATSERASDREVAPLIPS"
     gene            320040..321515
                     /locus_tag="MNOD_RS39905"
                     /old_locus_tag="Mnod_8097"
     CDS             320040..321515
                     /locus_tag="MNOD_RS39905"
                     /old_locus_tag="Mnod_8097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631286.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_050783632.1"
                     /db_xref="GI:915398247"
                     /translation="MPAIWLAGNSQFSGFEVVQLMEEGVARRIIAAIKEQIHAGVYQP
                     GDRLPSTRAFADEWGASRTTVTAAYGQLIAEGYLTTRPGARATVAHGLGAAATPMPTP
                     AAAPRRLSAFAQRLLALPSPAVAQAARVADFRYGDLSAADFPVLAWRRALNRASLRRT
                     ARLRYGDPQGSVALRTALQGYLWRARGIRCTPDQVVIVNGSQQGLDLCARLLLDPGDP
                     FVIENPGYLLARHAFTAAGGVAVPIPVDGDGLRTDALPSARLAYVTPSHQFPLGSVLS
                     AARRRTLLAWAARAGACIIEDDYDGEYRHDIAPIPPLQTLSPEAAIYVGTFSKTLSPT
                     LRLGYLVVPTPMCRAFSEAKRLTDRHTPQLEQDALAELLASGAYERHVRSIRRKNTER
                     RAVLLQALADELGPAVTIAGADTGLHVVAWINGVAADRERALVAAARAAGVGLYPVSP
                     LYDPTEPRPAAAGFILGYAGLDADALRRGVAVLATVMAEHC"
     gene            complement(321632..322072)
                     /locus_tag="MNOD_RS39910"
     CDS             complement(321632..322072)
                     /locus_tag="MNOD_RS39910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008840700.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783633.1"
                     /db_xref="GI:915398248"
                     /translation="MRSDLFCRPAVFEVRMPPLRERGDIAVLASELMRKRARGAGLAP
                     RPLQPDQLERLAAHSWPGNVRELESVLTRFLVSGEIRLTEPPGSGERAENGALDLRSR
                     LAHRRSDSVADAMRRAKGNKIKAAELLGVSRAHLYRILQNTGCS"
     gene            complement(322627..323283)
                     /locus_tag="MNOD_RS39915"
                     /old_locus_tag="Mnod_8100"
     CDS             complement(322627..323283)
                     /locus_tag="MNOD_RS39915"
                     /old_locus_tag="Mnod_8100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631287.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012631287.1"
                     /db_xref="GI:501740313"
                     /translation="MISGAQTRRRRKEARPAEITAAALSVFAEKGFAASRLEDVAERA
                     GASKGTIYLYFDTKEALFEAVVHEAFAPLLDRVGKAKRDPRARSEDLLRLVIETIYRD
                     LVGTDRRQILRMMIAEGTRFPHLVEFYHREAVSRGKALLGEIISQGIARGEFVDGPAA
                     RCPEVVIGPAIMAGVWKLVFERIERLDLDRFIAAHLDLVLNGLRAGSPTRVTVPSQRE
                     "
     gene            complement(323510..324616)
                     /locus_tag="MNOD_RS39920"
                     /old_locus_tag="Mnod_8101"
     CDS             complement(323510..324616)
                     /locus_tag="MNOD_RS39920"
                     /old_locus_tag="Mnod_8101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631288.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012631288.1"
                     /db_xref="GI:501740314"
                     /translation="MRTRLLALIVKELLATFRDRKARAALTVPPFIQLFIFAFAATLE
                     VTNVPIGIINDDWGAASVRLISRFERASAFSEIRRYSTLSEAQAAIDSQQVMAVLRVG
                     QDFSRKLARRETPTVQVLLDGRKSNSAQLLNNYIGTIISQFSADERTGVPYAPQSEIV
                     DRSWYNPNRDYREAMVPILIATLPMTIVLMVVGMSVAREQELGTFEQLLVSPLQPIEI
                     IVGKAVPGLIIGLAQCTAMTLIVVFGFGIAVTGSVPVLFLGLTVFLIAIIGVGLFISS
                     LATNQQQAMMGIMVCMMPTMLLSGFSSPVQNMPSWLQLFAVVNPLTHMLVIVRGVFLR
                     DMPFWLVAERIWPMALTAIVTLSAAAWMFRRKVQ"
     gene            complement(324621..325760)
                     /locus_tag="MNOD_RS39925"
                     /old_locus_tag="Mnod_8102"
     CDS             complement(324621..325760)
                     /locus_tag="MNOD_RS39925"
                     /old_locus_tag="Mnod_8102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631289.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012631289.1"
                     /db_xref="GI:501740315"
                     /translation="MTRPDGNRLSARRIAALIRKESLQVLRDPSSLVVAFVLPALLLF
                     LFGFGISFDANRIKIGLVAEESTPETSWFEVALSNTPYFDVRFASDRRAFTDDLSAGR
                     LNGIVVLAGDFSERLARGDTAGLQVITDGSDPNTAGLVAGYVQGAWSVWTAQRGLGRG
                     GAAPAQVNVESRFWFNPELESRRFLVPGSISLIQMMIGALLTALVVSREWERGTMEAL
                     LATPVSILEFIIGKLVPNFVLGLCAMAVCVLAALFVFDIPLRGSLATLVGFTAVFLLV
                     ALGLGLLISTVARTQFLASQVAMLLAFLPGLYLSGFLFEVASMPRLLRAVAVLIPAGY
                     YVRGLNTIFLAGDIAAVLVPATIVLLAMSAVLFALTAAKSRQTLD"
     gene            complement(325757..327493)
                     /locus_tag="MNOD_RS39930"
                     /old_locus_tag="Mnod_8103"
     CDS             complement(325757..327493)
                     /locus_tag="MNOD_RS39930"
                     /old_locus_tag="Mnod_8103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631290.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATP-binding protein"
                     /protein_id="WP_012631290.1"
                     /db_xref="GI:501740316"
                     /translation="MSEVLVALEGVTKRFAADAPAAIDRLTTNIVAGQVTGLVGPDGA
                     GKTTLIRMMAALLAPSQGSITVCGHDSVAEIGPIHEVIGYMPQRFGLYEDLSVMENLS
                     LYADLKGVVGPARRTAFDRLLAFTDLARFTDRLAGKLSGGMKQKLGLACAMLKSPRLL
                     LLDEPGVGVDPISRRELWRMVYALVQEGVGIVWSTAYLDEAENCASVLVLNGGKVLFE
                     GDPRAMTASMEGRVVLARGAGTTRRALLADALRSPDIIDGVLQGEAVRLVVAEGRPAP
                     DACALGGGPTVHVEPAHPRFEDSFVAMLSGQPKRTLGVSIHERPATPATAPVEAHHLT
                     RRFGSFTAADDISFTIRRGEIFGLLGPNGAGKSTTFKMMCGLLRPTSGTALVDGLDLY
                     KAPAVARGRLGYMAQKFSLYGDLSVKQNLEFFAGAYGLSGRARREAVTGVIEAFDLGP
                     YLAQNAGGLPLGYKQRLALAAAIMHEPPVLFLDEPTSGVDPLTRREFWGIINAMVGRG
                     VTVMVTTHFMDEAEYCDRVALINRGKCIAVDTPEALQASVRSHDLPNPTLEDAFIALI
                     EAQERESARSAA"
     gene            complement(327490..328554)
                     /locus_tag="MNOD_RS39935"
                     /old_locus_tag="Mnod_8104"
     CDS             complement(327490..328554)
                     /locus_tag="MNOD_RS39935"
                     /old_locus_tag="Mnod_8104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD"
                     /protein_id="WP_012631291.1"
                     /db_xref="GI:501740317"
                     /translation="MTFGLAGAAFWFWSPQVGELAGRYSWWSTLRSVPALSWLPGPRA
                     AAEGLVLQGNVEVRQVNLGFKVGGRIASLAVDEGATVREGQSLASLEKVYFEDAVAQA
                     RAQRDQARANLDKAQNGNRPEEIAQAQASVAEREATLANARLASDRAEQLLRSGAGTT
                     KAHDDALAALRQADAQLNSARQYLALMRAGARAEDIAAARAQLANSEAALAVAQRQLA
                     DAELVAPTDGTVLSRVRETGAIVNAGETVFVLSLTNPVWVRSYVSQVDLGRVRPGQMA
                     TIRIDTPGAPTFKGWVGFISTTAEFTPKTVETRELRTALVYRIRVVAEDPRGVLRQGM
                     PVTITLASTSTEPMVAGASE"
     gene            328862..329321
                     /locus_tag="MNOD_RS39940"
                     /pseudo
     CDS             328862..329321
                     /locus_tag="MNOD_RS39940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018409652.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            <329339..329521
                     /locus_tag="MNOD_RS39945"
                     /pseudo
     CDS             <329339..329521
                     /locus_tag="MNOD_RS39945"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631274.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
     repeat_region   329354..329588
     gene            complement(329659..330057)
                     /locus_tag="MNOD_RS39950"
                     /old_locus_tag="Mnod_8106"
     CDS             complement(329659..330057)
                     /locus_tag="MNOD_RS39950"
                     /old_locus_tag="Mnod_8106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631292.1"
                     /note="stability determinant protein; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid maintenance protein"
                     /protein_id="WP_043754059.1"
                     /db_xref="GI:760071251"
                     /translation="MLDTNICIFLRRQKSASVTARFAALQPGEAAMSIITYGEQLYGA
                     EKSQDRAKAIALIQRIAGMIPVLPMAVGVADFYGKIRSDLEEKGLTIGNNDLWIAAHA
                     LHENLILVTNNRREFDRVGMGLQVEDWTQP"
     gene            complement(330075..330302)
                     /locus_tag="MNOD_RS39955"
                     /old_locus_tag="Mnod_8107"
     CDS             complement(330075..330302)
                     /locus_tag="MNOD_RS39955"
                     /old_locus_tag="Mnod_8107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="virulence factor"
                     /protein_id="WP_012631293.1"
                     /db_xref="GI:501740319"
                     /translation="MATTRVFRSGNSMAVRLPRGFDLVGPDVEIEKRGDEIILREIKP
                     KNMLDALALFRELPDDMGDREDTPPQAREGL"
     gene            331567..332088
                     /locus_tag="MNOD_RS39960"
                     /old_locus_tag="Mnod_8109"
     CDS             331567..332088
                     /locus_tag="MNOD_RS39960"
                     /old_locus_tag="Mnod_8109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631294.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="WP_012631294.1"
                     /db_xref="GI:501740320"
                     /translation="MADVQEATADAGGPAIELVADIISAYVAHNPVPVAQLPDLIATV
                     SQTLDSLGKPAASAAEETPKATPAQIRKSITPDALISFIDGKPYKTLKRHLTRHGMSP
                     DEYRSKFGLPPTYPMVAESYAVQRSELAKASGLGQSHRRTAPKQSAGDAKVTASAKSK
                     KGSGRARKPKAAE"
     gene            332167..332439
                     /locus_tag="MNOD_RS39965"
                     /old_locus_tag="Mnod_8110"
     CDS             332167..332439
                     /locus_tag="MNOD_RS39965"
                     /old_locus_tag="Mnod_8110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012330566.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631295.1"
                     /db_xref="GI:501740321"
                     /translation="MVSSAVTLLIVAVVFVLGFAVIDRLEKWADTVGLVLGLTVVGLL
                     SAFLLTLAARPTQAPREARAGQQARIGHSVPKPAKSDPDVTGSIRR"
     gene            complement(332523..332723)
                     /locus_tag="MNOD_RS39970"
                     /old_locus_tag="Mnod_8111"
     CDS             complement(332523..332723)
                     /locus_tag="MNOD_RS39970"
                     /old_locus_tag="Mnod_8111"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754072.1"
                     /db_xref="GI:760071264"
                     /translation="MMRLAYAMPAAVAPPALAIGIDVISACQLTSLMRIACMQEAEDI
                     LAEMQVEPRDLLWESAAFRKPD"
     gene            complement(333054..333743)
                     /locus_tag="MNOD_RS39975"
                     /old_locus_tag="Mnod_8112"
     CDS             complement(333054..333743)
                     /locus_tag="MNOD_RS39975"
                     /old_locus_tag="Mnod_8112"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631297.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Crp/Fnr family transcriptional regulator"
                     /protein_id="WP_012631297.1"
                     /db_xref="GI:501740323"
                     /translation="MDQAPRWTRPTMGTLFAGLEREPADALLDAATHRQFAEGTTLFH
                     QGDAPSQLFQVSAGLVKLSRVNPEGEQTTLRFMGAGDLVGCVAVFQQSPFPATAIASK
                     PTSVLCWGAAQILDLTRRYPAISANALKTVGDRAREMIDRVAELTDKGVEARIASVLL
                     RLAGQVGRTCLAGVEIAYPVTRRDVAEMTGVTYFTVSRILGGWQRQGLVQLGRVRIIV
                     MEPQRLAQIAG"
     gene            334133..334840
                     /locus_tag="MNOD_RS39980"
                     /old_locus_tag="Mnod_8113"
     CDS             334133..334840
                     /locus_tag="MNOD_RS39980"
                     /old_locus_tag="Mnod_8113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_012631298.1"
                     /db_xref="GI:501740324"
                     /translation="MHLIRGVAVATALVVSVFGSAHAQSPESPPDTMAERVLACAPCH
                     GAQGEGTRDPYFPRLAGKPAGYLFNQLVAFRNGRRHYPPMNYLLEYLPEAYLKEMADH
                     FAGLNPPLPPPAIPTVGDEVLALGKTLVTQGDASRNIPACTSCHGPSLTGMEPGIPGL
                     LGLRPNYVSAQLGAWRYGTRTARAPDCMQVVAGHLTEADVMAVTAWLSSRPAPAERRS
                     VPQGTYALPFACGSQPQ"
     gene            334852..336111
                     /locus_tag="MNOD_RS39985"
                     /old_locus_tag="Mnod_8114"
     CDS             334852..336111
