GenomeNet

Database: RefSeq
Entry: NC_011887
LinkDB: NC_011887
Original site: NC_011887 
LOCUS       NC_011887             458070 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Methylobacterium nodulans ORS 2060 plasmid pMNOD02, complete
            sequence.
ACCESSION   NC_011887
VERSION     NC_011887.1  GI:220914669
DBLINK      Project: 59023
            BioProject: PRJNA59023
KEYWORDS    RefSeq.
SOURCE      Methylobacterium nodulans ORS 2060
  ORGANISM  Methylobacterium nodulans ORS 2060
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Methylobacteriaceae; Methylobacterium.
REFERENCE   1  (bases 1 to 458070)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E.,
            Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T.,
            Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Ivanova,N., Marx,C.J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Complete sequence of plasmid2 of Methylobacterium nodulans ORS 2060
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 458070)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (12-JAN-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 458070)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Glavina del Rio,T., Dalin,E.,
            Tice,H., Bruce,D., Goodwin,L., Pitluck,S., Sims,D., Brettin,T.,
            Detter,J.C., Han,C., Larimer,F., Land,M., Hauser,L., Kyrpides,N.,
            Ivanova,N., Marx,C.J. and Richardson,P.
  CONSRTM   US DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (06-JAN-2009) US DOE Joint Genome Institute, 2800
            Mitchell Drive B100, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP001351.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4003783
            Source DNA and bacteria available from Christopher J. Marx
            (cmarx@oeb.harvard.edu)
            Contacts: Christopher J. Marx (cmarx@oeb.harvard.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Annotation done by JGI-ORNL and JGI-PGF
            Finishing done by JGI-LANL
            Finished microbial genomes have been curated to close all gaps with
            greater than 98% coverage of at least two independent clones. Each
            base pair has a minimum q (quality) value of 30 and the total error
            rate is less than one per 50000.
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. it is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..458070
                     /organism="Methylobacterium nodulans ORS 2060"
                     /mol_type="genomic DNA"
                     /strain="ORS 2060"
                     /db_xref="taxon:460265"
                     /plasmid="pMNOD02"
     gene            37..2001
                     /locus_tag="Mnod_7772"
                     /db_xref="GeneID:7295469"
     CDS             37..2001
                     /locus_tag="Mnod_7772"
                     /EC_number="6.3.5.4"
                     /inference="protein motif:TFAM:TIGR01536"
                     /note="TIGRFAM: asparagine synthase
                     (glutamine-hydrolyzing);
                     PFAM: glutamine amidotransferase class-II; asparagine
                     synthase;
                     KEGG: sus:Acid_5610 asparagine synthase
                     (glutamine-hydrolyzing)"
                     /codon_start=1
                     /transl_table=11
                     /product="asparagine synthase"
                     /protein_id="YP_002489978.1"
                     /db_xref="GI:220914670"
                     /db_xref="InterPro:IPR000454"
                     /db_xref="InterPro:IPR000583"
                     /db_xref="InterPro:IPR001962"
                     /db_xref="InterPro:IPR006426"
                     /db_xref="GeneID:7295469"
                     /translation="MCGFLAVFHGGPRPLAPSTILAGLSAIRHRGPDERDIWLDPEAG
                     VALGHTRLSIIGLSNGRQPIASQDGALQLIVNGEFYDFERIRAELQARGCVFRTQSDS
                     EIALHLYREFGTAGLGRLRGEFALVLYDAVERQLVVMRDRFGIKPLFVAEHDGALWVG
                     SEIKALVAAGVPAFWDLDAYVSRGFYLGNRTLFQGIRSLAPGHLLIASPGHIRERAYW
                     DLDFPAAAALDSAAIDEAEAVEGLRAEILEAVGLRLRADVPIAVYLSGGIDSSAMLGC
                     ATRLRGTPLDAFTLSFTDDGDYDERRFAAEAASFNGARFHPIPVTQDDLADDFEEALW
                     HNEVPFFNAHGVAKYRLSRVVAQARFKVVITGEGADEIFAGYPHFRRDMLLYNAERQD
                     PGLVADLRARLARSEGGYGGTTLPADAAWMTDRLGHGVSWVGNQSAWFDALRALYDGP
                     TRRRSAGIGAYRRFYNGLDHARMAGRDPLHRSMYLWAKSFLPNFVLTTLGDRMEMANS
                     IEGRVPLLDHHVAEYAARLPVWLKIRGATEKHVFREAMRPFLPEALYRRKKHYFRAPP
                     AMSAQRNRLAQLVADTLASRHLEDLPFFDARAVRKAHAEAAALPPERQALLDPMFTEI
                     TSLCLMQRRFGLATHPATLSPEASVREAAA"
     misc_feature    40..693
                     /locus_tag="Mnod_7772"
                     /note="Glutamine amidotransferases class-II (GATase)
                     asparagine synthase_B type.  Asparagine synthetase B
                     catalyses the ATP-dependent conversion of aspartate to
                     asparagine. This enzyme is a homodimer, with each monomer
                     composed of a  glutaminase domain and a...; Region: AsnB;
                     cd00712"
                     /db_xref="CDD:238364"
     misc_feature    order(40..42,187..189,262..270,337..339)
                     /locus_tag="Mnod_7772"
                     /note="active site"
                     /db_xref="CDD:238364"
     misc_feature    order(85..87,109..111,118..120,127..141,184..186)
                     /locus_tag="Mnod_7772"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238364"
     misc_feature    91..1722
                     /locus_tag="Mnod_7772"
                     /note="asparagine synthase (glutamine-hydrolyzing);
                     Region: asn_synth_AEB; TIGR01536"
                     /db_xref="CDD:233454"
     misc_feature    763..1731
                     /locus_tag="Mnod_7772"
                     /note="The C-terminal domain of Asparagine Synthase B.
                     This domain is always found associated n-terminal
                     amidotransferase domain. Family members that contain this
                     domain catalyse the conversion of aspartate to asparagine.
                     Asparagine synthetase B  catalyzes the...; Region:
                     Asn_Synthase_B_C; cd01991"
                     /db_xref="CDD:238949"
     misc_feature    order(823..831,904..912,1087..1089,1129..1137)
                     /locus_tag="Mnod_7772"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238949"
     misc_feature    order(823..831,904..912,1087..1089,1129..1137)
                     /locus_tag="Mnod_7772"
                     /note="Molecular Tunnel; other site"
                     /db_xref="CDD:238949"
     gene            1998..3122
                     /locus_tag="Mnod_7773"
                     /db_xref="GeneID:7295723"
     CDS             1998..3122
                     /locus_tag="Mnod_7773"
                     /inference="protein motif:PFAM:PF01494"
                     /note="PFAM: monooxygenase FAD-binding; FAD dependent
                     oxidoreductase;
                     KEGG: rrs:RoseRS_4211 monooxygenase, FAD-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase FAD-binding"
                     /protein_id="YP_002489979.1"
                     /db_xref="GI:220914671"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:7295723"
                     /translation="MKIGIVGAGLNGLAFALLLKRFGLKAEIFERGDGPRDAGSGIYL
                     WPQGVQVLRFMIGDDRVLAAGQPIEYLDTHDRGGRLIHRQPVRLEGFEFPAPAVMFHR
                     TRLFRLLREALDADAVAYNSACTGIEQDADGVTAHFADGRSRRFDLLVGADGVFSGVR
                     GCIAPEAVATDTGVAACRGIVTFSDPALHGDRCQIFSYDGARVVTYPLDVRQGLRYWF
                     YAYRHGGRPLLGKAAIMAQVSGLAEPLPAMIAATGPDAMISNRLHRVDGLDAWHRGRV
                     VLLGDSAHAMLPTLGYGFTLGLENGFALAQALLCNCDATLESGLRRFDRRVRLRSREM
                     VAVMSDLTDLFYFQKEGAVTRDSLQAHMARFRTLAETTLF"
     misc_feature    1998..2921
                     /locus_tag="Mnod_7773"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    2010..2921
                     /locus_tag="Mnod_7773"
                     /note="geranylgeranyl reductase family; Region: GG-red-SF;
                     TIGR02032"
                     /db_xref="CDD:233693"
     misc_feature    <2814..3032
                     /locus_tag="Mnod_7773"
                     /note="Squalene epoxidase; Region: SE; cl17314"
                     /db_xref="CDD:266623"
     gene            3122..4210
                     /locus_tag="Mnod_7774"
                     /db_xref="GeneID:7295724"
     CDS             3122..4210
                     /locus_tag="Mnod_7774"
                     /inference="protein motif:PFAM:PF00441"
                     /note="PFAM: acyl-CoA dehydrogenase domain protein;
                     KEGG: hch:HCH_01061 acyl-CoA dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_002489980.1"
                     /db_xref="GI:220914672"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="GeneID:7295724"
                     /translation="MSDDAYRHAVRAFVAARIAPAIEEWERAGAYPASLHAEAGAAGL
                     LAFGEPPGPAPVEHPARRRILIEEITRGGSQGLTMGLASHGVSLAILAQADPDWAGPV
                     IRTVQSGERTIALALTEPQAGSDLAALRARAEPVADGWTITGEKRFICNGTRADCLVV
                     GAVTEAGLGLFLVERPQPGLTAEPLAAAGWRCLPLAALRFAGVPARLVVAPDRAARVL
                     QRALAQERLNLAVMALASAECVRDAALHHARTRMVRGASLDAMSHIRQRLAEIATRIA
                     LARCFVDSTAATAEASRIAMAKNAAVAALEEAARTAVQILGAAGCVAPSVVERTQRDA
                     PLIAIGGGTTEVMNEIIARSLAKETPAP"
     misc_feature    3122..4207
                     /locus_tag="Mnod_7774"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    3131..4186
                     /locus_tag="Mnod_7774"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(3374..3376,3464..3466,3470..3472,3563..3565,
                     3569..3571,4133..4141,4145..4147,4151..4153)
                     /locus_tag="Mnod_7774"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            4207..4665
                     /locus_tag="Mnod_7775"
                     /db_xref="GeneID:7295725"
     CDS             4207..4665
                     /locus_tag="Mnod_7775"
                     /inference="protein motif:PFAM:PF03061"
                     /note="PFAM: thioesterase superfamily protein;
                     KEGG: dol:Dole_0759 thioesterase superfamily protein"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase superfamily protein"
                     /protein_id="YP_002489981.1"
                     /db_xref="GI:220914673"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="GeneID:7295725"
                     /translation="MTTIPDHALRHSRALLDHVFQRQCGLTLVEQEPGRCLCRLTVTP
                     AIDNLSHCLHGGVTYAMLDVTSMLATLPLLGPDEYAVSTSMAVSILTAVPRNTEAEFE
                     SQVVRAGRTMIFTSCRAVRIGQDGRRTVFATGQITKARLRQDIRALTRAA"
     misc_feature    4279..4626
                     /locus_tag="Mnod_7775"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    order(4363..4365,4450..4452,4471..4482)
                     /locus_tag="Mnod_7775"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(4366..4368,4372..4374,4381..4383,4453..4467,
                     4471..4473)
                     /locus_tag="Mnod_7775"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(4369..4371,4393..4398,4405..4410,4450..4452)
                     /locus_tag="Mnod_7775"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            4956..5936
                     /locus_tag="Mnod_7776"
                     /db_xref="GeneID:7295726"
     CDS             4956..5936
                     /locus_tag="Mnod_7776"
                     /inference="protein motif:PFAM:PF01548"
                     /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
                     IS116/IS110/IS902 family protein;
                     KEGG: gdi:GDI1409  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS111A/IS1328/IS1533"
                     /protein_id="YP_002489982.1"
                     /db_xref="GI:220914674"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /db_xref="GeneID:7295726"
                     /translation="MQGKEVSKQETAGKSSVGIDVSKSWLDVHVLPSGQAQRFANTEV
                     GIRQLKRWLGRFALGLVVVEATGKWHRQTRRSLHASGLPVAVVDPFRVRMFAKAQGIW
                     AKTDRLDARVLAQFAAVMAPPQRPPASDALEALQELVAARDSAVAEQTALKNQLAAAA
                     SPFLIRQFQDRLARIAADIEALAGEIRRLIAADPGLARRHAILVSIPSIGDTIAATLV
                     ASLAELGTCSSRQIGLLAGLAPVADDSGARQGVRVIWGGRPPVRRVLYLAALSAARHN
                     AGLKAFHERLIANGKKPKCAIIAVARKLAVLANSLIAQDRLWTPNQPQQA"