                     /locus_tag="MNOD_RS39985"
                     /old_locus_tag="Mnod_8114"
                     /EC_number="1.1.99.3"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_012631299.1"
                     /db_xref="GI:501740325"
                     /translation="MASLVRSVLPALLASLLCVSAAESQAAPAAQPDAEALAKGEYLA
                     RAGDCIACHTAPEGKPFAGGRPMATPFGTLFTSNITPDPETGIGTWTADQFYQMMHTG
                     RSPDGGLLYPAMPFGSYTKVTRADSDAIYAFLMSVPPVKQANRPHDLRFPYNNRQLVL
                     GWRTLFFREGEFKPDPKQSAEWNRGAYLVEGLGHCGMCHTPINALGGSSESQAFQGGL
                     IPMQNWYAPSLTSNREAGVGDWSIEEISDLLRTGISRRGAVYGPMAEVTYNSLQYLTP
                     EDTRAMAVYLKSLGQEVAPPVTSNVPTAESSLLLSLGKTVYDTNCASCHGAQGQGKPP
                     HYPPLAGNQSIQMSSAVNAIRMVLNGGYPPGTEGNSRPYGMPPFAQSLSDNEVAAVVT
                     YIRTTWGNHGAAVTAQEANQLRSAPLD"
     gene            336305..336868
                     /locus_tag="MNOD_RS39990"
                     /old_locus_tag="Mnod_8116"
     CDS             336305..336868
                     /locus_tag="MNOD_RS39990"
                     /old_locus_tag="Mnod_8116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase subunit II"
                     /protein_id="WP_012631301.1"
                     /db_xref="GI:501740327"
                     /translation="MPTQDHIDEGARVAERVERRWATLSVAIIIVLAGAAAFSGIHQA
                     TMPQARVETIQPQTLHLTGEFIKGNLGSAVEPDGSVTVRAVGQQYSFTPQCMVVPTNT
                     PVVFRATSPDVVHGFLIQNTNINTMLVPGYVSEIPAKFSRTGEYLMPCQEYCGVGHEG
                     MWAKVKVVDKSEFLSMISANRRVTCVE"
     gene            336858..338480
                     /locus_tag="MNOD_RS39995"
                     /old_locus_tag="Mnod_8117"
     CDS             336858..338480
                     /locus_tag="MNOD_RS39995"
                     /old_locus_tag="Mnod_8117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631302.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C oxidase subunit I"
                     /protein_id="WP_012631302.1"
                     /db_xref="GI:501740328"
                     /translation="MLNSRRLILAHFWLAFAVFGLALLLGAWQMFIRSPLHTWISNPE
                     WYYRSLTAHGTVMAYVFPTLVAMGFGYAISEVSLKQRLIGLRWAWAGFWLIVIGAVTA
                     MIPVSLGRASVLYTFYPPLIGSPFYYLGVVLVVVGSWIWVALMSVNLHAWKKANPGAP
                     VPLPMFANVAGSYLWAWTAVGAALELLLQILPVAFGLKSTIDAGLSRVFFSWTLHAIV
                     YFWLIPTYIAYYTIVPRAIGGKIYSDTMGRIAFILFLIVSMPIGMHHTFEDPQVGAGF
                     KFIHSAFTALVALPTLLTVFTICASVEIAARMRGGRGPFGWIKVLPWSNPIMLAVAFS
                     FVMLGFGGAGGLINMSYQLNTSIHNTQWITGHFHLIFGGAIVIMYFAIAYDLWPHLTG
                     RALTDLRLMRTQLWLWFIGMIVTTFPWHWVGILGMPRRMAYFDYGDPAVATQAFSVTL
                     SAIGGFILVASGALFILVLLRGQRAPREDAGVYRFAVALHPPVAVPALNSYALWIALM
                     VGLTATNYGFPIAQLALRQDTSVPAVYVGVNP"
     gene            338477..339289
                     /locus_tag="MNOD_RS40000"
                     /old_locus_tag="Mnod_8118"
     CDS             338477..339289
                     /locus_tag="MNOD_RS40000"
                     /old_locus_tag="Mnod_8118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631303.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C"
                     /protein_id="WP_012631303.1"
                     /db_xref="GI:501740329"
                     /translation="MSDEDLLSPRNPWFARSVGITVALFVVTALGGFVLLPYAQPDLK
                     FTGVWDAICSAAGLPKTPSAAAPVQPDGKLTQVVVTSALPGAAAPEAVGRGATLAQQC
                     AICHGPTGVSRADSPNLAGQYAAAIYKQLMDFKTGARANAIMTPFAVNLSDRDMSDLA
                     AYYAYLPRLPGFHPDRDKPAPRIVINGAPLRNIAPCGSCHGALDNKTGSPWLEGQPAA
                     YVKAQLQAFASGARRNDISQQMRNIARRMTREEIDQAAQWYASQPPTTIHTQ"
     repeat_region   339447..339726
     gene            complement(339474..339689)
                     /locus_tag="MNOD_RS40005"
                     /old_locus_tag="Mnod_8119"
     CDS             complement(339474..339689)
                     /locus_tag="MNOD_RS40005"
                     /old_locus_tag="Mnod_8119"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631304.1"
                     /db_xref="GI:501740330"
                     /translation="MHKAGHGYALLSERTGAPLARLTPTGEADTVQVPWWNGARWGAA
                     GPFGIATTPLDQALDYIASTPLFWIND"
     gene            complement(339656..340192)
                     /locus_tag="MNOD_RS40010"
     CDS             complement(339656..340192)
                     /locus_tag="MNOD_RS40010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_009488330.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783634.1"
                     /db_xref="GI:915398249"
                     /translation="MAACFPRPTFANLMVLVAGAVLAPGRRTVTAALSRLGLREGVTV
                     STYHRVLSRRRWRAQATARGLLGLLIAAFAPSGPVVVGIDETLERRWGARIKARGIDR
                     DPVRSSPGHFVKASGLRWISRMLPHDGVVGALNPASRARASSCQPDPILCRRALRRST
                     RPAAGASPCTRRATATRC"
     repeat_region   340295..340574
     gene            340332..340547
                     /locus_tag="MNOD_RS40015"
                     /old_locus_tag="Mnod_8121"
     CDS             340332..340547
                     /locus_tag="MNOD_RS40015"
                     /old_locus_tag="Mnod_8121"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631304.1"
                     /db_xref="GI:501740330"
                     /translation="MHKAGHGYALLSERTGAPLARLTPTGEADTVQVPWWNGARWGAA
                     GPFGIATTPLDQALDYIASTPLFWIND"
     gene            340921..341565
                     /locus_tag="MNOD_RS40020"
                     /old_locus_tag="Mnod_8122"
     CDS             340921..341565
                     /locus_tag="MNOD_RS40020"
                     /old_locus_tag="Mnod_8122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631306.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631306.1"
                     /db_xref="GI:501740332"
                     /translation="MAGWLSGVPFTPLHSAFARWTRLGLWRRLGQRLALDWRRARGDE
                     VVPSAVVADSRSLRSAPSAWARGIDGGKLVKGVKLVAVCDKHGSLLDLALGPATVDDR
                     AGTPPLLPQLAGLGFQGDLLGDSGLKGAPFAAAALVHDIHVSVSPGGTRDDQFLPCGI
                     RWVVERLFAWLSRYRRLNIVYDRQPDLFAAHVWIAMISIISRRLVAHTQAQQAV"
     gene            341684..342679
                     /locus_tag="MNOD_RS40025"
                     /old_locus_tag="Mnod_8123"
     CDS             341684..342679
                     /locus_tag="MNOD_RS40025"
                     /old_locus_tag="Mnod_8123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019404220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783635.1"
                     /db_xref="GI:915398250"
                     /translation="MSKATVSLVLRNHPSIPERTRQRVLHAAEQLGYVYNRGAASLRS
                     AQTHLIGLAVNDLTNPYFAEITAAIEDVLTTQNRIVIMSNTGESVERQSAFAASVREY
                     NVDGLLLVPARGTDATFVDLLRSWRLPFVMVSRSVPGAETDLVQADHRAGTLAATEHL
                     VGLGHRRIGFIGLNTDISTGRERLEGYQLALARSGIEYEPQLVLSGPATRDEGMAQLF
                     ALLDLPEPPTAAVCFNDVVAFGAMLGLRARNLTPGADFSIFGFDDIAEATLWRPALTS
                     VSVPRKLIGQTAAELLLRRIGQIDAPAKVVLLPTELVVRDTTSRPALRGRRARRR"
     gene            343045..343776
                     /locus_tag="MNOD_RS40030"
                     /old_locus_tag="Mnod_8124"
     CDS             343045..343776
                     /locus_tag="MNOD_RS40030"
                     /old_locus_tag="Mnod_8124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015928157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="WP_050783636.1"
                     /db_xref="GI:915398251"
                     /translation="MSDDEARPSSLARPSSLADGVYQSLVTEIASGTYAENQKLPSEN
                     DLAGRFKVSRPIVRAALERLRRENVIVSRQGAGSFVRARGKAPALGFAPVESIADIQR
                     CYEFRLTIEPDAAFYAALRRNEAAIGRIASALDLLNAATRQQQHRDDADFAFHLAIAE
                     ASNNHYYAASMQALQAHIAVGMKIHGLALLGPNSGLQGVFDEHHAIFAAVRDGDPNTA
                     RVQMQRHICSSRDRLFECRLLDLSL"
     gene            344452..345558
                     /locus_tag="MNOD_RS40035"
                     /old_locus_tag="Mnod_8126"
     CDS             344452..345558
                     /locus_tag="MNOD_RS40035"
                     /old_locus_tag="Mnod_8126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hrp-dependent type III effector protein"
                     /protein_id="WP_012631310.1"
                     /db_xref="GI:501740336"
                     /translation="MPSLRLIADDLTGALDTAAGFTGLVGAVEVAWVGAPMGPCGGNL
                     ALDTGTRERSAEEAARIAGALAPRLQGAEIAFKKVDSLLRGPWAAELAACFGTGAWRH
                     AIVAPAFPYQGRRTVEGRQFARTESGWQAASGDIAESLHAAGLATRRAGVGDGLLDGV
                     AVYDATDDADLDRIASFAESAAGPVLWCGSGGLAGALAGRSPASCDTRLVGPVLGLFG
                     SDRPETAAQLAHCPEHRLILPAEGDHAGRVAARLRERGAALVSLGLPEGTGRQEAAAR
                     IAASFGLLARALPPPGTLLVAGGETLKALCLALGTETLVVTGQVAPGIPRSRMRGGLW
                     DGVAIVSKSGAFGSPAVWRDLLRRNGLLPERTCA"
     gene            345579..346592
                     /locus_tag="MNOD_RS40040"
                     /old_locus_tag="Mnod_8127"
     CDS             345579..346592
                     /locus_tag="MNOD_RS40040"
                     /old_locus_tag="Mnod_8127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="WP_043754272.1"
                     /db_xref="GI:760071467"
                     /translation="MGDPAGIGPEILVKAAHRLKHRIAAGDLKLLVIGSVPALRRAEG
                     ALGAAPIPEIAQESDWPNLACLQADAEGAPIEPGQLSADGGRFAFKAIERAVRLALDQ
                     RIGGIVTAPLNKEALNLAGYHYAGHTEMLADLTGVRGSVMMLAHGGMRVSHVTTHVAL
                     EDVPKRLTPERLRRVIDLTHKALKGLGLAQPRIAVAALNPHAGEGGLFGRQDIDVSAP
                     VIATAVADGLDVVGPVPGDTVFVKLRAGQYDAVVAMYHDQGHIPVKLLGFEVDPTTGQ
                     WMELSGVNITLGLPIIRTSVDHGTAFDIAGRGIANERSLIEAIEYAERLAASAAATQR
                     SAA"
     gene            346589..347716
                     /locus_tag="MNOD_RS40045"
                     /old_locus_tag="Mnod_8128"
     CDS             346589..347716
                     /locus_tag="MNOD_RS40045"
                     /old_locus_tag="Mnod_8128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_012631312.1"
                     /db_xref="GI:501740338"
                     /translation="MTDLTAPIAIVRPEIAFGSGTARTVGQRARARAARRILVVADAF
                     NAARVDLLALPGEVRVFGEVRPEPDIPNLERALALAEDFSPDLVVGFGGGSAMDLAKL
                     VAVLPGSGQTIHDVVGPERVAGRRAGLIQVPTTAGTGSEGGTRALVTDPATQTKLAVQ
                     SRHMLADAAVIDPDLTLTVPPAVTAATGVDALAHCVEAFTSRKAHPLIDLYALEGARL
                     VGRFLPRAVRDGSDVEARAGLALASLYGGFCLGPVNTTAGHAVAYPLGSRHHVAHGLA
                     CAVIFPHTLAFNAPAVPEKTRQVMAALGLPETAEEGAVAEAATRWCADLGLAMRLSAL
                     GVPEGDLPAMATEAHAIRRLLDNNPREISRDRILALYRAAA"
     gene            347730..348650
                     /locus_tag="MNOD_RS40050"
                     /old_locus_tag="Mnod_8129"
     CDS             347730..348650
                     /locus_tag="MNOD_RS40050"
                     /old_locus_tag="Mnod_8129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631313.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_012631313.1"
                     /db_xref="GI:501740339"
                     /translation="MSETVFPRGVFCAALTPLDQDLNPNHAAFTAHCRHLLAEGCTGI
                     ALLGTTGEANSFSGDERKALLEAALRAGISPDQLLPGTGVAALTETVALTRHALSLGV
                     TTVVMLPPFYYKGVSEDGIVAAYAEIVERIGDERLRVVLYHIPQVAGVPLPHGAIARL
                     RERYPGTFVGIKDSAGDLAHMTALVERFPGFAVLAGADPLMLPLLKAGGAGAITATTN
                     LVARDLRFVFDHWADPAQAAAVGAAQGRVVAARERASRFAQMASLKALLAERTGDPGW
                     CRMRPPLVPLSETERAALLAPMPDEARRAS"
     gene            348720..350144
                     /locus_tag="MNOD_RS40055"
                     /old_locus_tag="Mnod_8130"
     CDS             348720..350144
                     /locus_tag="MNOD_RS40055"
                     /old_locus_tag="Mnod_8130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631314.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:solute symporter"
                     /protein_id="WP_012631314.1"
                     /db_xref="GI:501740340"
                     /translation="MHEFTQGESLTIAVMVVAYILLTGWLTLKLRSRTNAQFMTAARS
                     MPAVVVGVLLMSEFIGAKSTVGTAQEAFNSGIAAAWSVLGASIGFVLFGLFIVRKIYD
                     SGEYTISAAIAQKYGKSTMMTVSVIMIYALLLVNVGNYVSGAAAISTALRVNLPTAMC
                     IIAAVSTFYYVFGGLKGVAWVTILHSAIKVVGIGIILAVALSLTGGLAPMRESLPPVY
                     FTWDGKLGFATIFAWTFGTVGAIFSTQFIVQAISSTKNASAARASAFYAAAFCFPLGI
                     VLALIGLAAKHLYPDMNSLYALPVFMKGMHPLLAGLVTTSLVASIFVSVSTVALAIAS