     misc_feature    5004..5879
                     /locus_tag="Mnod_7776"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    5004..5420
                     /locus_tag="Mnod_7776"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    <5361..5576
                     /locus_tag="Mnod_7776"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    5556..5807
                     /locus_tag="Mnod_7776"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(6128..7060)
                     /locus_tag="Mnod_7777"
                     /db_xref="GeneID:7295727"
     CDS             complement(6128..7060)
                     /locus_tag="Mnod_7777"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: regulatory protein LysR; LysR
                     substrate-binding;
                     KEGG: abo:ABO_0028 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="YP_002489983.1"
                     /db_xref="GI:220914675"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:7295727"
                     /translation="MTKITLEQWRMFVATAQQGSFLQAAEKLGKTQSAISHAIRKMEE
                     TLGQELFAIEGRRARLTTVGEMIYPRARELIGHAAQIERLCVSFDPEAEGEISIAVDV
                     IFPMQLLHRALEEYEKLYPHFSVRVWETTLSGASEILEDGRAVIGIAGQLPPGTVMEP
                     LLKVSFLCVAVADHPLHREGDLTHAMLKEHRQIVLSDSGRRNLSSGWLGARKRWTVGH
                     LATSVALVRAGQGYAWLPEHSIGADIAAGTIRPLRLHSGGRRTVQLHLGYTEIGQNLR
                     QALDLLGVFRDTVADHAPLATQAGFDVPPAAVAG"
     misc_feature    complement(6179..7051)
                     /locus_tag="Mnod_7777"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(6866..7045)
                     /locus_tag="Mnod_7777"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(6263..6778)
                     /locus_tag="Mnod_7777"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(6377..6382,6386..6391,6407..6424,
                     6674..6694,6698..6700,6710..6712,6719..6724,6728..6733))
                     /locus_tag="Mnod_7777"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            7278..7925
                     /locus_tag="Mnod_7778"
                     /db_xref="GeneID:7295728"
     CDS             7278..7925
                     /locus_tag="Mnod_7778"
                     /inference="protein motif:PFAM:PF01323"
                     /note="PFAM: DSBA oxidoreductase;
                     KEGG: sml:Smlt2924  thioredoxin DsbA family"
                     /codon_start=1
                     /transl_table=11
                     /product="DSBA oxidoreductase"
                     /protein_id="YP_002489984.1"
                     /db_xref="GI:220914676"
                     /db_xref="InterPro:IPR001853"
                     /db_xref="InterPro:IPR006662"
                     /db_xref="GeneID:7295728"
                     /translation="MDRIRIEFFHDVVCGWCFVLSPRLKRIAADLPVDIEHRCFVLQD
                     SPAEMERVFGSLPRAKEVILGHWVQCAAADDIPGRINIEGMRRQSFAYPSGLAGTLAC
                     KSAERQGGSTAHGALFDRIQAAHLTENRNIADPRVLTDCAAAVGLDMARFEADMADPA
                     TRELVEQDRARARALAIRSIPSLVIGQRVISSTLPYHELRRRILACAASTPSVAC"
     misc_feature    7278..7922
                     /locus_tag="Mnod_7778"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(8033..8221)
                     /locus_tag="Mnod_7779"
                     /pseudo
                     /db_xref="GeneID:7295729"
     gene            8493..9125
                     /locus_tag="Mnod_7780"
                     /pseudo
                     /db_xref="GeneID:7295730"
     gene            9409..10266
                     /locus_tag="Mnod_7781"
                     /db_xref="GeneID:7295731"
     CDS             9409..10266
                     /locus_tag="Mnod_7781"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase;
                     KEGG: met:M446_4269 GCN5-related N-acetyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_002489985.1"
                     /db_xref="GI:220914677"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="GeneID:7295731"
                     /translation="MTQDASGKLTIRVMKRHDLGLAIDWAAAEGWNPGLKDADCFKAV
                     DPTGFLVGCLGDEPIASISVVRYSSTFGFLGFYIVRPDQRGRGFGYRLWRAGIAYLED
                     RTVGLDGVVAQQDNYARSGFVLAHRNVRFGGSPQVEAPHDERLKLVGPDLIEAVLAYD
                     RPFFAAPRETFLRCWLKPDTRTAVAFVEDGTVKGYGVIRACRSGYKIGPLFADSERGA
                     DLLFQALASQAKGSLVFLDLPEPNQAAVQLAASYGLSPVFETARMYRGERPDLPLART
                     YGISTFELG"
     misc_feature    9553..9717
                     /locus_tag="Mnod_7781"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(9637..9645,9673..9678)
                     /locus_tag="Mnod_7781"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(10379..11383)
                     /locus_tag="Mnod_7782"
                     /db_xref="GeneID:7295732"
     CDS             complement(10379..11383)
                     /locus_tag="Mnod_7782"
                     /inference="protein motif:PFAM:PF01636"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: rec:RHECIAT_CH0002311  aminoglycoside
                     phosphotransferase protein (antibiotic resistance
                     protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_002489986.1"
                     /db_xref="GI:220914678"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="GeneID:7295732"
                     /translation="MNAPEPLLADFLRRMRLAPPGEEGCWIPLSGGVSSDIWRVDIAG
                     RSLCVKRALARLKVAAEWTAPIERNAYEWAYLEVANEIAPGHVPQPIAQDPEHGLFAM
                     AWLAPDRHRLWKAELLSGQVNSSDAAAVGDLVGRIHAATADDPRLRAIFATDANFHAI
                     RIEPYLLATARAHPDLADHIGAVASTTAATKRVLVHGDVSPKNILLGPDGPILLDAEC
                     AWFGDPAFDLAFCLNHLIAKAHVVSSACAELSRSFDVLVETYLRQVSWEPPSEVERRA
                     AQLLPCLLLARVDGKSPLEYLNDKQRGILRTNARHGIIEERTTLCDVKRLLLERPVQS
                     "
     misc_feature    complement(10679..11308)
                     /locus_tag="Mnod_7782"
                     /note="Phosphotransferase enzyme family; Region: APH;
                     pfam01636"
                     /db_xref="CDD:250760"
     misc_feature    complement(<10673..11254)
                     /locus_tag="Mnod_7782"
                     /note="Predicted kinase [General function prediction
                     only]; Region: COG4857; cl17281"
                     /db_xref="CDD:247835"
     gene            complement(11380..12660)
                     /locus_tag="Mnod_7783"
                     /db_xref="GeneID:7295733"
     CDS             complement(11380..12660)
                     /locus_tag="Mnod_7783"
                     /EC_number="4.2.1.11"
                     /inference="protein motif:PFAM:PF00113"
                     /note="PFAM: enolase;
                     KEGG: ttj:TTHA0002 enolase (2-phosphoglycerate
                     dehydratase)"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="YP_002489987.1"
                     /db_xref="GI:220914679"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="GeneID:7295733"
                     /translation="MTCTRLRRLHARQILDSRGRPTVEAEISLDNGIQVRASVPSGAS
                     TGKAEAVELRDGGEAWGGLGVSRAVSNIRGEIAALLEGCDVLDQVGLDNRIREADGTH
                     NLARFGANATLAVSIAAVRASAVATGIPLHRRLAELCGTTPSMPMPMVNILSGGLHAG
                     RGMDVQDFLVIPIGASSYSEALDWICRVRTAAASICAKRGISTLLADEGGLSPGFATS
                     EEALSLMVEAFEQAGLEPGVQAAIALDVASSSLASANGAYAFARQGRSFGAREMIELQ
                     RQWAASFPIVSIEDGLGEDDWANWPALTRALGHLQLVGDDLFATQPDRIRRGIDENIA
                     NAALIKVNQNGTLSGTLEAITTARAAGYATVISARSGETEDDFLADLAVGVAGRQIKV
                     GSVRNSERLAKYNQLLRLEEEGLAWSGRTGLAPL"
     misc_feature    complement(11422..12633)
                     /locus_tag="Mnod_7783"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    complement(11422..12633)
                     /locus_tag="Mnod_7783"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    complement(order(11425..11427,11434..11439,11446..11448,
                     11455..11460,11464..11472,11539..11547,12019..12021,
                     12025..12027,12046..12051,12088..12093,12100..12105,
                     12112..12117,12178..12186,12553..12555,12589..12591,
                     12601..12627,12631..12633))
                     /locus_tag="Mnod_7783"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    complement(order(11716..11718,11794..11796,11926..11928,
                     12529..12531))
                     /locus_tag="Mnod_7783"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    complement(order(11488..11490,11551..11559,11641..11643,
                     12037..12039,12187..12189))
                     /locus_tag="Mnod_7783"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            13635..14294
                     /locus_tag="Mnod_7784"
                     /db_xref="GeneID:7295734"
     CDS             13635..14294
                     /locus_tag="Mnod_7784"
                     /inference="protein motif:PFAM:PF03070"
                     /note="PFAM: TENA/THI-4 domain protein;
                     KEGG: mrd:Mrad2831_3392 TenA family transcription
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="TenA family transcriptional activator"
                     /protein_id="YP_002489988.1"
                     /db_xref="GI:220914680"
                     /db_xref="InterPro:IPR004305"
                     /db_xref="GeneID:7295734"
                     /translation="MFSTDAWTRNALLYEAARTLPFNRALADGTLPMPAFRHYMIQDA
                     HYLVGFAQALALAAAKSDQPGYVVQFAAAAAAAIEVERTLHTDFFSRFGVSTEEVAAT
                     PPTPAAHHYICFLLASGFREPLAVHLAAMLPCFWMYREIGRDIHARASLDNPYRAWID
                     TYAGEEFSRAVDAMIEVTDVVWAEAGAKERAAMHAAFTRAAQLEWMFWDSAYRDATWP
                     V"
     misc_feature    13635..14273
                     /locus_tag="Mnod_7784"
                     /note="TENA/THI-4/PQQC family; Region: TENA_THI-4;
                     cl15243"
                     /db_xref="CDD:265653"
     gene            complement(14524..14658)
                     /locus_tag="Mnod_7785"
                     /db_xref="GeneID:7295735"
     CDS             complement(14524..14658)
                     /locus_tag="Mnod_7785"
                     /inference="similar to AA sequence:KEGG:Mrad2831_6463"
                     /note="KEGG: mrd:Mrad2831_6463 integrase catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic region"
                     /protein_id="YP_002489989.1"
                     /db_xref="GI:220914681"
                     /db_xref="GeneID:7295735"
                     /translation="MESATLEWVAWFNTRRLLAPIGNLPPAEAEARYYAQAEVPALAA
                     "
     misc_feature    complement(14527..>14655)
                     /locus_tag="Mnod_7785"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            complement(14674..14997)
                     /locus_tag="Mnod_7786"
                     /db_xref="GeneID:7295736"
     CDS             complement(14674..14997)
                     /locus_tag="Mnod_7786"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mrd:Mrad2831_6463 integrase catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002489990.1"
                     /db_xref="GI:220914682"
                     /db_xref="GeneID:7295736"
                     /translation="MRPICRVLPIAPSTSHAHAARRADPGRRPARARSDAALMVAIRR
                     VFEANFCVYGVQGLAAARPGRDRGRPLHGRTADANPGSERGCAGWEETINGLFKAEVI
                     HRRGP"
     sig_peptide     complement(14938..14997)
                     /locus_tag="Mnod_7786"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.726) with cleavage site probability 0.479 at
                     residue 20"
     misc_feature    complement(<14776..14976)
                     /locus_tag="Mnod_7786"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            complement(15055..15381)
                     /locus_tag="Mnod_7787"
                     /db_xref="GeneID:7295737"
     CDS             complement(15055..15381)
                     /locus_tag="Mnod_7787"
                     /inference="protein motif:PFAM:PF01527"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: met:M446_6733 transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_002489991.1"
                     /db_xref="GI:220914683"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:7295737"
                     /translation="MTKHTPPFSAEVRERAVRMVLEYQGEHGSQDAAIRSIAAKIGCS
                     GEALRNWVRQAERDQGLRAGPTTGERARITALERENRELRQANEILRKASASCAMAEL
                     DRRSRP"
     misc_feature    complement(<15097..15381)
                     /locus_tag="Mnod_7787"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(15121..15360)
                     /locus_tag="Mnod_7787"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            complement(15481..16524)
                     /locus_tag="Mnod_7788"
                     /db_xref="GeneID:7295738"
     CDS             complement(15481..16524)
                     /locus_tag="Mnod_7788"
                     /inference="protein motif:TFAM:TIGR03454"
                     /note="TIGRFAM: parB-like partition protein; plasmid
                     partitioning protein RepB;
                     PFAM: ParB domain protein nuclease; RepB plasmid
                     partition;
                     KEGG: mlo:mll9352 replication protein B"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein RepB"
                     /protein_id="YP_002489992.1"
                     /db_xref="GI:220914684"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR004437"
                     /db_xref="InterPro:IPR011111"
                     /db_xref="InterPro:IPR017819"
                     /db_xref="GeneID:7295738"
                     /translation="MKRRDAIKNLYTAPPEPEKLAVANTRAVVENPPERVLAGPVRTM
                     GLALGRLEEESRALQDALASGASVVELEPEHIESSFVRDRLEDSGTGYEEFRRSIAER
                     GQEVPILVRPHPDKAGRYQVAYGHRRLRAVAELGRRVRALVRTMSDAELVVAQGIENS
                     ARQDLTYIEKALFARRLEDRGFERTVIMDALSTDKGELSKLISVARAIPEELVQTIGP
                     APKAGRRRWLALAELLSDAACAASALRMARDPDLAGLDSDTRFVRVLGAAAPRPAARE
                     RPTAWQSDGGVTRARISRAGSTVTLAIERDPAFGEFIASRLDDLYAAYRRDTDSSSAS
                     SGPGRDGSGVREN"
     misc_feature    complement(15547..16521)
                     /locus_tag="Mnod_7788"
                     /note="plasmid partitioning protein RepB; Region:
                     partition_RepB; TIGR03454"
                     /db_xref="CDD:234216"
     misc_feature    complement(16048..16320)
                     /locus_tag="Mnod_7788"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     misc_feature    complement(15553..16044)
                     /locus_tag="Mnod_7788"
                     /note="RepB plasmid partitioning protein; Region: RepB;
                     pfam07506"
                     /db_xref="CDD:254246"
     gene            complement(16521..17738)
                     /locus_tag="Mnod_7789"
                     /db_xref="GeneID:7295739"
     CDS             complement(16521..17738)
                     /locus_tag="Mnod_7789"
                     /inference="protein motif:TFAM:TIGR03453"
                     /note="TIGRFAM: plasmid partitioning protein RepA;
                     PFAM: regulatory protein MerR; Cobyrinic acid ac-diamide
                     synthase;
                     KEGG: mlo:mll9353 replication protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein RepA"
                     /protein_id="YP_002489993.1"
                     /db_xref="GI:220914685"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR017818"
                     /db_xref="GeneID:7295739"
                     /translation="MATAAIRTKPGPTSDDRVSAHARLLSSQLQGLRERLFPPESQKV
                     LRKFTSGEAARLIGVSDSYLRQLSLDGQGPVPEMLPNGRRLYTLRQINELRRFIAETR
                     PKEARAVLPLRREGERLQTLACVNFKGGSAKTTTTLYLAQWLALQGYRVLALDLDPQA
                     SLSAMFGVQPEFDLRWGDTLYGAIRYDDKRRSLREIIRPTNFDGLDLVPGNLELMEFE
                     HETPRELSAGRVSSGGLFFQRVGAALAEVQDAYDLVVIDCPPQLGYLTLGAVCAATSL
                     LITIHPQMVDVASMSQFLLMTSDLMSVVRKAGGDLSHDFIRYVVTRHEPHDGPQSQIV
                     ALLRNLFGDEVLAASVWKSTAIADAGLTKQSLYELERNSVGRATYDRAIESLEAVHRE
                     ILGLVHQAWGRAA"
     misc_feature    complement(16530..17696)
                     /locus_tag="Mnod_7789"
                     /note="plasmid partitioning protein RepA; Region:
                     partition_RepA; TIGR03453"
                     /db_xref="CDD:234215"
     misc_feature    complement(17481..17594)
                     /locus_tag="Mnod_7789"
                     /note="MerR family regulatory protein; Region: MerR;
                     pfam00376"
                     /db_xref="CDD:249811"
     misc_feature    complement(order(17487..17495,17544..17546,17586..17594))
                     /locus_tag="Mnod_7789"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     misc_feature    complement(16776..17378)
                     /locus_tag="Mnod_7789"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(<16959..17357)
                     /locus_tag="Mnod_7789"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(17337..17357)
                     /locus_tag="Mnod_7789"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(16968..16970,17337..17339))
                     /locus_tag="Mnod_7789"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            18245..18373
                     /locus_tag="Mnod_7790"
                     /pseudo
                     /db_xref="GeneID:7295740"
     gene            18479..19450
                     /locus_tag="Mnod_7791"
                     /db_xref="GeneID:7295741"
     CDS             18479..19450
                     /locus_tag="Mnod_7791"
                     /inference="protein motif:PFAM:PF00665"
                     /note="PFAM: Integrase catalytic region;
                     KEGG: bxe:Bxe_C0793  integrase"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase catalytic subunit"
                     /protein_id="YP_002489994.1"
                     /db_xref="GI:220914686"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="GeneID:7295741"
                     /translation="MLAIHPNARTTPAVRAEIARSPEPSGVLAQRFGVSTETIRKWRK
                     RGPADCQDRSARPHKLPWKASAAERAVVCALRRATGFPLDDLTFIVSHFLPHLNRDAV
                     YRILKAAGLNRLTPADRTRKPHSAFKEDEVGFVHLDVTPLPKLQDRDGVTRKRSLYVA
                     IDRASRFVHLAVKDDEMAASAIAFLEEALAALPFRVTQVLTDRGSCFTADEFETACRR
                     HGVEHRTTRPYTPRTNSMVERFNDRVQREVLSITLYSHQDLETLLAGFTAAYNGRRQR
                     VLKDRSPDLVLRERLRAKPELAKPVTKPPDPEALPKALQMVAAAKEV"
     misc_feature    18560..18808
                     /locus_tag="Mnod_7791"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    18881..19222
                     /locus_tag="Mnod_7791"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(19541..20875)
                     /locus_tag="Mnod_7792"
                     /db_xref="GeneID:7295742"
     CDS             complement(19541..20875)
                     /locus_tag="Mnod_7792"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_4843 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002489995.1"
                     /db_xref="GI:220914687"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295742"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     misc_feature    complement(20414..20812)
                     /locus_tag="Mnod_7792"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    complement(19568..20047)
                     /locus_tag="Mnod_7792"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(19556..>19786)
                     /locus_tag="Mnod_7792"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            complement(21088..21408)
                     /locus_tag="Mnod_7793"
                     /pseudo
                     /db_xref="GeneID:7295743"
     gene            complement(21390..22115)
                     /locus_tag="Mnod_7794"
                     /db_xref="GeneID:7295744"
     CDS             complement(21390..22115)
                     /locus_tag="Mnod_7794"
                     /inference="similar to AA sequence:KEGG:Mpop_4643"
                     /note="KEGG: mpo:Mpop_4643 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002489996.1"
                     /db_xref="GI:220914688"
                     /db_xref="GeneID:7295744"
                     /translation="MLTSIPQTNRARHAPHPTAAAFTFPPVRGRKLTAAFDGGRLPSD
                     GGVLLLAQATRRLGIADRLAAVIPDWRDPHRIRHPLTEILLARILASACSHENADDLD
                     HLCTGAVFKLACARLPESGPDLMSQPTVSHLENTPCLRDLIRLGRVLVDFFCVSSPEP
                     PTAITLDIDDTLDVVHGHQQLSLFNAHHDERCFLPIHVYDPVTGRAVAVILRPGKTPS
                     GREVRGHLRRLVRAIRRHCTPRT"
     misc_feature    complement(<21411..22046)
                     /locus_tag="Mnod_7794"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:257999"
     gene            complement(22207..22473)
                     /locus_tag="Mnod_7795"
                     /pseudo
                     /db_xref="GeneID:7295745"
     gene            22479..22688
                     /locus_tag="Mnod_7796"
                     /db_xref="GeneID:7295746"
     CDS             22479..22688
                     /locus_tag="Mnod_7796"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002489997.1"
                     /db_xref="GI:220914689"
                     /db_xref="GeneID:7295746"
                     /translation="MHRLLGTSGDKTSRHAYRQRWTVETVMPIAKRCWGEALSARTEA
                     TLHLQALLKGPVYNVHRLVRLGIYA"
     gene            complement(22867..24117)
                     /locus_tag="Mnod_7797"
                     /db_xref="GeneID:7295747"
     CDS             complement(22867..24117)
                     /locus_tag="Mnod_7797"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: see:SNSL254_p_0003 plasmid replication
                     protein RepA"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002489998.1"
                     /db_xref="GI:220914690"
                     /db_xref="GeneID:7295747"
                     /translation="MPRRSKPTGPSTSTALTRGASATEPSKPTPIEQPIQFDFLAQQD
                     ERVTKILRFWDHVPWAVLYKHDVMRSGAYLKMVTRAFDVGGRLHQLQMTPARLVRDGQ
                     ELDDYPGDREQLIELAIRRLAAMKREFRLHRKNASNVIGSKVVEVVALNLGIYEIQNE
                     LKRNGHEYNYTQILESIDILNKTHCSITAYDTDQDGDGVAHVMNGPIFTQVYFTRNDK
                     EEKNAAMRVTIHVNSLVADAIRGLDFYDVSYEALMKLKPVSRWIFKRLHHAMVFPTSN
                     EDPRIQTIRASTILAYSGMGEYARLRDALKQIMIYLDDLKRNGIIEEIMAEDEWEGSG
                     RSKRKADVSYTIRMSEEFYRQSIQAQQSRIEALTDFRDITGQATPEVWTPATPTARLE
                     VAKRRTSRRTKGTSDLPLFGSVQD"
     sig_peptide     complement(24049..24117)
                     /locus_tag="Mnod_7797"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.980) with cleavage site probability 0.972 at
                     residue 23"
     gene            24962..26095
                     /locus_tag="Mnod_7798"
                     /db_xref="GeneID:7295748"
     CDS             24962..26095
                     /locus_tag="Mnod_7798"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: sml:Smlt3389  translation initiation factor
                     IF2-2"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002489999.1"
                     /db_xref="GI:220914691"
                     /db_xref="GeneID:7295748"
                     /translation="MPRISALLCLACHGKPEEQWTQIAYAGLLAEPPQWSESDVAAFE
                     ALTPRQRSDLVVGHMTDIPTVRVEPAQERRKRRQRDNRLRQRRHLAGFRYVRRHALDP
                     FLDARLSAGARTTLIYLIARCGRGQAFTKRTCLVATDLGIAQRTVQAHYAALEGAGYI
                     ARSAPDPQTGATTIVLTHLVEPPMPRKKQAGTDTRSQEGRAQEFAPTQAIKDSKTREN
                     EVSDASSVSVARGSQKTGAALVEAAQPPSSVLGDNPLVGSVGQTREMLRPDIAREVQS
                     ARAVRPADTEELTPFDRAMNEILLRVAAHRSKTSEGIVTRSDGTPAQAAVGQGACSPS
                     RTPATNSHPRSSNTPSGQACHVERNFLSLLAPRTIVVRVFPTT"
     misc_feature    25280..25441
                     /locus_tag="Mnod_7798"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:258026"
     gene            complement(26479..28085)
                     /locus_tag="Mnod_7799"
                     /pseudo
                     /db_xref="GeneID:7295749"
     gene            complement(28902..29807)
                     /locus_tag="Mnod_7800"
                     /db_xref="GeneID:7295750"
     CDS             complement(28902..29807)
                     /locus_tag="Mnod_7800"
                     /inference="protein motif:PFAM:PF01261"
                     /note="PFAM: Xylose isomerase domain protein TIM barrel;
                     KEGG: bbt:BBta_0486  myo-inositol catabolism protein"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_002490000.1"
                     /db_xref="GI:220914692"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="GeneID:7295750"
                     /translation="MILYGTNPIAWSNDDDQSIGAHLTLDDCLSDCRKIGFDGIEKGH
                     KMPDDGMALKARLAEYGLRYAAGWHSTNLLVNDIDTEKTALARFIEMTKAAGGDHINA
                     CECSNTVHGNAAVPVNDRPIMTDPQWERFSAGYEELSRFAADRGVKMGYHHHMGTIIE
                     SGADIDRFMAMAGPHTHLLLDTGHCTFGGADPAAVAEKYMNRVTHIHCKNIRPEIMRQ
                     VREENLSFLEGVRRGVFTVPGDPEGCVDFAPVLRIAAEQGYSGWLVIEAEQDSLMREP