                     LVVRDFYVPYWNPDPAQELRMTRIFSLVIAVVPLVFVFFIPEILKLSFFTRALRLSIA
                     IVAMVGFYLPWFGSNRGATLGLLGAAVATTVWYVLGNPYGIDNMYVAALAPLLVMVIE
                     RLFGWGKPQPAPAASEPTHTVTPV"
     gene            350158..351354
                     /locus_tag="MNOD_RS40060"
                     /old_locus_tag="Mnod_8131"
     CDS             350158..351354
                     /locus_tag="MNOD_RS40060"
                     /old_locus_tag="Mnod_8131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_012631315.1"
                     /db_xref="GI:501740341"
                     /translation="MLDIIAQPQARTGTLQPVAGDPVRLETFIPSLCVQNHAANLMPL
                     ANGDLACVWFGGTQEGMADISVYFSRLAKGSDAWSPAEKLSDDPARSEQNPILFPAPT
                     GDLWLIWTAQVSGNQDTAFVRRRLSRDHGRSWGPIETLFPRREGCGTFVRQPPVVLAN
                     GDWLLPIFHCPSVPGAKWVGDDDTSAVKISSDAGRTWHEVAVPDSTGCVHMSIMPLDD
                     GTLLALFRSRWADAIYESRSTDGGATWSAPVPTALPNNNSSIQATRLANGHLALVYNA
                     VNAEAATERRASLYDEIEDEAGESAAPLPAAPGKRTAFWGTPRAPLTLAISEDGGRTW
                     PHRRDVETGDGYCMTNNSRDRTNRELSYPSVAQTPDGALHVAFTYHRQAIKYVRLSEG
                     WVSAGG"
     gene            351347..352030
                     /locus_tag="MNOD_RS40065"
                     /old_locus_tag="Mnod_8132"
     CDS             351347..352030
                     /locus_tag="MNOD_RS40065"
                     /old_locus_tag="Mnod_8132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_012631316.1"
                     /db_xref="GI:501740342"
                     /translation="MAEAARHALVTGASSGIGAAIVARLLGDGWAVTGVSRSEGSEVH
                     PRYRHLALDLSDLDAIAPALEDLRVDALVHAAGLLRVGRLGAMAPEDGEAMWRLHVEA
                     AVRMAEILVPRMAAGGRVVLIGSRTAAGAAGRGAYAASKAALVALARSWAAELMPRGI
                     TVNVVAPAATETPMLTDPARGGLAPRLPPLGRFIRPDEVAAAVAFFLSRETDAVTGQQ
                     LMICGGSSL"
     gene            complement(352340..353284)
                     /locus_tag="MNOD_RS40070"
                     /old_locus_tag="Mnod_8133"
     CDS             complement(352340..353284)
                     /locus_tag="MNOD_RS40070"
                     /old_locus_tag="Mnod_8133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012631317.1"
                     /db_xref="GI:501740343"
                     /translation="MARITPAPSAPTQIHAHHAAKAYMLLTFTALIWAGNVIASKWAV
                     GQVSPLALTSVRWLVACAALVPLAARQVACEWRLLRPAWFRILLMGGCGFTAFNALFY
                     IAGTYTSATNIALFQGAIPVVVLACSFLVYRTRVSLIQVTGVLVTLLGVAVAATHGDW
                     EVLRTFAFNRGDLLMLVACVLYAGYTVGLRARPAISGLTFFAAMALAALLTSLPLLMV
                     EWATGRLIWPTGKGWAIIAFVGLGPSLISQLSFMRGVELIGPNRAGVFVNLVPVFGAG
                     LAVSLAGEPFRLDNAVALTLVLSGIFIAERLGRRSRSS"
     gene            353702..353886
                     /locus_tag="MNOD_RS42270"
                     /pseudo
     CDS             353702..353886
                     /locus_tag="MNOD_RS42270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018261436.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_except=(pos:353770..353772,aa:OTHER)
                     /transl_table=11
                     /product="hypothetical protein"
     repeat_region   353880..355357
     gene            353943..355277
                     /locus_tag="MNOD_RS40080"
                     /old_locus_tag="Mnod_8135"
     CDS             353943..355277
                     /locus_tag="MNOD_RS40080"
                     /old_locus_tag="Mnod_8135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631034.1"
                     /db_xref="GI:501739547"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     gene            355639..>355833
                     /locus_tag="MNOD_RS40085"
                     /pseudo
     CDS             355639..>355833
                     /locus_tag="MNOD_RS40085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015933130.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            356224..356442
                     /locus_tag="MNOD_RS40090"
                     /old_locus_tag="Mnod_8137"
     CDS             356224..356442
                     /locus_tag="MNOD_RS40090"
                     /old_locus_tag="Mnod_8137"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754073.1"
                     /db_xref="GI:760071266"
                     /translation="MEETRRLHKNRLRIQALVQQTVHAFRATREDVKAYRQKAADGLA
                     RRSLQALAPMPDTIIRPRARRRGTRKQP"
     gene            complement(<356721..357081)
                     /locus_tag="MNOD_RS40095"
                     /pseudo
     CDS             complement(<356721..357081)
                     /locus_tag="MNOD_RS40095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012336501.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
     gene            complement(358029..358856)
                     /locus_tag="MNOD_RS40100"
                     /old_locus_tag="Mnod_8140"
     CDS             complement(358029..358856)
                     /locus_tag="MNOD_RS40100"
                     /old_locus_tag="Mnod_8140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012383331.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631322.1"
                     /db_xref="GI:501740348"
                     /translation="MLRRGRWGIISLWLGFVLSLWMGGAVAQEMHIADYTNTIHQKRF
                     ASKDDNDDYMQMLLSASVDNVVRAANRLIERGTADSEALAYAYAQRSNFWKSSSDAWA
                     AAVRDYEHAVQLSTQCKPFYLVRLGEIVAERDWGRAMSYFDQAITLSPQDPYVFFRRG
                     RLYGKAQKNDLALRDFDEVIRLVPHRPAAYIQRAEVWRAAGDIDRALQDYHAAFDRAD
                     SQFIKNTQWNLRDKKLYRREPDGSNNDTFRGAVSDCVRDRGCTVVSGWSAETRDDSP"
     gene            complement(359331..359513)
                     /locus_tag="MNOD_RS40105"
                     /old_locus_tag="Mnod_8142"
     CDS             complement(359331..359513)
                     /locus_tag="MNOD_RS40105"
                     /old_locus_tag="Mnod_8142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631323.1"
                     /db_xref="GI:501740349"
                     /translation="MYVEGGWKPSWEPPPRRPQLTERQERVFLWLIALNALLLLLAPI
                     GGATIIHAVLAVLRHG"
     gene            359650..360033
                     /locus_tag="MNOD_RS40110"
                     /old_locus_tag="Mnod_8143"
     CDS             359650..360033
                     /locus_tag="MNOD_RS40110"
                     /old_locus_tag="Mnod_8143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631324.1"
                     /db_xref="GI:501740350"
                     /translation="MTGAEDGLRDDQWERVKDLLPGGRKGKRGPRLQNRLFLDAILWF
                     ARSGGRWKDLPERFGQSDTIKRRYYRLVDRGVFDQILDRLAQDADLEWLMIDSTIVRA
                     HHRAAGARLTKGGRLPRGWAGLAEA"
     gene            360009..360416
                     /locus_tag="MNOD_RS40115"
                     /old_locus_tag="Mnod_8144"
     CDS             360009..360416
                     /locus_tag="MNOD_RS40115"
                     /old_locus_tag="Mnod_8144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631325.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631325.1"
                     /db_xref="GI:501740351"
                     /translation="MGRSRGGLSTTIHAAVDAHGNPVRLIGGPGQEHDLAKAGALIAG
                     FPAEFTLADKGYDGDPLCDAITAQGSEVVIPPRRGRTHPRSYDKDLYKERNVIERFFA
                     RLKDFRRVATRYDKLLKNYMGFVTLAAIAIWLR"
     gene            360864..361289
                     /locus_tag="MNOD_RS40120"
                     /old_locus_tag="Mnod_8145"
     CDS             360864..361289
                     /locus_tag="MNOD_RS40120"
                     /old_locus_tag="Mnod_8145"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631326.1"
                     /db_xref="GI:501740352"
                     /translation="MMVATLADTSTELLLIAEHDLAEVLVIDEHQDRQTALLLKVAAE
                     LSDELQQAIAALASVGVQRAQRVVRAYVAARAVFENPPPKAKVKIAARVLPRLLRLEE
                     VAARDPDLDRALEQAREAVRKIPARGLAIDWITSKARGR"
     gene            complement(361337..361789)
                     /locus_tag="MNOD_RS40125"
                     /old_locus_tag="Mnod_8146"
     CDS             complement(361337..361789)
                     /locus_tag="MNOD_RS40125"
                     /old_locus_tag="Mnod_8146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631327.1"
                     /db_xref="GI:501740353"
                     /translation="MTTQSDTGARLLIYGERRCSRPSAPSLVASMAALEGMHAAGLPG
                     IVDVILTTRDDTTLEVSFIETLHERQKGHAGRAIEIITEAADAAGVKLILKAQACPPK
                     RARRVLSTNELVRFYERRGIRIVSAALGGGILMERPPERRMRVVGRAA"
     gene            361960..362238
                     /locus_tag="MNOD_RS40130"
                     /old_locus_tag="Mnod_8147"
     CDS             361960..362238
                     /locus_tag="MNOD_RS40130"
                     /old_locus_tag="Mnod_8147"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631328.1"
                     /db_xref="GI:501740354"
                     /translation="MRTTLLSRAIQRGRGWRKWHTADASEIFFGGANALTDGMRLCWT
                     VQGRVGVVDASANRRLARHTAFDLINNTNVTGALRELNDLAAPHLKAG"
     gene            complement(362301..363998)
                     /locus_tag="MNOD_RS40135"
                     /old_locus_tag="Mnod_8148"
     CDS             complement(362301..363998)
                     /locus_tag="MNOD_RS40135"
                     /old_locus_tag="Mnod_8148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631329.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylyase"
                     /protein_id="WP_012631329.1"
                     /db_xref="GI:501740355"
                     /translation="MDATPKSALRRQQSMPEFVAAMEKAGLLVRIPGEKRVDELPMLM
                     EQHYDKAIFVERIQDCEFSFLANAYSNHAQYAWALGCSRSEIGNVTAELAKGRIKPKI
                     VATAPCKEVILKGADVDLSRLPLFLHHDRDGHAYINDNLVVSKDPDTGVTDWGIYRSM
                     FRTINEKNFDMTCASHRGRLNALKYQARGQDMPIAIVLGGPTLDKIAALAGVPPETED
                     FDVLGSFYGAPAELVKCETSDLFVPANAEIVLEGEVMATEGWVYDEGPYGEFTGMYGG
                     GMKHNPRVVIHCMTYRKGAIYQTATIGGAHPGFTDNMLQLPAVESDIYGALCAGGIHV
                     LDVRCPAPGLSNIAYARIKPQGGGDAKQALGIMLTCSKQGLPKIAMVFDADVDIWNDE
                     RIAQSMAFRYMPDRDTIIIPQCNTMSTDPKVGDPDKPFVCSKIGLDCTIPLVGDVDRS
                     AYDWSSACDLGQIPKGVVSMDKDALTKDMEVFIRAAPRSWKEILEHYHGQPYRPIYQA
                     FSTLRPRLGRRSDAPWYRYAFLDSGLADATPSAPKLSNHDPRHQPHFTPPPRAATGA"
     gene            complement(364015..364649)
                     /locus_tag="MNOD_RS40140"
                     /pseudo
     CDS             complement(364015..364649)
                     /locus_tag="MNOD_RS40140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020800996.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(365168..366082)
                     /locus_tag="MNOD_RS40145"
     CDS             complement(365168..366082)
                     /locus_tag="MNOD_RS40145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754074.1"
                     /db_xref="GI:760071267"
                     /translation="MVAIADDNNNTVVGTADDELLPGLGGDDIVLGLVGNDTIQGGDG
                     NDFVSGGFGADSVSGDAGNDLVFGDDDDDVADGGEGNDRVHGGTGADRVFGAAGDDQV
                     YGEWGNDFVSGGEGHDFVSGGFGNDEVNGDAGNDLLFGDDGDDAVSGGEGNDRVYGGT
                     GNDLVSGDAGADQLFGEQGEDVLLGGAGSDYLSGGAGADQLFGGEGADLLFGNAGADA
                     LTGGLGSDAFAFGRGDGQDVIRDFVTGGAERDVIAFNNGALGSFAAVQAALRQEGSDA
                     VIAYGTGDTITLQNVQASSLTADNFSFS"
     gene            complement(366990..367256)
                     /locus_tag="MNOD_RS42275"
     CDS             complement(366990..367256)
                     /locus_tag="MNOD_RS42275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007677524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783637.1"
                     /db_xref="GI:915398252"
                     /translation="MRANAVRLQLHALAYNRANFFRTLVLPDEGEQWSLATLREKVVK
                     SGAKVIAHARYTVFQMAEVAVPRHLFRRMLALIGDLRPRPVVRW"
     gene            368443..>368697
                     /locus_tag="MNOD_RS40155"
                     /pseudo
     CDS             368443..>368697
                     /locus_tag="MNOD_RS40155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018261866.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            369428..369637
                     /locus_tag="MNOD_RS40160"
                     /old_locus_tag="Mnod_8155"
     CDS             369428..369637