                     FFYQNMGLAALRNMAGAAGLDKVAA"
     misc_feature    complement(28941..29798)
                     /locus_tag="Mnod_7800"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    complement(29088..29723)
                     /locus_tag="Mnod_7800"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     gene            complement(30107..30922)
                     /locus_tag="Mnod_7801"
                     /db_xref="GeneID:7295751"
     CDS             complement(30107..30922)
                     /locus_tag="Mnod_7801"
                     /inference="protein motif:PFAM:PF06845"
                     /note="PFAM: Myo-inositol catabolism IolB domain protein;
                     KEGG: acr:Acry_2313 myo-inositol catabolism IolB
                     domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Myo-inositol catabolism IolB domain protein"
                     /protein_id="YP_002490001.1"
                     /db_xref="GI:220914693"
                     /db_xref="InterPro:IPR010669"
                     /db_xref="GeneID:7295751"
                     /translation="MMANLLRRPFGAHGKVHEITPHSAGWRYVGFSLYRLRPGETVGE
                     ATGAMEAILVMVEGKAAVTAAGNDWGELGDRMDVFEKTPPHCLYIPNGENWTAVAITD
                     CTIGVCLAPGQSGHAARRIGPEGITLTRRGQGSNTRFINNIAMEAEDYCDSLLVTEVF
                     TPAGHWSSYPSHRHDEDDYPRITYLEETYYHRLNPAQGFGIQRVYTDDGSLDETMAVH
                     NHDVVLVPRGHHPCAAAHGYEMYYLNVMAGPLRQWRFEPDPAHRWLLEGEAKT"
     misc_feature    complement(30122..30919)
                     /locus_tag="Mnod_7801"
                     /note="Uncharacterized enzyme involved in inositol
                     metabolism [Carbohydrate transport and metabolism];
                     Region: IolB; COG3718"
                     /db_xref="CDD:226241"
     gene            complement(31016..32854)
                     /locus_tag="Mnod_7802"
                     /db_xref="GeneID:7295752"
     CDS             complement(31016..32854)
                     /locus_tag="Mnod_7802"
                     /inference="protein motif:PFAM:PF00205"
                     /note="PFAM: thiamine pyrophosphate protein domain protein
                     TPP-binding; thiamine pyrophosphate protein central
                     region; thiamine pyrophosphate protein TPP binding domain
                     protein;
                     KEGG: pde:Pden_1675 thiamine pyrophosphate enzyme domain
                     protein TPP-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate protein central region"
                     /protein_id="YP_002490002.1"
                     /db_xref="GI:220914694"
                     /db_xref="InterPro:IPR000399"
                     /db_xref="InterPro:IPR011766"
                     /db_xref="InterPro:IPR012000"
                     /db_xref="InterPro:IPR012001"
                     /db_xref="GeneID:7295752"
                     /translation="MMTTVRLTAAQTMMRWLSVQMTEEGERFIEGVWAIFGHGNVAGI
                     GEALEKIGDALPTWRGQNEQTMAHAAIAYAKTKRRRKAMAVTSSIGPGATNMVTAAAL
                     AHVNRLPVLLIPGDVFANRRPDPVLQQIEDFDDGTVSANDCFRPVSRYFDRITRPEHL
                     LTALPRALQVMTDPAQCGPVTLAFCQDVQAEAYDWPEAFFAPKVWHIRRPEPDRRELA
                     AVIEMIRAAQKPVIVSGGGVLYSGADQDLAAFAEKHNIPVVETQAGKGALDWQHPLNF
                     GSPGVTGSDCANRICAEADLIIGAGTRFQDFTTGSWAAFRNPQRKLVSVNLTGYDAAK
                     HSAVPLVADAKIALTAITAGLEGHRFAGPDASLRTAWFKAADRVMAAPQGENPNDLPT
                     DAQVVGAVQRYAGADTVVMCAAGTMPGALQVLWRAAPGGYHMEYGYSCMGYEVAGAMG
                     IALAVPEKEVICFVGDGSYMMANSELATAAMMHVPFTIVLTDNRGYGCINRLQIECGG
                     APFNNMYVDSRHKTFPEIDFVAHARAMGAEAVKVAGIAGLEAELARPRDRKVPRVILI
                     DTEAESSLGVGGAWWDVAVPEVGTTEALRAARERYDSHAAFQRTFD"
     misc_feature    complement(31022..32854)
                     /locus_tag="Mnod_7802"
                     /note="Acetolactate synthase [Amino acid transport and
                     metabolism]; Region: COG3962"
                     /db_xref="CDD:226471"
     misc_feature    complement(32303..32770)
                     /locus_tag="Mnod_7802"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(32537..32542,32549..32551,32561..32563,
                     32582..32584,32624..32632,32636..32641,32648..32653,
                     32660..32662,32669..32689,32717..32719,32732..32734,
                     32744..32749,32762..32764))
                     /locus_tag="Mnod_7802"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(32417..32419,32426..32428,32552..32554,
                     32561..32566,32570..32575,32582..32584,32663..32665,
                     32669..32680,32684..32686,32717..32719,32732..32734,
                     32741..32749))
                     /locus_tag="Mnod_7802"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(32570..32572,32582..32584,32666..32668,
                     32747..32749))
                     /locus_tag="Mnod_7802"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(31802..32206)
                     /locus_tag="Mnod_7802"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(31091..31678)
                     /locus_tag="Mnod_7802"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    complement(order(31370..31372,31376..31378,31451..31462,
                     31532..31534))
                     /locus_tag="Mnod_7802"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            complement(32851..34773)
                     /locus_tag="Mnod_7803"
                     /db_xref="GeneID:7295753"
     CDS             complement(32851..34773)
                     /locus_tag="Mnod_7803"
                     /inference="protein motif:PFAM:PF00294"
                     /note="PFAM: PfkB domain protein;
                     KEGG: rsh:Rsph17029_3547 ribokinase-like domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB domain-containing protein"
                     /protein_id="YP_002490003.1"
                     /db_xref="GI:220914695"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:7295753"
                     /translation="MKTLDVITIGRSSVDLYGTQIGGRLEDMRSFQKYIGGSPTNIAA
                     GTARLGLKSALITRVGDEHMGRFIREELLKEGVDVRGVKTDPERLTALVLLGIRDQER
                     FPLIFYRSDCADMALCEDDIDESLIAQARSVVATGTHLSHPRTEAAVLKAFRLARTHG
                     ARTALDIDYRPNLWGLAGHDAGESRFIASKAVTAKLQSHLPLFDLIVGTEEEFHIAGG
                     DTNTLAALRAVRAVSSAVLVCKRGAAGAVAFTGEIPDSLDEGEMGPGFPIEVFNVLGA
                     GDGFMSGLIKGWLEEAPWPRALAYANACGAFAVSRHGCTPAYPSLTELEFFLERGVVT
                     PALRHDAALEQLHWSTNRHGDWSTMRVFAFDHRMQLEVMEGASPAKIGAFKELCLQAA
                     LEVQDGRPGYGILCDDRLGRDALQAAAGTGLWIGRPVEWPGSRPLTLEPELGPDYGGL
                     AEWPLDHVVKVLCFCHPDDTLEMRAQQEAVVTRLFHAARRQRLEFLLEIIPSKVGPVD
                     DRTTATLIRRFYEIGIYPDWWKLEPMASAVAWAEACAAIEEHDRHTRGIVVLGLDAPE
                     AELAESFRIAAGFSLVKGFAVGRTIFGQVARDWLAGRIGDEDAVAEMVRRYARLCAVW
                     DAGKGLASATAGREQA"
     misc_feature    complement(33829..34761)
                     /locus_tag="Mnod_7803"
                     /note="2-keto-3-deoxygluconate kinase (KdgK)
                     phosphorylates 2-keto-3-deoxygluconate (KDG) to form
                     2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the
                     common intermediate product, that allows organisms to
                     channel D-glucuronate and/or D-galacturinate into the...;
                     Region: KdgK; cd01166"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(33832..33834,33940..33942,33949..33951,
                     34264..34266,34360..34362,34447..34449,34453..34455,
                     34495..34497,34651..34653,34660..34665))
                     /locus_tag="Mnod_7803"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(33856..33858,33868..33870,33934..33936,
                     33943..33951,33976..33978,34039..34041,34054..34056))
                     /locus_tag="Mnod_7803"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     misc_feature    complement(32896..33807)
                     /locus_tag="Mnod_7803"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2090); Region: DUF2090; pfam09863"
                     /db_xref="CDD:255612"
     gene            complement(34804..35703)
                     /locus_tag="Mnod_7804"
                     /db_xref="GeneID:7295754"
     CDS             complement(34804..35703)
                     /locus_tag="Mnod_7804"
                     /inference="protein motif:PFAM:PF01261"
                     /note="PFAM: Xylose isomerase domain protein TIM barrel;
                     KEGG: atc:AGR_L_630 myo-inositol catabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_002490004.1"
                     /db_xref="GI:220914696"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="GeneID:7295754"
                     /translation="MKYTLDPHMFRHLSLEETCRKTAELGYDSIELSPRPDFLAWWTR
                     PKVYPERIRSFKKALKDHGVGLATLQPMYRWASPYPDEWELAIDNWKRAIAIAVEMEC
                     PMFVSEFGRGGSPERSLNDRSGLHRPETCEGQFFRAMDILVPILEREGIVLSLEAHPE
                     HWVEEVAPAIDIIKTINSPMVKASFIAPHTFFYGPDMVANLRATAGYLAHVRLADTYD
                     HNKSSQLRYIVNPPGAKVRVHQHLDIGQGEIDWDLFFSTLADMKFDGVLSNCVFAWED
                     RAEDSARFMLAEMKRYVGTYWKA"
     misc_feature    complement(34831..35703)
                     /locus_tag="Mnod_7804"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    complement(34957..35646)
                     /locus_tag="Mnod_7804"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     gene            complement(35816..36739)
                     /locus_tag="Mnod_7805"
                     /db_xref="GeneID:7295755"
     CDS             complement(35816..36739)
                     /locus_tag="Mnod_7805"
                     /inference="protein motif:PFAM:PF00532"
                     /note="PFAM: periplasmic binding protein/LacI
                     transcriptional regulator;
                     KEGG: atc:AGR_L_632  rhizopine-binding protein precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="YP_002490005.1"
                     /db_xref="GI:220914697"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:7295755"
                     /translation="MKRLLLAAALTACALPAYAGGRIGVSMTSLDNPFLTILLNGMKG
                     EAARTKGVELMLEDAQRDVSRQLSQVQNFVANRVDAIVVNAVDGDSTAAITRAAKAAG
                     IPLVYVNHPPAELGRGMPKGTAFVGSNELDSGTMQARAVCKMLAGKGRAVILMGPLEN
                     HSALVRTKDVVDVFRTPDCPIHILDKQTANWMRVEAQDLVASWLTAGMRFDAVIANSD
                     EMAIGAAQALKSAGVAMKDVVIAGIDATPDGLAAMATGDLDVTVFQNATRQGEVAVQT
                     AVAMAAGEKAEDAIWVPFELVTKDNLAEYRK"
     sig_peptide     complement(36680..36739)
                     /locus_tag="Mnod_7805"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 20"
     misc_feature    complement(35846..36676)
                     /locus_tag="Mnod_7805"
                     /note="Periplasmic binding proteins specific to
                     rhizopines; Region: PBP1_rhizopine_binding_like; cd06301"
                     /db_xref="CDD:107296"
     misc_feature    complement(35885..36673)
                     /locus_tag="Mnod_7805"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    complement(order(35948..35950,36008..36010,36242..36244,
                     36413..36415,36638..36640))
                     /locus_tag="Mnod_7805"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107296"
     gene            complement(36821..37606)
                     /locus_tag="Mnod_7806"
                     /db_xref="GeneID:7295756"
     CDS             complement(36821..37606)
                     /locus_tag="Mnod_7806"
                     /inference="protein motif:PFAM:PF01261"
                     /note="PFAM: Xylose isomerase domain protein TIM barrel;
                     KEGG: atc:AGR_L_627  IolI protein"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_002490006.1"
                     /db_xref="GI:220914698"
                     /db_xref="InterPro:IPR012307"
                     /db_xref="GeneID:7295756"
                     /translation="MRFALNHILAPKLPLEEFFASARALGATEVEIRNDLPDVVGTVA
                     PEEVRTAAEKTGVSIISIKALYPFNVWTDDMAKRAAKLAAYAAACGAKALVMCPLNEG
                     KAVAFDVLVASLKAMKPILLDHRLTGLVEPLGFPVSSLRTKKEAIAAIRAADGADTYR
                     LVHDTFHHHLAGETEFFPEWTGLVHISGVTDPIVAVADMLDAHRVLVDGADRLENIPQ
                     IRRLIAAGYSGPFSFEPFATEVHELEDPKGAAKRSMDFVSASL"
     misc_feature    complement(36824..37606)
                     /locus_tag="Mnod_7806"
                     /note="Fructose/tagarose-bisphosphate aldolase class II.
                     This family includes fructose-1,6-bisphosphate (FBP) and
                     tagarose 1,6-bisphosphate (TBP) aldolases. FBP-aldolase is
                     homodimeric and used in gluconeogenesis and glycolysis;
                     the enzyme controls the...; Region: FTBP_aldolase_II;
                     cl17181"
                     /db_xref="CDD:266533"
     misc_feature    complement(36875..37606)
                     /locus_tag="Mnod_7806"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     gene            complement(37616..38626)
                     /locus_tag="Mnod_7807"
                     /db_xref="GeneID:7295757"
     CDS             complement(37616..38626)
                     /locus_tag="Mnod_7807"
                     /EC_number="1.1.1.18"
                     /inference="protein motif:PFAM:PF01408"
                     /note="PFAM: oxidoreductase domain protein; Oxidoreductase
                     domain;
                     KEGG: atc:AGR_L_628 myo-inositol 2-dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase domain-containing protein"
                     /protein_id="YP_002490007.1"
                     /db_xref="GI:220914699"
                     /db_xref="InterPro:IPR000683"
                     /db_xref="InterPro:IPR004104"
                     /db_xref="GeneID:7295757"
                     /translation="MTVRVGIIGTGAIGREHARRIEQVLSGGKVVALSDVNATSAEAV
                     RAEIARDARLFETGEALIASPDVDAVLVTSWGATHEQYVLAAIAAGKPCFCEKPLATT
                     AEGARRIVDAEVAHGKRLVQVGFMRRYDAGYIALKQAVKSHTGAPILVHAAHRNPAVP
                     EQYVTPMAIHDTLIHEIDVLRWLLDDDYVSARVLFPRKAARSHAKLRDPQVVVLETKK
                     GVLIDVEIFVNCHYGYDIQCEVVGEDGIARLPEPMAVEMRLDAKRQNAILTDWKDRFI
                     ASYDVELQDFLKAAAAGTASGPTSWDGYVAAITSDACVEAQERAGEAVAITLPARPSL
                     YN"
     misc_feature    complement(37649..38626)
                     /locus_tag="Mnod_7807"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    complement(38252..38620)
                     /locus_tag="Mnod_7807"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    complement(37910..>38116)
                     /locus_tag="Mnod_7807"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            complement(38742..39776)
                     /locus_tag="Mnod_7808"
                     /db_xref="GeneID:7295758"
     CDS             complement(38742..39776)
                     /locus_tag="Mnod_7808"
                     /EC_number="3.6.3.17"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: atc:AGR_L_2904 sugar ABC transporter (permease)"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_002490008.1"
                     /db_xref="GI:220914700"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:7295758"
                     /translation="MFVNNSSAEGVAVAAPVATRRRLPVEANILLILIGIALVFELLG
                     WVVVGQSFLMNPQRLTILILQVSVIGIIAIGVTQVIITGGIDLSSGSVVGLSAMVAAS
                     DAQSSAWTKVLYPSMTDLPVAVPILVGLAIGLLAGVINGMLIVYTKIPPFIATLGMMV
                     SARGLSKWYTKGQPVSGLTDEFSVIGSGIWPVVIFLSVAVIFHVLLRYTRYGKFTYAI
                     GANEQAARISGIEVDRHLIKVYGVAGLLGGLAGIVTAARAQTAQAGMGTMYELDAIAA
                     AVIGGASLSGGVGRITGTVIGTIILGTMTSGFTFLRVDAFYQEIIKGLIIIAAVAADV
                     YRQKKRVKKA"
     misc_feature    complement(38778..39581)
                     /locus_tag="Mnod_7808"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(39054..39110)
                     /locus_tag="Mnod_7808"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(39802..41340)
                     /locus_tag="Mnod_7809"
                     /db_xref="GeneID:7295759"
     CDS             complement(39802..41340)
                     /locus_tag="Mnod_7809"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: smd:Smed_4267 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490009.1"
                     /db_xref="GI:220914701"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:7295759"
                     /translation="MIRSSTMAAVRDSAAAPNSEYLLTIENARKEFPGVLALDNVQFK
                     LRRGTVHALMGENGAGKSTLMKIIAGIYQPDRGEIHLRGAPIELKSPLDALENGIAMI
                     HQELNLMPFMTVAENIWIRREPLNRLGLVDHAKMNEMTAELFRRLNINIHPQVQVRDL
                     SVANRQMVEIAKAVSYESDVLIMDEPTSALTEREVEHLFEIIRELRAQGKGIIYITHK
                     MNELFEIADEFSVFRDGRYIATHPSSEVTRDDIIRMMVGREITQMFPKEEVPIGDVVL
                     SVKNLSLEGVFQDVSFDIRAGEIFGIAGLVGSGRSNVAETIFGVTPATSGTIEILGKP
                     VNIGSPSTAIRHQMALLTEDRKETGCLLILDILENMQIAVLQQDFVRGGFVFEKTLTG
                     ACATMSEKLKVKTPNLQERIENLSGGNQQKVLIGRWLLTKPKILILDEPTRGIDVGAK
                     AEIHKLLVELARNGVAIMMISSEMPEVLGMSDRIMVMHEGRMTGILDRAEADQLKIME
                     LAAK"
     misc_feature    complement(39808..41298)
                     /locus_tag="Mnod_7809"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    complement(40621..41274)
                     /locus_tag="Mnod_7809"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(41155..41178)
                     /locus_tag="Mnod_7809"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(40690..40692,40786..40791,41029..41031,
                     41152..41160,41164..41169))
                     /locus_tag="Mnod_7809"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(41029..41040)
                     /locus_tag="Mnod_7809"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(40834..40863)
                     /locus_tag="Mnod_7809"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(40786..40803)
                     /locus_tag="Mnod_7809"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(40768..40779)
                     /locus_tag="Mnod_7809"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(40684..40704)
                     /locus_tag="Mnod_7809"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(39865..40527)
                     /locus_tag="Mnod_7809"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(41423..42364)
                     /locus_tag="Mnod_7810"
                     /db_xref="GeneID:7295760"
     CDS             complement(41423..42364)
                     /locus_tag="Mnod_7810"
                     /inference="protein motif:PFAM:PF00532"
                     /note="PFAM: periplasmic binding protein/LacI
                     transcriptional regulator;
                     KEGG: atc:AGR_L_634  rhizopine-binding protein precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="YP_002490010.1"
                     /db_xref="GI:220914702"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:7295760"
                     /translation="MKEILLVAVLMSSIASSALAENIGVSMSLFDDNLLTVMRNDMTN
                     YATTLNGVTLQIEDAQNDVAKQQSQVQNFIAAGVDAIIVNPVDTDATAAISKIASNAG
                     IPLVYVNRLPVNLGKLPPKQAFVGPDERESGTLQTKEICRLLKQAGKTKANIVVMMGE
                     LSNQAARQRTQDVHEVIATPECSFMKIVEEQTANWSRTQGADLMSNWLSAGVQFDAVV
                     SNNDEMAIGAIQAMKAARVDMKTMIVGGVDATQDALAAMAAGDLDVTVFQNVVGQGRG
                     ALDAALKLARGKKVEQKVFVPFELVTPANLQNYRAKN"
     sig_peptide     complement(42302..42364)
                     /locus_tag="Mnod_7810"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 21"
     misc_feature    complement(41426..42352)
                     /locus_tag="Mnod_7810"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    complement(41459..42298)
                     /locus_tag="Mnod_7810"
                     /note="Periplasmic binding proteins specific to
                     rhizopines; Region: PBP1_rhizopine_binding_like; cd06301"
                     /db_xref="CDD:107296"
     misc_feature    complement(order(41561..41563,41621..41623,41858..41860,
                     42038..42040,42263..42265))
                     /locus_tag="Mnod_7810"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107296"
     gene            complement(42753..43781)
                     /locus_tag="Mnod_7811"
                     /db_xref="GeneID:7295761"
     CDS             complement(42753..43781)
                     /locus_tag="Mnod_7811"
                     /inference="protein motif:PFAM:PF00356"
                     /note="PFAM: regulatory protein LacI;
                     KEGG: atc:AGR_L_636 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LacI family"
                     /protein_id="YP_002490011.1"
                     /db_xref="GI:220914703"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="GeneID:7295761"
                     /translation="MRRPTIADLAEAAGVSVATVDRVLNGRYRVREETARRVLEAAHK
                     IGFYGANVIRARVLAEQPEYHLGFILQKERHAFYQTFARQIEEAVGAVPNKRLRATIR
                     FVQSAAPAELADLIRSMKGKVQAVAATGLDHHDATAAVAELRAVGVPTFSLLSDFAQG
                     VRESYIGTNNLRVGRSAAWLMSKMACRPGKIVIFIGGHRYHGHALRETGFRSYFREFA
                     PDFELLDSIVNIETRQLTCEATLGLLARHDDVVGIYVAGGGMEGAVAALREVRQPDDV
                     ACIVNELTPESTQGLLDRFVSIVMATPLPTLCSDLVAMMVHAIEHGMAEYPGQRFLPI
                     ELWTPESL"
     misc_feature    complement(42756..43763)
                     /locus_tag="Mnod_7811"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    complement(43605..43763)
                     /locus_tag="Mnod_7811"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(43605..43610,43614..43619,43629..43631,
                     43638..43640,43680..43682,43689..43694,43707..43709,
                     43716..43721,43725..43739,43761..43763))
                     /locus_tag="Mnod_7811"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(43608..43622,43626..43640))
                     /locus_tag="Mnod_7811"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(42765..43589)
                     /locus_tag="Mnod_7811"
                     /note="Periplasmic sugar-binding domain of uncharacterized
                     transport systems; Region:
                     PBP1_uncharacterized_sugar_binding; cd06307"
                     /db_xref="CDD:107302"
     misc_feature    complement(order(42876..42878,42936..42938,43164..43166,
                     43320..43322,43551..43553))
                     /locus_tag="Mnod_7811"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107302"
     gene            44173..45126
                     /locus_tag="Mnod_7812"
                     /db_xref="GeneID:7295762"
     CDS             44173..45126
                     /locus_tag="Mnod_7812"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: regulatory protein LysR; LysR
                     substrate-binding;
                     KEGG: sme:SMb21434  transcriptional regulator, LysR family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="YP_002490012.1"
                     /db_xref="GI:220914704"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:7295762"
                     /translation="MAAQSPRVRHLNWNLLRTFLVIVEERSITKAAERLHLRQPTVTA
                     SLQKLEETLGTQLILRDSRRFVLTSRGEALRKECVEIHQHVERIGERLSTDEDDLSGL
                     VRMLIVTEVMLPTLDRALGLMHRRHPSVTLSIDVANSQEIARAVAQRTVPFGLCLLPK
                     PLAALECRMLMREEFGIYCGRTHPLFERQDVTLEDLRAEPFVAFTCGQPGGALEPMVA
                     LRDGAGLGARTAGVSSHLGEVARMIAAGIGIGILPVTAAERMADKDLLWRLPVLEGQI
                     GADLYFLRNPEMALDRAEKAFLDLFLSLVPDPEGPAEPVWV"
     misc_feature    44203..45087
                     /locus_tag="Mnod_7812"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    44209..44388
                     /locus_tag="Mnod_7812"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    44518..45075
                     /locus_tag="Mnod_7812"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(44521..44526,44530..44535,44542..44544,44554..44556,
                     44560..44580,44860..44877,44893..44898,44902..44907)
                     /locus_tag="Mnod_7812"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(45385..46632)
                     /locus_tag="Mnod_7813"
                     /db_xref="GeneID:7295763"
     CDS             complement(45385..46632)
                     /locus_tag="Mnod_7813"
                     /EC_number="3.5.1.87"
                     /inference="protein motif:TFAM:TIGR01879"
                     /note="allantoate amidohydrolase and N-carbamoyl-L-amino
                     acid amidohydrolase are very similar; the allantoate
                     amidohydrolase from Escherichia coli forms a dimer and
                     binds zinc ions for catalytic activity and catalyzes the
                     conversion of allantoate to (S)-ureidoglycolate and
                     ammonia; carbamoyl amidohydrolase from Bacillus sp.