                     /locus_tag="MNOD_RS40160"
                     /old_locus_tag="Mnod_8155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631334.1"
                     /db_xref="GI:501740360"
                     /translation="MAKLFIGSVRTQGGYRPPITVRATSQAEALWFLRAQYPQDRVEA
                     VLPALWWPPTSDTGRTIGDIREHRC"
     gene            complement(369735..370229)
                     /locus_tag="MNOD_RS40165"
     CDS             complement(369735..370229)
                     /locus_tag="MNOD_RS40165"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754084.1"
                     /db_xref="GI:760071277"
                     /translation="MDNICAHASHSISAYSATLPAVLFKTFYGCKPDPGWIAECATRA
                     AILDDIRKMPMGLETLVGDMGSTLSGGQKQRAILARALYRRPDILFLDEATSHLDEPT
                     EAVIAEALRALNMTRIIVALRPATIAHADHVLGFGGGETRSPSAQLALVHQTPGAPRP
                     KRRR"
     gene            complement(371409..371681)
                     /locus_tag="MNOD_RS40170"
                     /old_locus_tag="Mnod_8157"
     CDS             complement(371409..371681)
                     /locus_tag="MNOD_RS40170"
                     /old_locus_tag="Mnod_8157"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754086.1"
                     /db_xref="GI:760071279"
                     /translation="MPMAGADATLQIVWACDHKGEVRAWALPYDGQVEVEGTAITVVY
                     DPSNGTRSWTAVVMDGDQPTSILEPNDIRTLAERYELRDWSDKRYV"
     gene            371837..372115
                     /locus_tag="MNOD_RS40175"
                     /old_locus_tag="Mnod_8158"
     CDS             371837..372115
                     /locus_tag="MNOD_RS40175"
                     /old_locus_tag="Mnod_8158"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018259596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783653.1"
                     /db_xref="GI:915398268"
                     /translation="MTTVEVYCRRTGCRHRAVIATDRFPDDLSSVRFAFRLRCSRCGA
                     RRPEVRRDMLAHYAQIHAETGWGMRASGPLPAHHKVVGRDVPWPDEKR"
     gene            372407..372670
                     /locus_tag="MNOD_RS40180"
                     /old_locus_tag="Mnod_8159"
     CDS             372407..372670
                     /locus_tag="MNOD_RS40180"
                     /old_locus_tag="Mnod_8159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012331755.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783638.1"
                     /db_xref="GI:915398253"
                     /translation="MMPLHTDERWHYEGDAATREKRVYCDDALIGRVRRWHMMEPDGR
                     FSAWFAFEQWQDGAFRPVGGLQATFDEALLHLASLSVPPRACQ"
     gene            373315..373509
                     /locus_tag="MNOD_RS40185"
                     /old_locus_tag="Mnod_8160"
     CDS             373315..373509
                     /locus_tag="MNOD_RS40185"
                     /old_locus_tag="Mnod_8160"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631339.1"
                     /db_xref="GI:501740365"
                     /translation="MKSTAMADETAPESSTTVAAEAAAGASLRECVAASEAIAGQSDS
                     AAPEARTGKPGSAAQAARSG"
     gene            complement(374038..375069)
                     /locus_tag="MNOD_RS42280"
                     /old_locus_tag="Mnod_8162"
     CDS             complement(374038..375069)
                     /locus_tag="MNOD_RS42280"
                     /old_locus_tag="Mnod_8162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015206532.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Methicillin resistance protein"
                     /protein_id="WP_012631341.1"
                     /db_xref="GI:501740367"
                     /translation="MSAEVAVKQPHSEFDRWKTWDAFIEQRADPGFRQLSWYTSLQVA
                     RGWEQFGTVLRYGDAIIGGAMVLARSFAPGKCYYIVPDGPIFLEEDSPSEQEQVFRTV
                     MSFIERKRQTEQRVVSHLCINPRWEHVPEFVTGFRKSSHYYGTPRDTLYIDLTSSESA
                     ILAQMKPKGRYNIRVAQRYGVSVVEDVSSKGIEDFLAVYRETFDRRRKDGRSSGYFHN
                     LIPRLLAADRGSIFFSEYQGTRIATALVVYSGRMATYYYGGSRDVHRNVMAPYLLHFE
                     IMRTAKSRGCLSYDLFGVTPQGAPSDGWQNFSIFKRKFGGREVRFVPTLEHIYDPAAY
                     QEWKEAEDE"
     gene            complement(<375517..377619)
                     /locus_tag="MNOD_RS40195"
                     /old_locus_tag="Mnod_8163"
                     /pseudo
     CDS             complement(<375517..377619)
                     /locus_tag="MNOD_RS40195"
                     /old_locus_tag="Mnod_8163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631342.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
     gene            complement(377607..378938)
                     /locus_tag="MNOD_RS40200"
                     /old_locus_tag="Mnod_8164"
     CDS             complement(377607..378938)
                     /locus_tag="MNOD_RS40200"
                     /old_locus_tag="Mnod_8164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011133624.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD family protein"
                     /protein_id="WP_012631343.1"
                     /db_xref="GI:501740369"
                     /translation="MSQDGSDSELAAGQKQLPIHRESLFRAEVLAEGQAQWLGTVLLE
                     PRLTHWMFALFASAAVMAIVLLLVFGSYTRKARINGWLVPEQGVVRSFSPQAGVITEV
                     LVQEGMAVRKGSPVLVISTEMLSSAAGATRQEVVRQLKRRRDSMMQEKSVQVRVFENQ
                     INDARKKLDILSAERKHLEVEVGLQKTKIEMADRTAVRLRELRKRDIVTAPRLEEAEK
                     ERLDEAAKLQALERSLATLEREQAEAWATLQAVPLRRQIQENESERSVAALEQDLIEA
                     EARREIVITAPQDGTITGLQAEPGGNATTSIPLFGIVPSRSKLQAQLFSPSRGIGFLR
                     AGQRVLLRYQAFPYQKFGFYGGVVTTVSRSALSPAELNQTLAGLTALFGSNEPIYRVT
                     VELDRQTAVAYGQAVALQPGMQLEADVLIESRRLIEWVLEPLYTLSGSWHA"
     gene            complement(378947..379906)
                     /locus_tag="MNOD_RS40205"
                     /old_locus_tag="Mnod_8165"
     CDS             complement(378947..379906)
                     /locus_tag="MNOD_RS40205"
                     /old_locus_tag="Mnod_8165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631344.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631344.1"
                     /db_xref="GI:501740370"
                     /translation="MDARQHWPMTHGEPQVGVREAWLLGQPGLQDFLDYVEDHAVGVA
                     ALSRSALVDEWRAANDYYHHLELNEAGAADAIEVRDLDPTCAELADAVRADPRYRRAF
                     DKVPTRFAMVELDRLVVAQSHIDLDHADRLQARAGDRLNAQALFRFCQPLGDFEAPVQ
                     IRQAGARRYLFVSASSDLRFHECLLLKPQDLANHAAFGSVSGAVGLIVGFGSNFLSVV
                     QSESRLLLHNGHHRAYALRAMGVRFAPCIIQTATRGEELGLLASSKVMASPSFYFRAA
                     RPPLLKDFFEPRIRKVLQVRRTSQVIELSFEVKDYSVRSLDDA"
     gene            complement(<381150..>381659)
                     /locus_tag="MNOD_RS40210"
                     /pseudo
     CDS             complement(<381150..>381659)
                     /locus_tag="MNOD_RS40210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015932514.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="sulfurtransferase"
     gene            complement(381771..382070)
                     /locus_tag="MNOD_RS40215"
     CDS             complement(381771..382070)
                     /locus_tag="MNOD_RS40215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012408833.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783639.1"
                     /db_xref="GI:915398254"
                     /translation="MAACFTRPTFATLPVLVAGAVLAPGRRTVTAALSSLGLREGVTV
                     STEHRVLSRRRWRAQATARGLLGLLIAAFVPSGPVVVGIDETLERRCGTKIKARS"
     gene            382054..382248
                     /locus_tag="MNOD_RS42285"
     CDS             382054..382248
                     /locus_tag="MNOD_RS42285"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783640.1"
                     /db_xref="GI:915398255"
                     /translation="MKQAAKGAIQVDRTAGTVGRLGGDRACHGGLPVVSSSAPTPPAP
                     QGFPMPARSDPLQARIEAFN"
     repeat_region   382245..383718
     gene            382305..383639
                     /locus_tag="MNOD_RS40220"
                     /old_locus_tag="Mnod_8169"
     CDS             382305..383639
                     /locus_tag="MNOD_RS40220"
                     /old_locus_tag="Mnod_8169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631034.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631034.1"
                     /db_xref="GI:501739547"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     gene            complement(383975..384886)
                     /locus_tag="MNOD_RS40225"
                     /old_locus_tag="Mnod_8171"
     CDS             complement(383975..384886)
                     /locus_tag="MNOD_RS40225"
                     /old_locus_tag="Mnod_8171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010880107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631347.1"
                     /db_xref="GI:501740373"
                     /translation="MSWFFIALWAPFLLACANHNDKLLLSKYFKDKTIGPIVIFSSLF
                     SGVAIPIALLIQPNVYEVSLVQGSALVTTGMLSVVAGVFYLYALDLDEASFVTPFYQT
                     VPIFAYFLGYFILGETITLSQGLGSSVIIAGAIALSLEFGQRGIRFKRNVVALMLVAS
                     FLSAINGVVFKLIAVSKGFWVSLFWGFIGQVIAGFIFLVCVPSYRRDFITLLKQQKVP
                     AAGLIALSRTLFSVSEAVTLYATLLAPVALVLVVNSFQPLFVFMLGIVLTLLLPRVAK
                     ESLDRRKMLQKGVGIGLMLAGGYLISR"
     gene            complement(384883..385953)
                     /locus_tag="MNOD_RS40230"
                     /old_locus_tag="Mnod_8172"
     CDS             complement(384883..385953)
                     /locus_tag="MNOD_RS40230"
                     /old_locus_tag="Mnod_8172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020506749.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="WP_012631348.1"
                     /db_xref="GI:501740374"
                     /translation="MRTFPSNEPHLAFAVPGDLATPTGGYGYDRRIIQELRQLGWQVD
                     VADIGDGFPFPSVVQRATALATLSAVPAGCPTVLDGLAFGALPEAGALRSRTPLIALV
                     HQPLALDSCLDTAQADTFRESERAALAAAARVVVTSEATARVVCTDYDVPVQRISVVR
                     PGNDPVPPALGSSDGVVRLLSVGSVVPVKGYDLLIAAVATLADMPWRLTIAGDRTRNP
                     AIAAQLDADIEAYGLGDRVAVLGAVSPERISDLYLASDVFVLASRFEGYGMALTEAIA
                     HGLPVVSTVAGAIPDTVPSGTGFLVPPNDAAALAQALRYLIGDPAERQRLAANARAAA
                     TQLPTWQDSARLFARAVETVRL"
     gene            complement(386040..386483)
                     /locus_tag="MNOD_RS40235"
     CDS             complement(386040..386483)
                     /locus_tag="MNOD_RS40235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011281861.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754098.1"
                     /db_xref="GI:760071291"
                     /translation="MDDAEELKEIADQSIDLAICIGAFEHMLDKRAVLAGIHRVLKFG
                     GRFFCLTPDADYVWYRSIAPVLGFATKHLSSDRMLTRDEFSALLDQAGFRRIRSVPWT
                     FIPKGDVPSLVALLLTVLDAIGRHARLDSLRGGLALCAWKEAKPT"
     gene            386529..386735
                     /locus_tag="MNOD_RS40240"
     CDS             386529..386735
                     /locus_tag="MNOD_RS40240"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754099.1"
                     /db_xref="GI:760071292"
                     /translation="MRQFNHAWRDIDPDATSHFRNKGKEVMAIAATEVQDDIRGPGPG
                     QASHERESVFEQPLRVAVLFQKPG"
     gene            387715..388122
                     /locus_tag="MNOD_RS40245"
                     /old_locus_tag="Mnod_8175"
     CDS             387715..388122
                     /locus_tag="MNOD_RS40245"
                     /old_locus_tag="Mnod_8175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631350.1"
                     /db_xref="GI:501740376"
                     /translation="MTRAATLDRHAPTVLSVLRIVAALIFMAHGTQKVLGFPAHPNPP
                     GLMTLSGVAGILELIGGALLALGLFTRPVAFILSGEMAFAYFIAHAPRSFFPVLNGGD
                     AAILYCFVFLYLVFAGPGPLSLDALGSRGRSPR"
     gene            388294..388521
                     /locus_tag="MNOD_RS40250"
                     /old_locus_tag="Mnod_8176"
     CDS             388294..388521
                     /locus_tag="MNOD_RS40250"
                     /old_locus_tag="Mnod_8176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015927301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631351.1"
                     /db_xref="GI:501740377"
                     /translation="MILNALALKLERQARGDFKGRHCEATLIVQAVSWYLRDALNHAH
                     LQGRGLRTTVTPARLQLCCTRGFNRRAASRP"
     gene            complement(388662..389765)