                     converts N-carbamoyl amino acids to amino acids, ammonia,
                     and carbon dioxide"
                     /codon_start=1
                     /transl_table=11
                     /product="allantoate amidohydrolase"
                     /protein_id="YP_002490013.1"
                     /db_xref="GI:220914705"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR010158"
                     /db_xref="GeneID:7295763"
                     /translation="MSRSSNIRPNISRLWSSLMRSAEIGATPRGGLRRLALTEEDGEV
                     RREFIRWCEEAGCVVRVDGIGNIFAFRAGQDPDAKAVLVGSHLDTQIKGGRFDGILGV
                     LAGLELVRTLNDHGVTTRRPIAVVNWTNEEGARFEPPMIGSAVFTGRASLDFAHGRAD
                     KDGITLGQALDAIGFRGTDRLSPEAFDSLFELHIEQGPHLDEAKRQVGVVTGAFSVRG
                     MVVEVVGETGHVGPTPMPKRRNAIVGAARVTLAVDDIGWSRHETGGKSTTMRLRVEPN
                     LLGILPDRVEMTCDFRHPDDAVATEMLASLKAQIPDIEQRSGCKVSIREQWSYGGMQY
                     DPGCVGLVREVAQALGYSTMDLLTEAGHDAMHAADHLPTAMIFTPCEGGLSHNEAENV
                     TPDDIEPGVNVLLQSVLRRAEVV"
     misc_feature    complement(45388..46626)
                     /locus_tag="Mnod_7813"
                     /note="allantoate amidohydrolase; Reviewed; Region:
                     PRK12893"
                     /db_xref="CDD:237250"
     misc_feature    complement(45406..46593)
                     /locus_tag="Mnod_7813"
                     /note="M20 Peptidase beta-alanine synthase, an
                     amidohydrolase; Region: M20_bAS; cd03884"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(45475..45477,45550..45555,45757..45759,
                     45979..45981,45985..45987,46045..46047,46054..46056,
                     46216..46218,46237..46242,46339..46344,46375..46377))
                     /locus_tag="Mnod_7813"
                     /note="active site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(45475..45477,46054..46056,46237..46242,
                     46342..46344,46375..46377))
                     /locus_tag="Mnod_7813"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193505"
     misc_feature    complement(order(45556..45558,45757..45759,45763..45765,
                     45787..45798,45802..45807,45817..45840,45859..45864,
                     45871..45876,45880..45888,45892..45900,45904..45909,
                     45919..45921,45928..45930,45934..45948,45979..45981,
                     46024..46029,46036..46047))
                     /locus_tag="Mnod_7813"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193505"
     gene            46944..47990
                     /locus_tag="Mnod_7814"
                     /db_xref="GeneID:7295764"
     CDS             46944..47990
                     /locus_tag="Mnod_7814"
                     /EC_number="4.3.1.12"
                     /inference="protein motif:PFAM:PF02423"
                     /note="PFAM: ornithine cyclodeaminase/mu-crystallin;
                     Shikimate/quinate 5-dehydrogenase;
                     KEGG: LOC100148442; similar to ornithine cyclodeaminase
                     family (predicted)"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase/mu-crystallin"
                     /protein_id="YP_002490014.1"
                     /db_xref="GI:220914706"
                     /db_xref="InterPro:IPR003462"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="GeneID:7295764"
                     /translation="MPNAGGGPESRYRADESLAAGPPLVLCAAEVAAALDREALIEAL
                     AAAFRGGCEAPRRHHHAIPIPGEPDATLLLMPAWSVGRHFGVKVAAVVPGNNARFLPA
                     VQSQYLLFCGRTGRLRAALDGNELTSRRTVAASSLAARFLALPGAGRLLIVGTGEIAR
                     HVAASHAALRPIRSVEVWGRSPAKAQAVAADLTRAGVNASPATDLAEACARADIITCC
                     TLSREPLVEGRWLRPGTHLDLIGGFTPAMREVDDGAVARATLFIDTPAALHEAGDLAI
                     PLARGIIAPTAVAGDLADLASGRHPGRTSVDEITLFKSVGASIEDLAAAILCVERHRA
                     RPASVFPTPVEARP"
     misc_feature    47013..47948
                     /locus_tag="Mnod_7814"
                     /note="Predicted ornithine cyclodeaminase, mu-crystallin
                     homolog [Amino acid transport and metabolism]; Region:
                     COG2423"
                     /db_xref="CDD:225280"
     misc_feature    47013..47948
                     /locus_tag="Mnod_7814"
                     /note="Shikimate / quinate 5-dehydrogenase; Region:
                     Shikimate_DH; cl19124"
                     /db_xref="CDD:267477"
     gene            47993..49321
                     /locus_tag="Mnod_7815"
                     /db_xref="GeneID:7295765"
     CDS             47993..49321
                     /locus_tag="Mnod_7815"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: General substrate transporter; major
                     facilitator superfamily MFS_1;
                     KEGG: azc:AZC_1948 permeases"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_002490015.1"
                     /db_xref="GI:220914707"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:7295765"
                     /translation="MATTTTPSIVAEPPAVAEPHRMRRIAIASVIGTTVEWYDLFVFA
                     TASALVFNKVFFPSFDPLVGTLLAFGTFASAYLARIVGAALFGHFGDRLGRKSMLLFS
                     LVLMGVATFAIGLLPNYAAIGIWAPILLLSLRVVQGLALGGEWGGAVLMAVEHAPRHQ
                     RGLYGSWVQIGVPAGTLLANLVFLLINAVLPAEDMLAWGWRIPFLASILLVLVGGYIR
                     LNVSETPSFAKVKRASEQVKVPFAELMRKSWKTVVLGGVATMSTGSSFNLIVAFGLSY
                     GTQNLGFTRNTMLAIVLLSCAACVALLPFFGWLSDRWGRRPVIVGGILAEALVAFPLF
                     WLMDTKTFAGALAGYLLMMMAFAANYGPIATFLAELFGTRVRYSGLSIAYMLSGVLGS
                     AATPFVTTWLLAATGQGSSVAWYMIGSAVLSAGALMLLVETVRRDLTDAS"
     misc_feature    48086..49261
                     /locus_tag="Mnod_7815"
                     /note="metabolite-proton symporter; Region: 2A0106;
                     TIGR00883"
                     /db_xref="CDD:233168"
     misc_feature    48206..49285
                     /locus_tag="Mnod_7815"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(48206..48208,48215..48220,48227..48229,48239..48244,
                     48248..48253,48413..48418,48425..48430,48437..48442,
                     48449..48451,48485..48490,48497..48502,48518..48520,
                     48779..48781,48788..48793,48800..48805,48812..48814,
                     48854..48856,48866..48868,48878..48880,48887..48889,
                     48899..48901,49049..49051,49058..49063,49070..49072,
                     49082..49087,49094..49096,49127..49132,49139..49144,
                     49151..49156,49166..49168)
                     /locus_tag="Mnod_7815"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            49353..49994
                     /locus_tag="Mnod_7816"
                     /db_xref="GeneID:7295766"
     CDS             49353..49994
                     /locus_tag="Mnod_7816"
                     /inference="protein motif:PFAM:PF03737"
                     /note="PFAM: Dimethylmenaquinone methyltransferase;
                     KEGG: vei:Veis_0782 dimethylmenaquinone methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylmenaquinone methyltransferase"
                     /protein_id="YP_002490016.1"
                     /db_xref="GI:220914708"
                     /db_xref="InterPro:IPR005493"
                     /db_xref="GeneID:7295766"
                     /translation="MTLDRTGTSEAMHRLAAVETATIGHVLSHGFMDPAIQGLGGEAR
                     ICGPAVTVALPPEGGAALAWAVSTARRGDVLVVDRQGDACHACWGAVMTEAALAVGLA
                     GIVIDGPVTDAAAIRASGLPVWCRGRSPLTIKRRPGGRVGGTIRCGGVTVRTGDLVLA
                     DENGVLVLDPERAFALAEEALTLQEGEPAFIARLRRGERLADLYGLTREDLDR"
     misc_feature    49392..49973
                     /locus_tag="Mnod_7816"
                     /note="Demethylmenaquinone methyltransferase; Region:
                     Methyltransf_6; cl00480"
                     /db_xref="CDD:260452"
     gene            49991..50380
                     /locus_tag="Mnod_7817"
                     /db_xref="GeneID:7295767"
     CDS             49991..50380
                     /locus_tag="Mnod_7817"
                     /inference="protein motif:PFAM:PF01042"
                     /note="PFAM: Endoribonuclease L-PSP;
                     KEGG: azc:AZC_1946  translation initiation inhibitor
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="YP_002490017.1"
                     /db_xref="GI:220914709"
                     /db_xref="InterPro:IPR006175"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="GeneID:7295767"
                     /translation="MREILEIPVISEAIRGLGAPTSALVRAGDLLFTCGMPPIDTRTG
                     RIVTGPIEAQTRASLDALRVTLDHAGSSLAKVVKATVYVTDPVLMGGVNTVYQEFFPD
                     GWPARTFAAIKPWPLPFDIEIECVACL"
     misc_feature    50063..50371
                     /locus_tag="Mnod_7817"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cd00448"
                     /db_xref="CDD:100004"
     misc_feature    order(50063..50065,50069..50071,50078..50080,50084..50086,
                     50090..50095,50213..50215,50219..50224,50228..50230,
                     50234..50236,50267..50269,50276..50278,50303..50326,
                     50354..50356,50360..50362,50366..50368)
                     /locus_tag="Mnod_7817"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    order(50255..50257,50267..50269,50309..50311,50354..50356)
                     /locus_tag="Mnod_7817"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            50679..51237
                     /locus_tag="Mnod_7818"
                     /pseudo
                     /db_xref="GeneID:7295768"
     gene            51620..52456
                     /locus_tag="Mnod_7819"
                     /db_xref="GeneID:7295769"
     CDS             51620..52456
                     /locus_tag="Mnod_7819"
                     /inference="protein motif:TFAM:TIGR03214"
                     /note="TIGRFAM: allantoin catabolism protein;
                     PFAM: Cupin domain protein; protein of unknown function
                     DUF861 cupin_3; Cupin 2 conserved barrel domain protein;
                     KEGG: bcs:BCAN_A0354 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490018.1"
                     /db_xref="GI:220914710"
                     /db_xref="InterPro:IPR006045"
                     /db_xref="InterPro:IPR008579"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR017627"
                     /db_xref="GeneID:7295769"
                     /translation="MTVRTYFASLGGLPPQTQLLTDRATFTEAYAVIPKGVYSDIVTS
                     YLPFWEKTRCWVIARPLSGFSETFSQYVMEVSPGGGSDKPELDVGAEGVLFVVDGELT
                     VTLGGKDNLLAPGGYAYIPPASDWQVRNQSGQKVRFHWIRKAYDYVAGIPAPDPIFAN
                     ELDIVPNPMPDTEGKWATTRFVDPSDMRHDMHVTIVTLQPGAVIPFAETHVMEHGLYV
                     LEGKAVYRLNQDWVEVEAGDFMWLRAFCPQACYAGGPGNFRYLLYKDVNRHMKLGGEL
                     RR"
     misc_feature    51629..52438
                     /locus_tag="Mnod_7819"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11171"
                     /db_xref="CDD:183011"
     misc_feature    51830..52042
                     /locus_tag="Mnod_7819"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     misc_feature    52091..52405
                     /locus_tag="Mnod_7819"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            52453..52944
                     /locus_tag="Mnod_7820"
                     /db_xref="GeneID:7295770"
     CDS             52453..52944
                     /locus_tag="Mnod_7820"
                     /EC_number="3.5.3.19"
                     /inference="protein motif:PFAM:PF04115"
                     /note="catalyzes the formation of glyoxylate from
                     (S)-ureidoglycolate"
                     /codon_start=1
                     /transl_table=11
                     /product="ureidoglycolate hydrolase"
                     /protein_id="YP_002490019.1"
                     /db_xref="GI:220914711"
                     /db_xref="InterPro:IPR007247"
                     /db_xref="GeneID:7295770"
                     /translation="MNTIVAQPLTREAFSPYGEVIDTEGADHFPINNGRCERYHALAR
                     TDAIGPGARVIISIFKGAPYTLPLKLHMVERHPLGSQAFIPLSPRPFLVVVARDDGNR
                     PGRPQAFLTRPGQGVNYPPNVWHGVLTPIGEPQDFLVVDRAGDGNNLEEFFFPEPYEI
                     CLP"
     misc_feature    52453..52932
                     /locus_tag="Mnod_7820"
                     /note="ureidoglycolate hydrolase; Provisional; Region:
                     PRK03606"
                     /db_xref="CDD:179606"
     gene            52932..53144
                     /locus_tag="Mnod_7821"
                     /pseudo
                     /db_xref="GeneID:7295771"
     gene            complement(53147..53335)
                     /locus_tag="Mnod_7822"
                     /pseudo
                     /db_xref="GeneID:7295772"
     gene            53532..54347
                     /locus_tag="Mnod_7823"
                     /db_xref="GeneID:7295773"
     CDS             53532..54347
                     /locus_tag="Mnod_7823"
                     /inference="protein motif:PFAM:PF01650"
                     /note="PFAM: Peptidase C13, legumain asparaginyl
                     peptidase;
                     KEGG: azo:azo1258 hypothetical membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase C13, legumain asparaginyl peptidase"
                     /protein_id="YP_002490020.1"
                     /db_xref="GI:220914712"
                     /db_xref="InterPro:IPR001096"
                     /db_xref="GeneID:7295773"
                     /translation="MPSRSTYLILAVLAWWAAAEGPGPVLAGGGIAAPQQTSPSPQSR
                     QNSTETYIVSFGLFGGESVFESEARGAARILREWLRARPSPLVSFNSKWGGAATARTL