                     /locus_tag="MNOD_RS40255"
                     /old_locus_tag="Mnod_8178"
     CDS             complement(388662..389765)
                     /locus_tag="MNOD_RS40255"
                     /old_locus_tag="Mnod_8178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002717258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783641.1"
                     /db_xref="GI:915398256"
                     /translation="MALDLVRFDTISPPGSESACAAHLAVLLRRAGFDVTDYPFAPGR
                     TSLVARLPGTNPALAPLVFTGHLDTVPLGSAPWSFDPRGEIRDGRLYGRGASDMKAGV
                     AAFVAAVLDVAHSAAVLTRGVTLVLTAGEETGCLGAADLARRGVLGEASGLVVAEPTS
                     NRLALAHKGALHLRARTHGATAHGSMPELGDNAVLKATRAVEALRNFEFGVPTHPLLG
                     SPTLAVTSLHGGEAVNVIPDSCTLTLDLRTLPGQDHARTLAMLQDQLGPDVVFDPPLA
                     DLPAVGTEPSDGFAMAAARSVRKVTQEVGEAIGMPYFTDGSVLQGAFGGCPTVILGPG
                     EPGQAHQTNEWCATSAITIAHRIYGALVQEWCA"
     gene            complement(391070..393307)
                     /locus_tag="MNOD_RS40260"
                     /old_locus_tag="Mnod_8179"
     CDS             complement(391070..393307)
                     /locus_tag="MNOD_RS40260"
                     /old_locus_tag="Mnod_8179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631354.1"
                     /note="has catalase and peroxidase activities; Derived by
                     automated computational analysis using gene prediction
                     method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="catalase/hydroperoxidase HPI(I)"
                     /protein_id="WP_012631354.1"
                     /db_xref="GI:501740380"
                     /translation="MDAKVDDTGEGKCPITGSRRGRTNRDWWPNHLDIQVLHRNSSLS
                     DPMGEDFDYAKEFKTLDLNAVIKDLHALMTDSQDWWPADFGHYGGLMIRMAWHSAGTY
                     RITDGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGRKISWADLMILAGNV
                     ALESMGFKTFGFAGGRKDVWEPEELYWGPEGTWLGDERYSGERQLQEPLGAVQMGLIY
                     VNPEGPNGKPDPVAAARDIRETFFRMAMNDEETVALIAGGHTFGKTHGAGDPSFMGPE
                     PEAGALEDQGLGWKSRHGRGFGPDTITGGPEVIWSQTPTKWSNYFFDNLFKYEWELTK
                     SPAGAWQWQAKGAEPTIPDPFDESKKRMPTMLITDLALRLDPAYEKISRRFYEHPDQF
                     ADAFARAWFKLTHRDMGPIQRYLGPLVPKEVLIWQDPIPALDHEVVNEQDIAVLKAKI
                     LASGPSVPQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPAELAKVLQKL
                     EVIQKEFNASQKGGKKVSLADLIVLGGCAAVEKAAKDAETPVTVPFTPGRMDASQEQT
                     DVDSFAPLEPRADGFRNYISGRRQFMMPEEALVDRAQLLRLTAPEMTVLVGGLRVLGA
                     NVGQSKHGVFTNRPGMLTNDFFLNLLDMGTQWHHAGGDVYEGRDRKTNELRWTGTRVD
                     LIFGSHSQLRALAEVYGCADSQEKFVKDFVAAWTKVMNLDRFDVAGRIAEKAADLKVS
                     VDAAL"
     gene            complement(394402..394707)
                     /locus_tag="MNOD_RS40265"
                     /old_locus_tag="Mnod_8181"
     CDS             complement(394402..394707)
                     /locus_tag="MNOD_RS40265"
                     /old_locus_tag="Mnod_8181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631356.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631356.1"
                     /db_xref="GI:501740382"
                     /translation="MFLARFSYDVLPVNRQQAIEHIRREIEAARANGLKARLLVPLTR
                     VQRCAALQFEVELTNLDQLDQFRRGGVGSEGETSEWMRSFSDILQSPPLVEILRAED"
     gene            complement(<395103..395438)
                     /locus_tag="MNOD_RS40270"
                     /pseudo
     CDS             complement(<395103..395438)
                     /locus_tag="MNOD_RS40270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003605747.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(395410..395667)
                     /locus_tag="MNOD_RS40275"
     CDS             complement(395410..395667)
                     /locus_tag="MNOD_RS40275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012455606.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754305.1"
                     /db_xref="GI:760071500"
                     /translation="MNGRRGRETSLIRTLGCMSGFAFWLVTAAGVAAAYPPLSTGIAV
                     YGVLALAELHSSGRAASDMAAEDTFGLRKRRRAGGRPGRLL"
     gene            complement(395998..396510)
                     /locus_tag="MNOD_RS40280"
                     /old_locus_tag="Mnod_8184"
     CDS             complement(395998..396510)
                     /locus_tag="MNOD_RS40280"
                     /old_locus_tag="Mnod_8184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007565786.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631359.1"
                     /db_xref="GI:501740385"
                     /translation="MIRKLSLAALALCALAAPALAAEVTAVANTAVVVPWGDWIVAIA
                     QTITSVLVPILVTVITAAIALIAPWLQLFITQKRIQQMVEACLEYALNTVEGAAKGKA
                     LNVEIGSKVLATAVNRALNAAPAAVVRAAGGPKGVARTIFRALHLDETANANAVLTPV
                     LNGLPAAARK"
     gene            complement(396570..396871)
                     /locus_tag="MNOD_RS40285"
                     /pseudo
     CDS             complement(396570..396871)
                     /locus_tag="MNOD_RS40285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015930090.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ammonia monooxygenase"
     gene            complement(396871..>397140)
                     /locus_tag="MNOD_RS40290"
                     /old_locus_tag="Mnod_8186"
                     /pseudo
     CDS             complement(396871..>397140)
                     /locus_tag="MNOD_RS40290"
                     /old_locus_tag="Mnod_8186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015930091.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(397238..397606)
                     /locus_tag="MNOD_RS40295"
     CDS             complement(397238..397606)
                     /locus_tag="MNOD_RS40295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015931536.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="WP_050783654.1"
                     /db_xref="GI:915398269"
                     /translation="MFGYTVQEARRFALTHPEADNPRTARPMPKTADAELQTPEHRAW
                     RLAVLQRAGWCCEDCGAQGGRGGVRLFADHVIERQDGGALTDPNNGRCLCGSCHTRKT
                     VAERARRMAVRSAAAEPGRG"
     gene            complement(398444..398788)
                     /locus_tag="MNOD_RS40305"
                     /old_locus_tag="Mnod_8189"
     CDS             complement(398444..398788)
                     /locus_tag="MNOD_RS40305"
                     /old_locus_tag="Mnod_8189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018267598.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783642.1"
                     /db_xref="GI:915398257"
                     /translation="MFPGYAFVGKRPEQSWRDILRVPGVRALVTTGEAPTELPPWMMK
                     MLIAADEMAAYDRPRPQLAVGDKVQIRDELWEGLIGEVMRAPEGRRIAVLLKAFGKKH
                     VLSVDVDRLAAK"
     gene            complement(398830..399351)
                     /locus_tag="MNOD_RS40310"
                     /old_locus_tag="Mnod_8190"
     CDS             complement(398830..399351)
                     /locus_tag="MNOD_RS40310"
                     /old_locus_tag="Mnod_8190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631364.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631364.1"
                     /db_xref="GI:501740390"
                     /translation="MFLDETAATTSMVRRYGWAPRGERCRLAAPAGHWKTTTVIAGLR
                     TSGPDAIALLDGPVTGERFRAYVTDTLVPTLRPGDTVILDNLGAHKVAGVREAIAATG
                     ARLLYLPPYSPEFNPIEQAFAKLKALLRRAAARSVSELWAAIHQAFKCFSPAECRNYF
                     TAAGYEDDAYAST"
     gene            complement(399408..399791)
                     /locus_tag="MNOD_RS40315"
     CDS             complement(399408..399791)
                     /locus_tag="MNOD_RS40315"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015927332.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_015927332.1"
                     /db_xref="GI:506407613"
                     /translation="MPSALSVDLRQRVVSAVAEGASCHQAAARFGVSVASVSRWSRQQ
                     EGQGDVTPKPMGGDQRSQRIEAHAELILQTYQAHPQSFLHELCETLQEQGVPVSRSSL
                     SRFFARHRITRKKGRRTQLSRSGRM"
     gene            complement(400595..401254)
                     /locus_tag="MNOD_RS40325"
                     /old_locus_tag="Mnod_8193"
     CDS             complement(400595..401254)
                     /locus_tag="MNOD_RS40325"
                     /old_locus_tag="Mnod_8193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631367.1"
                     /db_xref="GI:501740393"
                     /translation="MSPLPERTESLTAPPTDPSGPIAGRPGHSLARRAIDEAERYLWF
                     ALYLIVILGTLILFSLNIYARIDQDVPRYPGYHFYALGLINALVFAKIMLIAEAAGVG
                     SRFIGRRLEAGRLVMVILYRALAFTVVLVAAYVLEAVLEGAWHGKAVGQVLPEIAGGP
                     LGLVSLAWIMLVALVPYFAYRELGRVLGHARLQAIMLKPGGTFRDGADPQTASQSRFA
                     A"
     repeat_region   401746..403220
     gene            401807..403141
                     /locus_tag="MNOD_RS40330"
                     /old_locus_tag="Mnod_8194"
     CDS             401807..403141
                     /locus_tag="MNOD_RS40330"
                     /old_locus_tag="Mnod_8194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012779118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631188.1"
                     /db_xref="GI:501740169"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDVMAVTGLNRPD
                     FRTIAEFRKRHLAALSDLFVQVLRLCQAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKTTEAALAAEVEAWLAQAAEMDAAEDRAHGMDRRGDETPDWMADKQRRLAAIRAAKA
                     ALEAEAADPPAPEDESGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTEPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAQRLVTNAADYRALVPLIDDVSAHLGRKPREVSGDAGF
                     ATEANLTALQARRIRGYLPPGRARHGEAHAAGRRKLTKMPLMSAMAQRLKRAGRRSRY
                     RLRKQVVEPVFGQMKQARGFRQFLLRGLEQVRGEWAMICTAHNLLKLAQAAR"
     gene            complement(403362..404810)
                     /locus_tag="MNOD_RS40335"
                     /old_locus_tag="Mnod_8195"
     CDS             complement(403362..404810)
                     /locus_tag="MNOD_RS40335"
                     /old_locus_tag="Mnod_8195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012631368.1"
                     /db_xref="GI:501740394"
                     /translation="MGVTRRIFATGAATIPLIGSGFPRASAQNAAQDALLIGNNAVAD
                     PLELATDAYIYGYPLVTMEMTRRVLTNVVAPEGKSAPMGQFANLREYPDAKFRAVTAP
                     NADTLYSSAFLDVGREPYILSIPNEDGRYFLMPMLSAWTNVFSVPGKRTTGTGPQTYF
                     IAGPGWSGSVPSGAKLIQAPTSLVWIIGRTYCTGTPEDYKTVHALQDQYRLIPASAAA
                     TSYTPPAGQVDPGIDTKTAVREQVNNLDAATYFNLLAALMKDNPPALADGVAVAKMAS
                     LGIVSGRTFDPRGLTPSVREAVEQAPKQAISRIMGHMKTTGRHINGWTFTTDGGDYGK
                     DYLQRALVTAVGLGCNLPQDAVYPLTTVDAAGRRLAGTSKYVMRFPAGELPPVDGFWS
                     LTMYDANFFFVDNPLNRYTVSPRNNLQTNPDGSVDLFIQTESPGPQRESNWLPAPTGP
                     FILMLRTYWPKDALLNGSWAPPPVTRGAGAAL"
     gene            406049..406399
                     /locus_tag="MNOD_RS40340"
                     /old_locus_tag="Mnod_8196"
     CDS             406049..406399
                     /locus_tag="MNOD_RS40340"
                     /old_locus_tag="Mnod_8196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631369.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phasin"
                     /protein_id="WP_012631369.1"
                     /db_xref="GI:501740395"
                     /translation="MTSQNPFEVPAELRDFADKSLAQAQQAVAAFFQNTRKLNETVQS
                     SFKASQLPVSVAYARSLDFAEQNADAAFAVAHKIIRARDLQEAGQIRAEYLRAQFDTF
                     QAQAKEIYSVAKAA"
     gene            406520..407113
                     /locus_tag="MNOD_RS40345"
                     /old_locus_tag="Mnod_8197"
     CDS             406520..407113
                     /locus_tag="MNOD_RS40345"
                     /old_locus_tag="Mnod_8197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015490319.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_015932755.1"
                     /db_xref="GI:506413036"
                     /translation="MTEAVAPGEQITEAGDEQAVLPPTEGEQTSLEAVPVYDPEPLPA
                     QEEAPEALMSEAAQSEADEPASASEIIAAEPEPIAVHSLEVSAPEISGEIPAPAPATN
                     EHAVAGVSAAPQPAATQASVYSIATRLLEKAGAQQRIWFSYAESELKAKLTYGRVLSK
                     SRTPVDVILASNAEYLRALVASSNVLSEIVADGITLA"
     gene            407158..407439
                     /locus_tag="MNOD_RS40350"
                     /old_locus_tag="Mnod_8198"
     CDS             407158..407439
                     /locus_tag="MNOD_RS40350"
                     /old_locus_tag="Mnod_8198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631371.1"
                     /db_xref="GI:501740397"
                     /translation="MLISCLEATLLLIEGQKVVELRLMKLARGGLEAWLEAQLMVSEK
                     VSAAFEAAGMLVVGKGFEAVIVRYREHVAANTQRLSTATTSDLHPQAWS"
     gene            complement(407881..408454)
                     /locus_tag="MNOD_RS40355"
                     /pseudo
     CDS             complement(407881..408454)
                     /locus_tag="MNOD_RS40355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012455577.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(408719..409330)
                     /locus_tag="MNOD_RS40360"
     CDS             complement(408719..409330)
                     /locus_tag="MNOD_RS40360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015823808.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754102.1"
                     /db_xref="GI:760071295"
                     /translation="MHLTIRRFYCHAPGCPRRTFAERFTHLLGRDASRTRRLAQAQVR
                     TGVALGGQPAARLLSHLVMPTTATTLLRTIRALPLPSAGQPQVVGVDDWALRKGRTYA
                     TIVIDLERHRPVDLLPDRSAATLATWLRHEPQIHLVARDRSTEYARGTTMGAPAAPQV
                     ADRWHLLLNTRQMLERWLARVHPRLRQMPLTALPASSLRRTTA"
     gene            409743..410378
                     /locus_tag="MNOD_RS40365"
                     /old_locus_tag="Mnod_8200"
     CDS             409743..410378
                     /locus_tag="MNOD_RS40365"
                     /old_locus_tag="Mnod_8200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631372.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SAM-dependent methyltransferase"
                     /protein_id="WP_012631372.1"
                     /db_xref="GI:501740398"
                     /translation="MLEWDAVLGQTGSSGDALFAPAVARNREVILDVLRRVLPPTGLI
                     LEVASGSGEHVVHFASALPDLQWQPSDADPKALRSIAAHAQASGVPNILSPMPLDVRE
                     ERWPVARADAVLAINMVHIAPWAATEGLMAGAGRVLPEGGLLYLYGPFRVAGVHTAPS
                     NAAFDADLRARDPAWGVRDVEAVSAAALAQGLTLLDRIPMPANNFSLVYSR"
     gene            complement(410618..410824)
                     /locus_tag="MNOD_RS40370"
     CDS             complement(410618..410824)
                     /locus_tag="MNOD_RS40370"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754105.1"
                     /db_xref="GI:760071298"
                     /translation="MPQQWSAFLCAAEQAQGEGSRRDCQEQGTVLLRDLRCPERERGQ
                     AGRMDGRRRLCCRKLIHGRRTGGG"
     gene            complement(410927..411580)
                     /locus_tag="MNOD_RS40375"
                     /old_locus_tag="Mnod_8202"
     CDS             complement(410927..411580)
                     /locus_tag="MNOD_RS40375"
                     /old_locus_tag="Mnod_8202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Phytochelatin synthase"
                     /protein_id="WP_012631374.1"
                     /db_xref="GI:501740400"
                     /translation="MKLKLIATACLALGIPGAIALAPISPRVSPEAIQSAVTRSGPLL
                     DRAWQLPVAASFRRDLVWQSNVSLCGPASVASAFRSLNERADTESAVLAGTGRCWTGF
                     CVLGLTLDQLADVARTHTKRKVIVLRDLSADEFREHMRRANDSGRRYIINFSRASIFG
                     GGAGHHSPVGGYMEAEDLVFVLDVNRNYQPWLIERPRLYSAMDTLDGDKKRGLLLIE"
     gene            411874..412392
                     /locus_tag="MNOD_RS40380"
                     /old_locus_tag="Mnod_8204"
     CDS             411874..412392
                     /locus_tag="MNOD_RS40380"
                     /old_locus_tag="Mnod_8204"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631376.1"
                     /db_xref="GI:501740402"
                     /translation="MRAFMIKHNAGSRRVLSFAGPVLTMTQDVTKLAKVKLEEARQRP
                     IVAEESPTLPALSMPASTPTTALGGRQVASDRADDLARGDHLAVEQLLSRPVEFSRLM
                     TPVRDRLFALPLQLGERRRLHGSLTSIMNARMFSDGATKLGPDTTGVVEVIKQDATVM
                     APDEPGPEKSVL"
     gene            complement(412831..413514)
                     /locus_tag="MNOD_RS40385"
                     /old_locus_tag="Mnod_8206"
     CDS             complement(412831..413514)
                     /locus_tag="MNOD_RS40385"
                     /old_locus_tag="Mnod_8206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631378.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012631378.1"
                     /db_xref="GI:501740404"
                     /translation="MSELLTAEALSALFEVIMIDLVLAGDNAIVIGLAAAGLPREQRN
                     KAILIGIAAATVLRIVFAGLVSQLLAIVGLLLAGGILLLWVCWKMWRESRAGHVEKDL
                     EADEALEDRDLGQDGLIAEHAPRKTFGQAAWQIVVADVSMSLDNVLAVAGAAREHPVA
                     LIFGLGLSIALMGIAASFIARLLQKYHWIGYIGLAIILYVALDMIYRGFLEVWPVVSS
                     VVGSGIDLS"
     repeat_region   414620..415626
     gene            414734..414937
                     /locus_tag="MNOD_RS40390"
     CDS             414734..414937
                     /locus_tag="MNOD_RS40390"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043748781.1"
                     /db_xref="GI:760065929"
                     /translation="MGITTDSRLRQELRFLLAGLAHVGAFGEAKQGLAVELFVAAAVL
                     CRGSLILSQDHAVGRQDEECSSG"
     gene            complement(414968..415450)
                     /locus_tag="MNOD_RS40395"
                     /old_locus_tag="Mnod_8207"
     CDS             complement(414968..415450)
                     /locus_tag="MNOD_RS40395"
                     /old_locus_tag="Mnod_8207"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012322594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754107.1"
                     /db_xref="GI:760071300"
                     /translation="MSLQGSPGANGRGGEEPSEVAEPPEPADPLPAWTAKDIERWVII
                     PMRLLRESAVATRPGNALRSTDLEQPSASFDILAFAHTVLTDKDEFLALTTYARIRAA
                     GGDAEASIAEWCREKGWQERTFHRRRVRACERLAAAKNAASLAEGENRSGFGTRPARR
                     "
     gene            complement(415980..416855)
                     /locus_tag="MNOD_RS40400"
                     /old_locus_tag="Mnod_8209"
     CDS             complement(415980..416855)
                     /locus_tag="MNOD_RS40400"
                     /old_locus_tag="Mnod_8209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PadR family transcriptional regulator"
                     /protein_id="WP_012631380.1"
                     /db_xref="GI:501740406"
                     /translation="MPLDPVARFRRFSRAVTLEVGALDTSFLGRGRPLGAARVLNAIG
                     QGRSDVADLRDCLRLDSGLMSRLLRRLEDEGLVRIEPHPDDARRRMAILTDAGQREFQ
                     IYEDLSNAQASSILSKHPDQELLLSAMDIVASALGRDRIKLDEVDPRSDAARYCLQEY
                     YAELAQRFAKGFDVSLSRDPDAADMIRPRGTFVVALSDGLPLGCVGLKGTGGDTAEIK
                     RLWVSSCARGLGIARRLMAAAEDTARALSIKTLRLDTNSALPEAVRLYCQSGWVEIDR
                     FNDDPYPDRFFEKKL"
     gene            complement(417288..418190)
                     /locus_tag="MNOD_RS40405"
                     /old_locus_tag="Mnod_8210"
     CDS             complement(417288..418190)
                     /locus_tag="MNOD_RS40405"
                     /old_locus_tag="Mnod_8210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="WP_012631381.1"
                     /db_xref="GI:501740407"
                     /translation="MTVSEIDAIRHLLLAQPRPTDPAARRERMNSFGRRYALPADVSV
                     TAADAGGVPAEWTVTPGADPNRVLIFLHGGGYMAGSLDSHRHVVAQAGREAQARTLAL
                     DYRLTPEHPFPAALDDALAGYRFVIERGVAPRRIVLSGESAGGGLALATLLRLREAGE
                     PLPGCVWLSSPWVDLTLSGDSLITKAAVDPLIQKPYLAELARAYLNSADPHDPLISPL
                     YADLRGLPPMLIQVGSSETLLDDAVRLAGAAGGADVSVTLRIWPEMIHAWHLFYPQLA
                     AGRAALAEVGRFVDTCINYAGERR"
     gene            complement(418207..420158)
                     /locus_tag="MNOD_RS40410"
                     /old_locus_tag="Mnod_8211"
                     /pseudo
     CDS             complement(418207..420158)
                     /locus_tag="MNOD_RS40410"
                     /old_locus_tag="Mnod_8211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013652550.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="catalyzes the formation of catechol from phenol;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="phenol 2-monooxygenase"
     repeat_region   420399..420510
     gene            complement(420713..421594)
                     /locus_tag="MNOD_RS40415"
                     /old_locus_tag="Mnod_8212"
     CDS             complement(420713..421594)
                     /locus_tag="MNOD_RS40415"
                     /old_locus_tag="Mnod_8212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631383.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug DMT transporter permease"
                     /protein_id="WP_043754314.1"
                     /db_xref="GI:760071510"
                     /translation="MKAPLSARWIGFLCLAATALGWALNWPAMKFLLREWPPLFARGV
                     AGAAAAFLLTGVAVLYGESLKAPRHVIPRLLFAAFTNVFAWMGFSTLCMKWLDVGEGA
                     LLVYTMPIWATLLAWPILGSRPTRRGTGALLLGMAGVSVLLSARGFNLDTGKLLGIGF
                     AFSAAVLFALGTVLNCTPLPLPPITAVAWQVGLGCLPMILIGLVFERPNLGGLNSAGW
                     SVLAYMTLVPMGLCYLAWFATLRRLPPAVASTGMLLVPLIGVLSAAVILGEPLGPRQF
                     VSLALTLGGVTLALQTS"
     gene            complement(423839..424087)
                     /locus_tag="MNOD_RS40420"
                     /old_locus_tag="Mnod_8215"
     CDS             complement(423839..424087)
                     /locus_tag="MNOD_RS40420"
                     /old_locus_tag="Mnod_8215"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631385.1"
                     /db_xref="GI:501740411"
                     /translation="MFVRLLALPACAGLLAAVTPLQARPLIETYAPTACFTCGYNQRA
                     EPLVVSGPYGARESVRPSGRQRFTRFDIEALRLMTRMR"
     gene            complement(425473..425688)
                     /locus_tag="MNOD_RS40425"
                     /old_locus_tag="Mnod_8217"
     CDS             complement(425473..425688)
                     /locus_tag="MNOD_RS40425"
                     /old_locus_tag="Mnod_8217"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631387.1"
                     /db_xref="GI:501740413"
                     /translation="MLTAKDELLALKTYARIRAAGGDAEASIAEWCRLKGWQESTFHR
                     RRVRACEKLAVAKNAADRAQGRCAPEA"
     gene            complement(426138..426956)
                     /locus_tag="MNOD_RS40430"
                     /old_locus_tag="Mnod_8218"
     CDS             complement(426138..426956)
                     /locus_tag="MNOD_RS40430"
                     /old_locus_tag="Mnod_8218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011531291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783643.1"
                     /db_xref="GI:915398258"
                     /translation="MRLSAAIGRMEGPTLLRDVRLNGIVDALRDGRVRSTAELALQFG
                     VSEMTLRRDLDHLGRRGLVRRVHGGARAAAGADPGYHRRAEENAAAKHRVGQAAAQLV
                     TPGSCVYLDAGTTAREVGRAIAERARAEGLTARIVTHAVNIGAELAGIVGLSVHQLGG
                     EVDPGTLAATGPALVTELRGLNFDLYFMGVTGIDPERGMTNSTPVGLEVKRAAMSRAR
                     ETWVVADVSKWRQVSAYYIASMDAITGLVTDAAQNSRPHLEIERASLKLKVLSS"
     gene            427077..428489
                     /locus_tag="MNOD_RS40435"
                     /old_locus_tag="Mnod_8219"
     CDS             427077..428489
                     /locus_tag="MNOD_RS40435"
                     /old_locus_tag="Mnod_8219"
                     /EC_number="2.5.1.26"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017983584.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase domain-containing protein"
                     /protein_id="WP_012631389.1"
                     /db_xref="GI:501740415"
                     /translation="MTVTFSQALASSRPSLRISADAADRTAHARDWWPRAAKWTDEEL
                     DRHRPDAVVFATGEEDCIAVVAACRDTGTKLVTYGAGSGVVGAAVPDSGSVVIDMRGM
                     SRIVAFNATDGFVTVEPGCLGGELENWLNERGFTLGHYPQSLHLASIGGLISTRSTGT
                     FSNKYGGIEELVLALRVVGADGSVTAFRNTPRNSSGPALQQLFIGAEGTLGVITQATL
                     RVFPRAERRIFEGYQFPSVAAGVEAVRKAYAAHLRPAVLRLYDETEAANLYRRVGRDS
                     GPPLLIAGFEGLSGVAAAEQAAFAAIAKAEGGISLGPDIGNAWEAHRFDANWLTAGNE
                     GPRRMADAIEIALPWSTLAEAHAAITAEVAPYCATVMSHYSHFYSTGGALYVIVLLEG
                     ADTASVLEQYRQVWDRVMRKALAFGGSLAHHHGVGRQRAPFLPQELDGGHRLLQLVKA
                     ALDPEGILNPGKLALNGAVQ"