                     AAALRTAGAAMDPDNGTLVVVLTSHGTPEGLAIVAGTTSDTLTPPDLRRMLDASGAKY
                     RIVIISACYSGVFVPALADPRTLVITAAAADRPSFGCQDGARWTYFGDAFFNRSLRRA
                     PDLETAFEGARRLVTARERRDGFEPSRPQLAGGSEVLALLARHNRPARSGFVR"
     sig_peptide     53532..53615
                     /locus_tag="Mnod_7823"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.958) with cleavage site probability 0.915 at
                     residue 28"
     misc_feature    <53901..54275
                     /locus_tag="Mnod_7823"
                     /note="Peptidase C13 family; Region: Peptidase_C13;
                     cl02159"
                     /db_xref="CDD:261200"
     gene            54726..54974
                     /locus_tag="Mnod_7824"
                     /db_xref="GeneID:7295774"
     CDS             54726..54974
                     /locus_tag="Mnod_7824"
                     /inference="similar to AA sequence:KEGG:CBU_0921"
                     /note="KEGG: cbu:CBU_0921 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490021.1"
                     /db_xref="GI:220914713"
                     /db_xref="GeneID:7295774"
                     /translation="MTQAASELDFEAALRSPKSCFAEPQDVVAHPALSREMKLAILRE
                     WEQDARRLSASEGEGFYGGEESMLGRVEDAINLVRRQA"
     gene            complement(55099..55377)
                     /locus_tag="Mnod_7825"
                     /db_xref="GeneID:7295775"
     CDS             complement(55099..55377)
                     /locus_tag="Mnod_7825"
                     /inference="similar to AA sequence:KEGG:M446_7010"
                     /note="KEGG: met:M446_7010 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490022.1"
                     /db_xref="GI:220914714"
                     /db_xref="GeneID:7295775"
                     /translation="MPDSAMLSAPSPAVLAWSCGLASLSPGQPPCPGFRPDEWGETLA
                     NCRRFVDDFGIQAAELGWDTLTPFGVHPQHEIIRGDWSGVLMPCAYRV"
     gene            complement(55794..56318)
                     /locus_tag="Mnod_7826"
                     /db_xref="GeneID:7295776"
     CDS             complement(55794..56318)
                     /locus_tag="Mnod_7826"
                     /inference="protein motif:PFAM:PF05443"
                     /note="PFAM: ROSMUCR transcriptional regulator;
                     KEGG: met:M446_1153 MucR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="YP_002490023.1"
                     /db_xref="GI:220914715"
                     /db_xref="InterPro:IPR000637"
                     /db_xref="InterPro:IPR008807"
                     /db_xref="GeneID:7295776"
                     /translation="MNDKADVSTSQPGADTIELVAAIISAYVSNNIVPPADLPALIAT
                     AGQTLGELGKPSAPAAEETPKLTAAQIRKSVTPDHIISFIDGKPYKAMKRHLTKNGLT
                     PAEYRQTYGLPGDYPIVAPNYAAQRSELAKSLGLGQLRRKMAEKRAADEAKGSAPAGS
                     KKGRGRPRRAAASE"
     misc_feature    complement(55905..56279)
                     /locus_tag="Mnod_7826"
                     /note="ROS/MUCR transcriptional regulator protein; Region:
                     ROS_MUCR; pfam05443"
                     /db_xref="CDD:253198"
     gene            56692..57126
                     /locus_tag="Mnod_7827"
                     /pseudo
                     /db_xref="GeneID:7295777"
     gene            complement(57305..57445)
                     /locus_tag="Mnod_7828"
                     /db_xref="GeneID:7295778"
     CDS             complement(57305..57445)
                     /locus_tag="Mnod_7828"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490024.1"
                     /db_xref="GI:220914716"
                     /db_xref="GeneID:7295778"
                     /translation="MKSMSEMTHDITDSVKKMVGRLTGRGDHNTYANKPSGQASKLTE
                     KK"
     gene            59063..59350
                     /locus_tag="Mnod_7829"
                     /db_xref="GeneID:7295828"
     CDS             59063..59350
                     /locus_tag="Mnod_7829"
                     /inference="protein motif:PFAM:PF00166"
                     /note="PFAM: chaperonin Cpn10;
                     KEGG: met:M446_1770 chaperonin Cpn10"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperonin Cpn10"
                     /protein_id="YP_002490025.1"
                     /db_xref="GI:220914717"
                     /db_xref="InterPro:IPR001476"
                     /db_xref="GeneID:7295828"
                     /translation="MTFRPLHDRVVVRRIEAEEKTKGGIIIPDTAKEKPQEGEIVAVG
                     PGARDETGKLVPLDVKTGDRVLFGKWSGTEVRIDGQDLLIMKESDIMGVLA"
     misc_feature    59066..59344
                     /locus_tag="Mnod_7829"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    order(59066..59068,59072..59074,59078..59080,59087..59089,
                     59168..59173,59234..59236,59264..59266,59279..59281,
                     59285..59287,59333..59341)
                     /locus_tag="Mnod_7829"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    59114..59155
                     /locus_tag="Mnod_7829"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    order(59195..59197,59228..59230)
                     /locus_tag="Mnod_7829"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            59442..61091
                     /locus_tag="Mnod_7830"
                     /db_xref="GeneID:7295470"
     CDS             59442..61091
                     /locus_tag="Mnod_7830"
                     /inference="protein motif:TFAM:TIGR02348"
                     /note="TIGRFAM: chaperonin GroEL;
                     PFAM: chaperonin Cpn60/TCP-1;
                     KEGG: met:M446_5580 chaperonin GroEL"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="YP_002490026.1"
                     /db_xref="GI:220914718"
                     /db_xref="InterPro:IPR001844"
                     /db_xref="InterPro:IPR002423"
                     /db_xref="InterPro:IPR012723"
                     /db_xref="GeneID:7295470"
                     /translation="MAAKDVRFSSDARERMLRGVDILANAVKVTLGPKGRNVVLEKSF
                     GAPRITKDGVTVAKEIELADKFENMGAQMVREVASKTSDVAGDGTTTATVLAQAIVKE
                     GAKYVAAGMNPMDLKRGIDLAVAAAVKDITGRARKVASSEEIAQVGTISANGDKDIGQ
                     MIAQAMQKVGNEGVITAEEAKTAETELDVVEGMQFDRGYLSPYFITNAEKMIAELEDP
                     YILIHEKKLSSLQAMLPVLEAVVQTGKPLLIVAEDIEGEALATLVVNKLRGGLKVAAV
                     KAPGFGDRRKAMLEDIAILTAGQMIAEDLGIKLENVTLPMLGRAKRVRIEKETTTIID
                     GAGEKADIEARVAQIKAQIEETTSDYDREKLQERLAKLAGGVAIIRVGGSTEVEVREK
                     KDRVEDALHATRAAVEEGIVPGGGTALLRAKAAVAALNSDNSDVQSGIRIVLKALEAP
                     IRQIAENAGVEGSIVVGQISDNTGSETYGFNAQTEEYEDMLQAGIVDPAKVVRTALQD
                     AASVAGLLVTTEAMVADAPKKESPAPAMPGGGMGGMGGMDF"
     misc_feature    59442..61034
                     /locus_tag="Mnod_7830"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    59451..61016
                     /locus_tag="Mnod_7830"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    order(59451..59453,59463..59465,59514..59516,59547..59558,
                     59562..59564,59577..59582,59586..59588,59616..59618,
                     59622..59624,59646..59648,59658..59660,59667..59669,
                     60030..60032,60126..60128,60210..60212,60591..60593,
                     60597..60599,60816..60818,60984..60986,60993..61013)
                     /locus_tag="Mnod_7830"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(59532..59540,59700..59702,59712..59714,59889..59891,
                     60633..60635,60684..60686,60801..60803,60924..60926,
                     60930..60932)
                     /locus_tag="Mnod_7830"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(59766..59768,60741..60743,60795..60797,60822..60824,
                     60828..60833,60840..60842)
                     /locus_tag="Mnod_7830"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(59862..59864,59997..59999,60018..60020,60564..60566,
                     60666..60671)
                     /locus_tag="Mnod_7830"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            61785..61949
                     /locus_tag="Mnod_7831"
                     /db_xref="GeneID:7295471"
     CDS             61785..61949
                     /locus_tag="Mnod_7831"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490027.1"
                     /db_xref="GI:220914719"
                     /db_xref="GeneID:7295471"
                     /translation="MAAEAYFRLADFTAALTMSFVDGAAATVFGTGFFGFLASRFPRF
                     FSEAMTNLLV"
     gene            62164..62364
                     /locus_tag="Mnod_7832"
                     /db_xref="GeneID:7295472"
     CDS             62164..62364
                     /locus_tag="Mnod_7832"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_5571  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490028.1"
                     /db_xref="GI:220914720"
                     /db_xref="GeneID:7295472"
                     /translation="MQLVSSARHQFPAEIVQHAVWLYLRFTLSYPVQNTFYAQRHLIS
                     RRTLRLFRAGAADAWQAATAAA"
     gene            62762..64960
                     /locus_tag="Mnod_7833"
                     /db_xref="GeneID:7295473"
     CDS             62762..64960
                     /locus_tag="Mnod_7833"
                     /inference="similar to AA sequence:KEGG:M446_5389"
                     /note="KEGG: met:M446_5389 glycosyl transferase group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_002490029.1"
                     /db_xref="GI:220914721"
                     /db_xref="GeneID:7295473"
                     /translation="MRYLTCIAKKVISLQSALFNWMRGNQFHSEGFDHKFYREFYRDL
                     SGMHDPRLLAKHYAEHGRTEGRFPNEAAMRDALARLPADFNPEGYRRHNPNLGDLSDD
                     AARIHYATIGRLEGFAYRSDQIPGFDPDHFREIHPAFASADDATCQAAWQAEGGPNGP
                     PGTQVEHLRRLDLPLRTYPAAFPWRFYTRLYPRAAAHRWAALAHFLREGFAEVGTQIP
                     YGEDAPSFLIALGDHFAHRNDPAAVQAYELAVALGATPTVAHQKRLAEAYGRVGAWSA
                     ALDLYAHLFASGICEEAIMRCFVSAAAARQDWPRLFTLLPQALAQTGVMGDTIAREAT
                     ETYFAHRSRTARALYADHRRAEGDAVLAEAVERVADLMTACGSSRARTAPERPMIAIL
                     ADRLPDRARHRLDQRVALLGRIGFEARIFDLGTVRAFEEAVPAATAAILVRTPAWPTV
                     VQALVCAKRAGVPTLYETDELIVDPRFAPPPLEAFAGRIGERVHQDLVFGVALYRAAA
                     KLCDFGLAPNRVLAAHLDGIVARGRSFIVRDAIVPEARSPGVGEQVRLFLHAPQLQDV
                     RATEAAGAALLEAFRREPRIALTTAGFVTLDEAFAPFADRISQHGPVPDWEEALRGSD
                     LNLVLADEGEAAACVAVTGWLAAARFGIPTLASATRAYCEDLEDGVDVRLASKEAEWR
                     AALSALIAEPNLRQALGTAAARSAGSRYTENAAAEDCRAMIKHVGKLRQQ"
     misc_feature    <63989..>64207
                     /locus_tag="Mnod_7833"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    <64574..64912
                     /locus_tag="Mnod_7833"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    64661..64912
                     /locus_tag="Mnod_7833"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_2; pfam13524"
                     /db_xref="CDD:257844"
     gene            64957..65907
                     /locus_tag="Mnod_7834"
                     /db_xref="GeneID:7295474"
     CDS             64957..65907
                     /locus_tag="Mnod_7834"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: Methyltransferase type 11; Methyltransferase
                     type 12;
                     KEGG: met:M446_5912 methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_002490030.1"
                     /db_xref="GI:220914722"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:7295474"
                     /translation="MTIWNWFNWTTLRRNLAQRLDPDRARAGISTLAAPPSPAGDTVD
                     VLFERLISAAAATSRTLALDGSFFREIGPVVDGDSLEARSAEDLLAAAYRPGSRLLDF
                     GCGAMHGRSFIESLGYTWQGVDYLDGVSPLVRDEVARLGEAVQLYDGRVLPFADGEFD
                     VVWAMVSLHHVQHIDISFKEISRVLRPGGKLIGQVAYLEQMQDFGTFNFTPYGLKVAA
                     QNAGLRLARIDPKHDAFVFLLRRLIVTLTASDETPLNRMMGPEGFVHRTLIEAGRRLG
                     LDIRTTNLLRLLFCTHFVFEIEKTADGSVSSSGFGSAGVG"
     misc_feature    65248..65532
                     /locus_tag="Mnod_7834"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(65260..65280,65326..65331,65395..65403,65449..65451)
                     /locus_tag="Mnod_7834"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            65904..67271
                     /locus_tag="Mnod_7835"
                     /db_xref="GeneID:7295475"
     CDS             65904..67271
                     /locus_tag="Mnod_7835"
                     /inference="protein motif:PFAM:PF07719"
                     /note="PFAM: hypothetical protein;
                     KEGG: met:M446_5912 methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490031.1"
                     /db_xref="GI:220914723"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:7295475"
                     /translation="MTAPPVTLMRPVTSGRSRETAALASIPAAQAHPARPAERVGWAR
                     AGDDPVQAVRAAEALRDAGDVLEAAAILTQLCRLFAHLPYGWRELAVLRQRAGDAEGA
                     ARDFARALAADPGDLHTLMQSVRHSAGMGRLDEAQACLSAFVPRTPGQVRRAERLEQL
                     VAYMRRHPETEAMLLAMAIRTSPRHLGIAAVEARIAAALEERRPFSLIRLGDGEGAWI
                     SDPDEEGGRFRSLYRNNRKRILRTWFGNDDLIDRADFLALRDRFLATIPTASVVGVTY
                     PERIRHEYGIASLDGVPSCTNVLRHVSPLLHREGVSVCTHDIHLDLHLSGALQRLMTS
                     GHPVGLISCHPQLAGAISRRFGTRIAAALLIPEEKRFAPIIGATGMQGAHYPEAFGHV
                     MARLRQRDWSGIFWLVAAGYLGKLYCHEIAARGGVAVDIGSIADAWSGKATRPGLSNL
                     DPYRL"
     misc_feature    66042..66245
                     /locus_tag="Mnod_7835"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    66189..66383