     gene            428522..429496
                     /locus_tag="MNOD_RS40440"
                     /old_locus_tag="Mnod_8220"
     CDS             428522..429496
                     /locus_tag="MNOD_RS40440"
                     /old_locus_tag="Mnod_8220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017380461.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783644.1"
                     /db_xref="GI:915398259"
                     /translation="MGDAAGIGPEIVVRALVEPEVREACHAIVIGDAGIMRDAVALTG
                     LPCEIRAVSSVAEAEFRDGTIDVLDLRNIARSDFEPGRISAACGRAFVEYIRRAARMA
                     LSGEIDAVASAPTNKEAMHAAGEIYPGQTEIFAEESRSTDPFTILTGGKMRVFLVSSH
                     VSLSQAIALVTQPRIELVIRKAVASLKELWGIDDPLIGVAGLNPHAGDGGLFGREEIE
                     HVIPVLERLRAEGIRIEGPGPADSVYDRADRGAYDGVIGMYHDQGVIPLKRYGYVTVI
                     SGTPIIRTTAGHGTAYDIAWKGIGRANVMQRAVVLAAELAASRAARAR"
     gene            429493..430692
                     /locus_tag="MNOD_RS40445"
                     /old_locus_tag="Mnod_8221"
     CDS             429493..430692
                     /locus_tag="MNOD_RS40445"
                     /old_locus_tag="Mnod_8221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019106430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Hrp-dependent type III effector protein"
                     /protein_id="WP_012631391.1"
                     /db_xref="GI:501740417"
                     /translation="MSIKVAVLADDLSGGNSVGAEFARQGLATLVARVSEVDAAVRYG
                     PEIIVVTTDTRNRSPEEADAITRDALTRAVTLQPAYLFKKLDSLLRGPIAVEAAATMA
                     AAGADSALVVTASPPTGRTTRAGRQLVDGRPLLDVIAALDPGASLATDEVGSFFLACG
                     RPLRHLDLDTVRAGEIKTGEWSGRITIADCETQSDLDRTVSAAIAADVRLFFGTYGMG
                     ASIARLLGRNAGMPVLVIAGSLSEATHRQVLALREEGECTLLSVDAPSTSEEARRALS
                     AGRDVVLCARPDTLGPSAARLLAPPTRAAASAMEERIARCAEPLLGLVSGLIVSGGST
                     ADTLLVLMGAHGLVLSGSELLPGVPVARILGGSHDGLRCVTKPGSFGTDDALCVARRF
                     VRDRRMS"
     gene            430843..432111
                     /locus_tag="MNOD_RS40450"
                     /old_locus_tag="Mnod_8222"
     CDS             430843..432111
                     /locus_tag="MNOD_RS40450"
                     /old_locus_tag="Mnod_8222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_012631392.1"
                     /db_xref="GI:501740418"
                     /translation="MRIRWAVLAITAGVLILNYADRSALGVAGASIIHEFNLTKTEFG
                     LISSIFFVGYAPFCFVGGWLADKYGPRAVMGAAVGWWSIFTGLTAAGAGYVSFLIIRL
                     LFGLGEGPQGSVTIKTMRNWFPQKQMGLAVGISQGSTPLGGLIGTPLVAGLIAYNGDW
                     RLPFIVLGVIGILMTIGWFVIVRDTPGQHPWAGQAEVDEMKADAAVVAQSPASPGGAP
                     HSVGYYIRQPHVLATSIAFFGYAWVLYTFLSWFPVYLVEARGVNIKEVAIVGALPWAL
                     GVLGYMLGGVLTDWIAARTGRPAAARRGVILVGLVGTAALLAGVGYVETITAAVLLMS
                     GVIFLLYLTGAQYFLMISDTIPGEKLGGVVGFVHLIANTSGILAPLIVGVIVDQTKSW
                     VLTFGLSAAICIVGVVAVGVWGRARSLTEA"
     gene            432327..432779
                     /locus_tag="MNOD_RS40455"
                     /old_locus_tag="Mnod_8223"
     CDS             432327..432779
                     /locus_tag="MNOD_RS40455"
                     /old_locus_tag="Mnod_8223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008117896.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC domain-containing protein dehydratase"
                     /protein_id="WP_012631393.1"
                     /db_xref="GI:501740419"
                     /translation="MPGWQTVERFFEDYTLGERDVERRRTIDQADINMFAGLTLDFHP
                     AHIDRTFADARYGGRLVHGVLTFALVTGLNVEYNMRAISYGYEKMRFPGPLRAGDTLV
                     ARSEVVDLKPHRRPEIGLVTKQYTGLNQDGATVFSCLHILAVDRRSAA"
     gene            432776..433966
                     /locus_tag="MNOD_RS40460"
     CDS             432776..433966
                     /locus_tag="MNOD_RS40460"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020576199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="WP_012631394.1"
                     /db_xref="GI:501740420"
                     /translation="MSTTEFLSEYRGKGPLRNVTVLDFTQMMMGPVATQLLGDLGAVV
                     IKVERPVNGEWERSYMPRGRRLHGESPYFLAMNRNKLAVTADLNDEADRSFLFDLVKS
                     CDVVVENFRPGVMDKLGFGYDDLVKHNPRLVYASGSGFGAEGPLVKRPGQDMLLQSMS
                     GLAANSGPGNGPPVPVAAPILDASTGFLLSFAIASAVLDARENGTPRQIEASLLGTSL
                     MIQCQEALVSMNTDLTWERSSSGIAAPWTDAPYGVYQTRDGFMAMSMTPRAKLAEIFA
                     LDPSLVACTDDEWFLRRDEINAILVEKLRTRTSDEWIAELTEKGMWVAPVQSVAEMVR
                     HPQVEANGYVEAIDAPGGKQVQAVGLPFRISGVHGANRLPVPTIGQHDAVVRQALAGR
                     KPQG"
     gene            434013..435170
                     /locus_tag="MNOD_RS40465"
                     /old_locus_tag="Mnod_8225"
     CDS             434013..435170
                     /locus_tag="MNOD_RS40465"
                     /old_locus_tag="Mnod_8225"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019533230.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783645.1"
                     /db_xref="GI:915398260"
                     /translation="MTWSHPRGLDPLVACVPPLRDRGVAVTWDARSLQGFEEASIQHL
                     ATQYDLIAIDHPFLGDAFRQGALHPVDGIVGEAFVDELRASSVGPSFQSYLWKDRLWA
                     IPVDAAAQVAAFRADLLADLGRAVPRSWAEVRALVDALPAGRSVAMPANPTHVLLAFG
                     TICHAVAADRSTQADLRPRWWRDDGFDPETARAALALLRSLLDALHPMSWDSDPIQIF
                     DHMVGNDDVVYTPIAFGYSNYARPSSYERPLGFCGVPSMDGAVIGGMLGGVGLCVSRQ
                     CRDLEAAAAVLRFVAASGTQRGLYTEAGGQPAHREAWIDERVNTICPNFFAPTLASLD
                     ASFVRPRLPGYPAFQREGGEVLHRLLRQGASDDEMIAAMNALWSEIRERDV"
     gene            435176..436723
                     /locus_tag="MNOD_RS40470"
                     /old_locus_tag="Mnod_8226"
     CDS             435176..436723
                     /locus_tag="MNOD_RS40470"
                     /old_locus_tag="Mnod_8226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011830271.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase/ligase"
                     /protein_id="WP_012631396.1"
                     /db_xref="GI:501740422"
                     /translation="MAEEAPGRPEASSHLETWAALLLAAHANFAGQVAVVRPEGAWSY
                     ADVLGAASRCAGRLSGLGVTRGARVVIALDNRPETVVIERALALWGFVRVALSPRLHP
                     EEIDFIAADCEAAVVICEAAVAGALRCEATVVSAEPHPAATLSLDALMAEATAPALPA
                     IGPDDLASLMYTSGTTGRPKGAMNTHRNWHAMATRMASILPPIGPGDVLLHVAPMSHF
                     SGSVASAYAANGAAIATLRRFDPARAVAVARQIGATCMPLVPTMVLDLIAGRDEGPLL
                     PSLKVLPYGGSSIAADALVRARAVLGDTLLQVYGMSEALIPVTALATTEHRAGDGERA
                     RLSSAGSPVPGAAVEVCAPPGEVGEIRVRGPNVMIGYWNNPDQTREVLDAEGWYASGD
                     LGRQDPSGRIEIVGRRRDVIITGGFNVYPAEVERVIAAVPGVAEAAVIGAPHARWIET
                     VVAVVVREAGAQVGADQLLAACRDHLAAYKKPTEIRFVPALPRISTGKVDKRRLRELY
                     LAGAYAP"
     gene            436919..437209
                     /locus_tag="MNOD_RS40475"
                     /old_locus_tag="Mnod_8228"
     CDS             436919..437209
                     /locus_tag="MNOD_RS40475"
                     /old_locus_tag="Mnod_8228"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631398.1"
                     /db_xref="GI:501740424"
                     /translation="MLVQGSAFERQLDFGDIAVSTAKAVMQEASETAQVGVLDGRSVL
                     YVAKADSIRRSYANGAGLTRAGAFPATTGAHIQRALNWVNELVLCNMQTAPA"
     gene            437383..438663
                     /locus_tag="MNOD_RS40480"
                     /old_locus_tag="Mnod_8229"
     CDS             437383..438663
                     /locus_tag="MNOD_RS40480"
                     /old_locus_tag="Mnod_8229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012631399.1"
                     /db_xref="GI:501740425"
                     /translation="MGRSELERLSKQELIELVLRLQRPEKTSRTSSKPPSTDRKERRE
                     QAKPGGAKPGHEGHSRTLSPDPDEIVAHRPGHCPCCGGVLAPDLPAEIVSVCEQIDLP
                     AVAPMVTQHQRLAVRCPACGTRVVAPVPQAARGTPFGPRLHAVAVYLKTFQALSYERL
                     QAALSDLFGLTLSQGGLMNLLRRAQRQFRADREAAVSALRRAAVVASDETGVRIEGSN
                     SYHWVFRSDAAVVHHAASTRAAAVVHAMMDGHRPSVWLSDRYTAQQGHGEHHQTCLAH
                     LARDVAYAVEVSDDPVPLRLQLWLGSVFSLAERVTDLAASTLSAKRRALDRQLSAILA
                     APSRCDLTRALQAKIGRARDQLLVFLDHPGRVAVTNNACERALRPAVVQRKVTNGYRA
                     MWAAAGEADVRTVVDTARLSGAGTFATILNIIRA"
     gene            439064..439264
                     /locus_tag="MNOD_RS40485"
                     /old_locus_tag="Mnod_8230"
     CDS             439064..439264
                     /locus_tag="MNOD_RS40485"
                     /old_locus_tag="Mnod_8230"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631400.1"
                     /db_xref="GI:501740426"
                     /translation="MKDPNLAEVLRQVEETITEWNRQAAELRRSTEELLRVEVTAERK
                     SARAIRCAWTPAPGRRRVAGGV"
     repeat_region   439369..440375
     gene            439483..439686
                     /locus_tag="MNOD_RS40490"
     CDS             439483..439686
                     /locus_tag="MNOD_RS40490"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043748781.1"
                     /db_xref="GI:760065929"
                     /translation="MGITTDSRLRQELRFLLAGLAHVGAFGEAKQGLAVELFVAAAVL
                     CRGSLILSQDHAVGRQDEECSSG"
     gene            complement(439717..440199)
                     /locus_tag="MNOD_RS40495"
                     /old_locus_tag="Mnod_8231"
     CDS             complement(439717..440199)
                     /locus_tag="MNOD_RS40495"
                     /old_locus_tag="Mnod_8231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012322594.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754107.1"
                     /db_xref="GI:760071300"
                     /translation="MSLQGSPGANGRGGEEPSEVAEPPEPADPLPAWTAKDIERWVII
                     PMRLLRESAVATRPGNALRSTDLEQPSASFDILAFAHTVLTDKDEFLALTTYARIRAA
                     GGDAEASIAEWCREKGWQERTFHRRRVRACERLAAAKNAASLAEGENRSGFGTRPARR
                     "
     gene            complement(440215..440667)
                     /locus_tag="MNOD_RS40500"
                     /old_locus_tag="Mnod_8232"
     CDS             complement(440215..440667)
                     /locus_tag="MNOD_RS40500"
                     /old_locus_tag="Mnod_8232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="WP_012631401.1"
                     /db_xref="GI:501740427"
                     /translation="MSDTTTSPLPTQDLVSLTAGIVGAYVAHTAVPPAELPDLIASVH
                     GALASLGQPSEPETPVLVPSVPIKRTVTPDAIISLEDGKPYKSLKRHLRTHGLTPERY
                     RAKWGLPLDYPMVAANYAAQRSELAKNSGLGRKGAAGRSGGRSQAKAR"
     gene            complement(440732..441340)
                     /locus_tag="MNOD_RS40505"
                     /old_locus_tag="Mnod_8233"
     CDS             complement(440732..441340)
                     /locus_tag="MNOD_RS40505"
                     /old_locus_tag="Mnod_8233"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631402.1"
                     /db_xref="GI:501740428"
                     /translation="MSAYPSLPLFTDAFIADTGHLSAAETGAYLMLLMVAWRSPGCSL
                     PVLATQAVGEGGRTLAKGLYLSVLARYPAWAIEQACNRFAQGFAGDRKFMPSPGDLAH
                     EVRRLIEPQVAERARLSRVLDAEVIPDPDPTMAEKARKAAADLAARLAMPGEERPTPE
                     AEAEAATNHLEQLKAQGLGGLKLSEATVAKMLGRPAQHAEPA"
     gene            complement(441337..441723)
                     /locus_tag="MNOD_RS40510"
     CDS             complement(441337..441723)
                     /locus_tag="MNOD_RS40510"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_020802560.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783646.1"
                     /db_xref="GI:915398261"
                     /translation="MACQGVRGNRKAPHQARLKNLLARATKEAGHLGDEVPPARMKRQ
                     GFYWSDEWRAVRYQALKLHGGACQCCGARGTKRAPLHVDHIKPRSRYPHLALEISNLQ
                     VLCEDCNLGKGASDDTDWRPAPARLQ"
     gene            complement(441789..442037)
                     /locus_tag="MNOD_RS40515"
                     /old_locus_tag="Mnod_8235"
     CDS             complement(441789..442037)
                     /locus_tag="MNOD_RS40515"
                     /old_locus_tag="Mnod_8235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631404.1"
                     /db_xref="GI:501740430"
                     /translation="MNAPSHPTIQQQIDEVLCCALSIEAAVRAWEQAPEKRRAVETGC
                     CRSKIEPLRAAVRTLELVRDNADEFRAAIIAKRGRDAA"
     gene            complement(442043..442978)
                     /locus_tag="MNOD_RS40520"
                     /old_locus_tag="Mnod_8236"
     CDS             complement(442043..442978)
                     /locus_tag="MNOD_RS40520"
                     /old_locus_tag="Mnod_8236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="WP_012631405.1"
                     /db_xref="GI:501740431"
                     /translation="MTANVFASHISQRFAAYHVDTVEFTKEMPDDCVDFSVYSPPFSS
                     LYIYSESERDMGNVGSDDEFQAHYRYLVKELFRITKPGRLTAIHVKDLVYYSNASERG
                     DRGIRDFTGACIRTHVQEGWSFHRRITIDRCPVREMQKTKSDRLLYKNFRTDAARTGG
                     GLPEYIVVFRKWADGMDAVPPVLHDPAEHPLESWQDLAQPIWMTSGIWYDTDETDVLN
                     VRVARDAEAEKHLCPMPLDLTERLVRQYTNPDETVYSPFMGIGSEGYQSLLQGRRFIG
                     TELKQSYYTQAVRYLTEAEQRGTTATLFTHMAAAE"
     gene            complement(442975..>443907)
                     /locus_tag="MNOD_RS40525"
                     /pseudo
     CDS             complement(442975..>443907)
                     /locus_tag="MNOD_RS40525"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018261908.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="helicase"
     gene            444258..444482
                     /locus_tag="MNOD_RS40530"
     CDS             444258..444482
                     /locus_tag="MNOD_RS40530"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_050783647.1"
                     /db_xref="GI:915398262"
                     /translation="MLCTDCHTAKTKRDRAHIDKAKRQADAHNGIRDPHARPLAGGRP
                     MPAGRPAHRATTPLVKSLPPRRSLYVSEHR"
     gene            444482..444895
                     /locus_tag="MNOD_RS40535"
                     /old_locus_tag="Mnod_8239"
     CDS             444482..444895
                     /locus_tag="MNOD_RS40535"
                     /old_locus_tag="Mnod_8239"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631406.1"
                     /db_xref="GI:501740432"
                     /translation="MRYRWPHTLRGWKTLFWLWLGRCPIHHTRLSVEAARQGQLTVAE
                     HKKLVAATEAAFAALRTEHQEVLCDLGDRVDEIVRLREALKPFVEYARYALIAGMEGE
                     IGEVIVVGFRRSISTQALRRTVEAYGEPPETSDAR"
     gene            445156..445701
                     /locus_tag="MNOD_RS40540"
     CDS             445156..445701
                     /locus_tag="MNOD_RS40540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_017484710.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_043754111.1"
                     /db_xref="GI:760071304"
                     /translation="MPDLERKLGERVLVGATYFETDFRNLIQTAYLPTYATNVNVGRA
                     VAYGAESFVSVKLTDTLSARVDYTNTVTKDEVANQELLRRPRHKVSLTGIWTPLPNLT
                     LTGTLISIGSFVDGNRDFSVTRLKNPSLTLVNLSANYACSETTTLFARIDNLFDQRYQ
                     NPTGFLGPGLAVYGGVRLTSF"
     gene            445710..446557
                     /locus_tag="MNOD_RS40545"
                     /pseudo
     CDS             445710..446557
                     /locus_tag="MNOD_RS40545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012455645.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
     gene            446554..447600
                     /locus_tag="MNOD_RS40550"
                     /old_locus_tag="Mnod_8244"
     CDS             446554..447600
                     /locus_tag="MNOD_RS40550"
                     /old_locus_tag="Mnod_8244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_012631407.1"
                     /db_xref="GI:501740433"
                     /translation="MNAAVPTLARSASRRFGTSAAGRTVVVLLAVTVVALTLASIAIG
                     YAPFDVQAAFADLLAGRTTLPALVLWELRIPRALLGGVVGFSLGLTGAVMQGYLRNPL
                     ADPGILGISSAAALGAVVVFYGGFAASLSLALPLGGIAGAAGAALLLNLLAARGSSTL
                     GLILAGVGLSSLAGALTALALNLSPNPYAALEIVFWLMGSLADRSMDHVLLCLPLMAI
                     GWGLMLSTASALDALALGEDTAASLGVGLVSARLRLVTGAALAVGSGVAVSGAIGFVG
                     LVVPHLMRPLVGARPGACLWPSGLAGAALVLSADIGVRLLATRPELKLGVVTALVGAP
                     FLIVLLLRNRGSRA"
     gene            447597..448412
                     /locus_tag="MNOD_RS40555"
                     /old_locus_tag="Mnod_8245"
     CDS             447597..448412
                     /locus_tag="MNOD_RS40555"
                     /old_locus_tag="Mnod_8245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_012631408.1"
                     /db_xref="GI:501740434"
                     /translation="MSLAARDIRVTLDGRTVLSDVSIALERGRFVGLVGPNGAGKTTL
                     LRVLAALVAPTEGSVTLEGRSTSGMCRDERARRVAALFQGAGVGWPMTVREIVALGRL
                     PHRRAFAPLTDADEVAIARAMVRTDVEHLADRPEPTLSSGERMRALLARALAVEAEWL
                     LADEPVTALDPAHQLDAMALLRAVARDGAGVVAVLHDLGLAARFCDRIVVLKGGRLVA
                     DGHPEEALTDALLAEVFGVTARRGRAPDGTRYILPWARSGAVKEESDGAIIPP"
     gene            448390..449355
                     /locus_tag="MNOD_RS40560"
                     /old_locus_tag="Mnod_8246"
     CDS             448390..449355
                     /locus_tag="MNOD_RS40560"
                     /old_locus_tag="Mnod_8246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012631409.1"
                     /db_xref="GI:501740435"
                     /translation="MAQSSRHEEVAALLREALADPGTAWSLGSFGAIAEFMRDPDEPV
                     MALPDERMGMATTRGAIALTACPDLRPVAYETAVASGWNHAVALCLPEDACAMSRRGV
                     VTELGPDRNAAREQDRDGVLFDLGLDLLAVDACVRTRDPDAIACLRAGAGRPLFDPGN
                     PIGPHLVAMSPHRVFLARIGRVEVYAPIPGPGGTSPEGPHTHVLPKLLRSGRTHAATT
                     PIPTGWVPCAGIHPAHPYKDMMGQRIAFDASRHEAFQVLLDRWGDPELLAIKRGAAPT
                     SAGTVSIRHVQAVRRVAEAQARYLRGETIEAGTGEDEDEATDVHA"
     gene            complement(449618..450523)
                     /locus_tag="MNOD_RS40565"
                     /old_locus_tag="Mnod_8248"
     CDS             complement(449618..450523)
                     /locus_tag="MNOD_RS40565"
                     /old_locus_tag="Mnod_8248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="WP_012631411.1"
                     /db_xref="GI:501740437"
                     /translation="MRNLTDLYYFAKVAEHGGFSAASRVLDQPKSTLSRRIAALERDL
                     GVRLIQRTNNRFALTEIGSAYVAHCQAMIAEAQAAQQVVENWRAEPTGTLRVSCPIAL
                     AQARVSEIVARFMIAHPGVSVRFIATNRTVDLIEEGIDVALRVRFPPLEESDLVMRVL
                     SDSTQAIVGAPALLDRLGRPSAPEALAGMDALDLIRQDRNHVWHLTHQDGRSVAIPFA
                     PRLVSDDMLTLRQAAREGVGVVRLPTYLVQAALDKGDLEAVLPAWTPRSGIIHAVLPS
                     RRGLARATRLFVDSLVEGFRQPARR"
     gene            450631..451230
                     /locus_tag="MNOD_RS40570"
                     /old_locus_tag="Mnod_8249"
     CDS             450631..451230
                     /locus_tag="MNOD_RS40570"
                     /old_locus_tag="Mnod_8249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631412.1"
                     /note="catalyzes the transfer of electrons from NADH to
                     ubiquinone; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H quinone oxidoreductase"
                     /protein_id="WP_012631412.1"
                     /db_xref="GI:501740438"
                     /translation="MPKVLVLYHSAYGHVEAMAQAVAAGAREAGATVALRRVPETVPD
                     AVARQAGYKLDQAAPLASVEELPDYDAIIIGCGTRYGRVSAQMANFLDQTGGLWARGA
                     LNGRVGAAFTATATQHGGQETTLFSLITNLLHLGLVVVGLPYSFQGQLGIEAVSGASP
                     YGATTITGGDGSRWPSATEIEGAHFQGRLVAETAARLFG"
     gene            451264..452370
                     /locus_tag="MNOD_RS40575"
                     /old_locus_tag="Mnod_8250"
     CDS             451264..452370
                     /locus_tag="MNOD_RS40575"
                     /old_locus_tag="Mnod_8250"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015459390.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MexH family multidrug efflux RND transporter
                     periplasmic adaptor subunit"
                     /protein_id="WP_012631413.1"
                     /db_xref="GI:501740439"
                     /translation="MRRTSRILLGLAVATPGALLLAGTGGAPARPDPDQPVKPLAVET
                     SRVSDTPLGRGVTAVASLRAVQQVTLSPEVDGRVVAIHFQEGARVEAGAPILDLFRDP
                     QQAELNRSRAEETLARLQLDRARALLQREATAQAEVDRRQAGLDQAVAQRQAAEAALA
                     QRVVRAPFAGELGLRRTDPGHYLRAGDPIVTLTALDALYVDFAVPQRYLADLREGQAV
                     EVASDAAGGRTVLARLDTIEPQIDPGTRNIRLRARLDNRDRSLRPGASVTATLRFAPE
                     RGVVTVPETAIVASAATDTAFVVRDLDADGHGHVAQVSVTTGRRSEGRIVVSAGLEPG
                     EVVVTAGQLRLSPGQPVRLEARHAASAAPEPALR"
     gene            452383..455448
                     /locus_tag="MNOD_RS40580"
                     /old_locus_tag="Mnod_8251"
     CDS             452383..455448
                     /locus_tag="MNOD_RS40580"
                     /old_locus_tag="Mnod_8251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012631414.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavine resistance protein B"
                     /protein_id="WP_012631414.1"
                     /db_xref="GI:501740440"
                     /translation="MAFTDLFVRRPTLAIVVSLMVLLGGTFALLALPVRQYPKLQSAA
                     ITVETRYPGAAQGLMQGFVTVPLSQAIATADGIEYLSSISSDGRSLIKARLRLDADPD
                     RSLAEIMAKVQQTKYRLPEEAYDPVIEKVTDDPTAVMYVALMSETLPIPEITDYAVRA
                     VQPLFASVKGVASAQIMGGRNLSLRVWLDPDRLAAHGLTAAEVGQALTRNNVQIAAGQ
                     VKGSFTAAAITADTDAQDPEAFRRLVLRDGDPQVRLEDVARIAFGGQDYEESALINGR
                     PAVVVAVNGTPDANPLDIVRAVTALLPQLERSKPPGLDISNVFDVARFVQAALTEVEH
                     TLVEAAIVVVIVIFLFLGSWRAVLIPMVTIPLSLVGAAALMLVAGFSLNLLTLLAMVL
                     AIGLVVDDAIVVVENVHRHIEEGASPFEASLRGAREVVGPVIGMTVTLAAVYAPIGLI
                     GGITGSLFREFAFTLAGAVLVSGVVALCVSPMMSSLLLQPQSQHGGFARRIEQAFARL
                     AEAYAVMLRASLRHRALMTAFAVAALAGTVALYLAAEREFAPTEDQGTVMEVAKAPRY
                     ANLDYTERYSVRLEAAFRRLPEADTTWVLNGSSQTEPGPHSVFAGVNLVPWDRRSRSA
                     AAIMAELQADGAQNPGLSVIAFLLPALPTAPGLPVQMVVRGPVPYDQLYAVKERIVAA
                     ARASGLFAVVDSDLTWDKPGIALSVDRARAGKLGLSMRDVAATLATLVGEKYVNRFEF
                     RGRSYDVIPQVERRFRADGAGLERFYVRARSGELVPLGTVIATAPRAEPNQLGQHDQM
                     NAVTISAVPAPGTTMGQAVAFLQRQAEDLPPGMGTAWLGQSRQFVTEGHRLTVAFGLA
                     LAVIFLVLAAQFNSFRDPFVILVSVPLSIFGALLPLWLGYTTLNIFTQIGLVTLVGLI
                     AKHGILMTAFANELQERDGLDRAAAIVEAARIRLRPILMTTAAMVVGLVPLIFASGAG
                     AASRFAIGAVVVAGLLVGTAFTLIVLPTIYTLLARDHRRGTVAGLAQAG"
     gene            456058..457248
                     /locus_tag="MNOD_RS40585"
                     /old_locus_tag="Mnod_8252"
     CDS             456058..457248
                     /locus_tag="MNOD_RS40585"
                     /old_locus_tag="Mnod_8252"
                     /EC_number="2.3.3.10"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004139619.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /protein_id="WP_012631415.1"
                     /db_xref="GI:501740441"
                     /translation="MTGVGIDDISIYTPEYYYSLHDLVIAHGIDPNKYLVGIGQERMA
                     VPPPDEDVVSMAANAVAPLLTRQLRDTVSTVIFATESGIDQSKSAGLFVHGLLGLNPH
                     CRVVEFKQACYSATAGIQLAADLVRQRPMEKVLVIASDIARYERGSEGECTQGAGAVA
                     MVISANPRLLELHPVSGLYSVDVMDFWRPNHRSTACVDGKLSIDVYLRSLAEAWADYR
                     RKGGLPLGAVDKLCFHQPFTRMAKKAFAALSEAAGSEAAHLDESCYADSQIYGRAIGN
                     TYSASLYIGLCSLLDRCGEDLGGRTIGLFSYGSGAVGEFFTATVKPQYRRHLRAEAHR
                     AMLDSRRRLDGRTYAAWFYDAPSQAEDRVFPQESRGRFRLAAIEGQRRIYAAASSEPA
                     RAAA"
     gene            457253..458068
                     /locus_tag="MNOD_RS40590"
                     /old_locus_tag="Mnod_8253"
     CDS             457253..458068
                     /locus_tag="MNOD_RS40590"
                     /old_locus_tag="Mnod_8253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007158526.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/isomerase"
                     /protein_id="WP_012631416.1"
                     /db_xref="GI:501740442"
                     /translation="MDQSVVVHRRALPGGAPVAEIRLMRPERGNALDEDMLGRIARIA
                     QDLAGEEALRAVLLTGEGRHFCAGADLGWMRRAAELSGAENLRDAAHLDRALGSLAAL
                     PVPLIAVVQGCCYGGGLGLISCADVALAEASATFRFSEPRLGLVPAVISPFVVRAIGL
                     RRARRRFLTAEPFGADEAWADGLVHEVLPAPAMQGRIEALVAAIAACGPQALRQCKAL
                     LARLERHDGLADETDHARALIARMRTTPEAQEGMAAFLAKRPPAWAAASPDAD"
CONTIG      join(CP001351.1:1..458070)
//
DBGET integrated database retrieval system