                     /locus_tag="Mnod_7835"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     gene            67309..68130
                     /locus_tag="Mnod_7836"
                     /db_xref="GeneID:7295476"
     CDS             67309..68130
                     /locus_tag="Mnod_7836"
                     /inference="protein motif:PFAM:PF02585"
                     /note="PFAM: LmbE family protein;
                     KEGG: scl:sce6791 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_002490032.1"
                     /db_xref="GI:220914724"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="GeneID:7295476"
                     /translation="MACPNEMTPSPAITAEQVLKSLAARRPIDLAVAVVTAHPDDETI
                     GLGGVMAHLRNLTLLQLTDGAPLDPAFAAAAGFPTRQAYAAARRSELVDALAVLVEGR
                     VARQVFYEIPDGRLADHLDVAIERLVEDLIWVDAVLTHPYEGGHFDHDAAAFAVQEAC
                     RQLARRGDHTPARLEFTSYHHIRGRLRTGHFVDHVACPEIVVPLLPEAARRKEAAFAC
                     HRSQASNLAAFGYGPERFRPAPTYDFFQPPAGGEVMYGIEVWHGLQRAFASAVHA"
     misc_feature    67408..67752
                     /locus_tag="Mnod_7836"
                     /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; pfam02585"
                     /db_xref="CDD:251394"
     gene            68159..68278
                     /locus_tag="Mnod_7837"
                     /db_xref="GeneID:7295477"
     CDS             68159..68278
                     /locus_tag="Mnod_7837"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490033.1"
                     /db_xref="GI:220914725"
                     /db_xref="GeneID:7295477"
                     /translation="MIERQPSFVLGGLLGLALGAGVGLVTYPGLLRIPACPTS"
     gene            complement(68746..68919)
                     /locus_tag="Mnod_7838"
                     /db_xref="GeneID:7295478"
     CDS             complement(68746..68919)
                     /locus_tag="Mnod_7838"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490034.1"
                     /db_xref="GI:220914726"
                     /db_xref="GeneID:7295478"
                     /translation="MTGFLRGFVASYLLTAAYLGINLAAQTQTQSATRVVLAAATWPF
                     VFTPAFVHHHMCR"
     sig_peptide     complement(68836..68919)
                     /locus_tag="Mnod_7838"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.889) with cleavage site probability 0.350 at
                     residue 28"
     gene            complement(68939..69262)
                     /locus_tag="Mnod_7839"
                     /db_xref="GeneID:7295479"
     CDS             complement(68939..69262)
                     /locus_tag="Mnod_7839"
                     /inference="similar to AA sequence:KEGG:M446_6447"
                     /note="KEGG: met:M446_6447 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490035.1"
                     /db_xref="GI:220914727"
                     /db_xref="GeneID:7295479"
                     /translation="MAQPYEPHADAIRFAHQIVDEAGCKLAQAIHAEDQQAIAGARHD
                     LVVRIAQAIMDAEHVAADQARGEGETSRESMDEPGPQSRTWPALMFGLLQWASAAVRP
                     ARGAR"
     gene            69535..69789
                     /locus_tag="Mnod_7840"
                     /db_xref="GeneID:7295480"
     CDS             69535..69789
                     /locus_tag="Mnod_7840"
                     /inference="similar to AA sequence:KEGG:M446_5915"
                     /note="KEGG: met:M446_5915 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490036.1"
                     /db_xref="GI:220914728"
                     /db_xref="GeneID:7295480"
                     /translation="MQKIALGLCATAALLALPSTGSAQGFYFGPGGVQIDDGHRDYYE
                     ERRYRRERGMCRELRQACLYKEELGEEGMGNCRRYRRLCT"
     sig_peptide     69535..69606
                     /locus_tag="Mnod_7840"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.903 at
                     residue 24"
     gene            70108..71745
                     /locus_tag="Mnod_7841"
                     /db_xref="GeneID:7295481"
     CDS             70108..71745
                     /locus_tag="Mnod_7841"
                     /inference="protein motif:PFAM:PF01610"
                     /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
                     protein;
                     KEGG: mlo:mll5961 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS204/IS1001/IS1096/IS1165 family
                     protein"
                     /protein_id="YP_002490037.1"
                     /db_xref="GI:220914729"
                     /db_xref="InterPro:IPR002560"
                     /db_xref="GeneID:7295481"
                     /translation="MILSSSLPGCTIERVFRHTDHLVVIAHGRRCHGRCPTCGTPSSA
                     VHSRYDRRPADLPSMGQPVTLRLRIRRFYCHHPACRRRTFAEPLPRLIPPRARRTRRL
                     AQAQTRIGLAVGGEAGARLTGHLGMQTSPDTILRLVHRLPLPRANAPRAVGIDDWAIR
                     KGRSYGTLLVDLERRCPIDLLPDRSGATVAAWLRRHPSIQIVARDRSTEYARAATAGA
                     PAALQVADRWHLLLNLRQVLERWLGRVHGRLRQLPPLASGDGRQPGERPRAYRRSAAE
                     IAVSLDSRARRLAAYEDVRRRHLAGETLLAIGRATGLARATVRKYAQAESFPERAIRR
                     PNPSRLDPYLAHLEQRMAEGCENAMALWREIRRQGFAGTHRQVHRFVAERRTARKWLS
                     QPASTSTEAIRPSPIASPKQLAWILVQPLATLQPRAAADLARIRQDPEAARIADLARR
                     FTMLVRACGLGGDRPADPASELDRWLLETRNCGVAALETFAAGLAQDGAAVRAALTTS
                     WSNAQAEGQISRLKMLKRTMYGRASFALLRSRILIAA"
     misc_feature    70207..70344
                     /locus_tag="Mnod_7841"
                     /note="zinc-finger of transposase
                     IS204/IS1001/IS1096/IS1165; Region: zf-ISL3; pfam14690"
                     /db_xref="CDD:258828"
     misc_feature    70423..71739
                     /locus_tag="Mnod_7841"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    70561..>70737
                     /locus_tag="Mnod_7841"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     misc_feature    <71521..71730
                     /locus_tag="Mnod_7841"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            complement(71860..72309)
                     /locus_tag="Mnod_7842"
                     /db_xref="GeneID:7295482"
     CDS             complement(71860..72309)
                     /locus_tag="Mnod_7842"
                     /inference="protein motif:TFAM:TIGR02044"
                     /note="TIGRFAM: Cu(I)-responsive transcriptional
                     regulator;
                     PFAM: regulatory protein MerR; Transcription regulator
                     MerR DNA binding;
                     KEGG: oan:Oant_4049  transcriptional regulator, MerR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MerR family"
                     /protein_id="YP_002490038.1"
                     /db_xref="GI:220914730"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR011789"
                     /db_xref="InterPro:IPR015358"
                     /db_xref="GeneID:7295482"
                     /translation="MNIGQAAKASGVSAKMIRYYEQTGLIPQADRKASGYRDYSDVDV
                     HMLRFIRRARGLGFSVAKINELLGLWRDESRQSAEVKRLAQAHIDELERKIKGLQDIE
                     HTLTMLVNACEGDHRPHCPILKHLENGEDNEDLSIHPRKGAVAGLAY"
     misc_feature    complement(71932..72309)
                     /locus_tag="Mnod_7842"
                     /note="Cu(I)-responsive transcriptional regulator; Region:
                     CueR; TIGR02044"
                     /db_xref="CDD:131099"
     misc_feature    complement(71932..72309)
                     /locus_tag="Mnod_7842"
                     /note="Helix-Turn-Helix DNA binding domain of CueR-like
                     transcription regulators; Region: HTH_CueR; cd01108"
                     /db_xref="CDD:133383"
     misc_feature    complement(order(72199..72207,72256..72258,72298..72306))
                     /locus_tag="Mnod_7842"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133383"
     misc_feature    complement(order(71932..71937,71944..71946,71950..71952,
                     71956..71970,71983..71985,72004..72009,72016..72018,
                     72028..72030,72046..72048,72058..72060,72067..72069,
                     72076..72081,72100..72102,72112..72114,72139..72144,
                     72154..72156,72163..72165))
                     /locus_tag="Mnod_7842"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133383"
     misc_feature    complement(order(71950..71952,71974..71976,72079..72081))
                     /locus_tag="Mnod_7842"
                     /note="copper binding site [ion binding]; other site"
                     /db_xref="CDD:133383"
     gene            complement(72364..74871)
                     /locus_tag="Mnod_7843"
                     /db_xref="GeneID:7295483"
     CDS             complement(72364..74871)
                     /locus_tag="Mnod_7843"
                     /inference="protein motif:TFAM:TIGR01525"
                     /note="TIGRFAM: ATPase, P-type (transporting), HAD
                     superfamily, subfamily IC; copper ion binding protein;
                     copper-translocating P-type ATPase; heavy metal
                     translocating P-type ATPase;
                     PFAM: Haloacid dehalogenase domain protein hydrolase;
                     Heavy metal transport/detoxification protein; E1-E2
                     ATPase-associated domain protein;
                     KEGG: oan:Oant_3240 heavy metal translocating P-type
                     ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="YP_002490039.1"
                     /db_xref="GI:220914731"
                     /db_xref="InterPro:IPR001756"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR001877"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR006122"
                     /db_xref="InterPro:IPR006403"
                     /db_xref="InterPro:IPR006416"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="GeneID:7295483"
                     /translation="MNAPVRPADLSSASISLPIEGMTCASCVGRVERALKAIPGVETV
                     SANLATERASITTNAPVDRSKLVGAVENAGYSVPAAFSAPASSIELSVEGMTCASCIG
                     RVERALKAVPGVTQASVNLATERATIEGSADSGALIAAIEQAGYGATVIGKAVNAGGQ
                     DDTAEQAEKKETERRELKRDFTIAAVLTAPVFVLEMGSHLIPGVHGAIDATIGMQWSW
                     YIQFALTTLVLFVPGIRFYEKGLPALWRLGPDMNSLVAVGTLAAYGYSLVATFAPAFL
                     PPGTINVYFEAAAVIVTLILLGRLLEARAKGRTSEAIKRLVGLQAKTARVRRDGKTVD
                     LPIASVAAGDIIEVRPGERIPVDGEVTEGESYVDESMITGEPIPVSKALGSEVVGGTV
                     NQKGAFAFRATAVGGNTVLSQIIRMVEEAQGSKLPIQAMVDKVTMWFVPAVMAVAALT
                     FAAWLYFGPSPALTFALVNAVAVLIIACPCAMGLATPTSVMVGTGRGAELGVLFRKGE
                     ALQLLKDSKVVAVDKTGTLTEGKPALTDLELAIGFDRKAVLGLVAAVEAKSEHPIARA
                     IVEAAHNEGLELPMVSGFESVTGFGVKATVDGKPIEIGADRYMAELGHDVAGFATVAE
                     RLANEGKSPLYAAIGGKLAAIIAVADPIKETTPPAIRALHDLGLKVAMITGDNARTAK
                     AIAARLGIDEVVAEVLPDGKVEAVRRLKSQYGKVAFVGDGINDAPALAEADVGLAIGT
                     GTDIAIEAAEVVLMSGSLQGVPNAIALSKATIGNIRQNLFWAFAYNTALIPVAAGVLF
                     PAFGILLSPVFAAGAMALSSVFVLGNALRLRRFKVAH"
     misc_feature    complement(74641..74823)
                     /locus_tag="Mnod_7843"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(74791..74793,74800..74808))
                     /locus_tag="Mnod_7843"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    complement(72379..74613)
                     /locus_tag="Mnod_7843"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    complement(74425..74607)
                     /locus_tag="Mnod_7843"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(74572..74574,74581..74589))
                     /locus_tag="Mnod_7843"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    complement(73339..74004)
                     /locus_tag="Mnod_7843"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(72655..>72906)
                     /locus_tag="Mnod_7843"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    complement(72850..72852)
                     /locus_tag="Mnod_7843"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            75047..75748
                     /locus_tag="Mnod_7844"
                     /db_xref="GeneID:7295484"
     CDS             75047..75748
                     /locus_tag="Mnod_7844"
                     /inference="similar to AA sequence:KEGG:Oant_4519"
                     /note="KEGG: oan:Oant_4519  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_002490040.1"
                     /db_xref="GI:220914732"
                     /db_xref="GeneID:7295484"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGVPA"
     misc_feature    75074..75703
                     /locus_tag="Mnod_7844"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    75245..75571
                     /locus_tag="Mnod_7844"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(76023..76886)
                     /locus_tag="Mnod_7845"
                     /db_xref="GeneID:7295485"
     CDS             complement(76023..76886)
                     /locus_tag="Mnod_7845"
                     /inference="similar to AA sequence:KEGG:M446_4335"
                     /note="KEGG: met:M446_4335 porin"
                     /codon_start=1
                     /transl_table=11
                     /product="porin"
                     /protein_id="YP_002490041.1"
                     /db_xref="GI:220914733"
                     /db_xref="GeneID:7295485"
                     /translation="MIRKLLLTSAATALLTGAASAADLPRREPPPPPVFTPVPVFTWT
                     GFYAGFNAGYGFDTGPNRGPTVIGVGPATGLVIVPTVIAFRNESNLDGFTGGGQIGYN
                     YQFTPGAGVVIGLEADAQYVDFGRDRNRFIATGPIAAQRVFNPAGLAGLDFFGTVRGR
                     LGYAWDRTLIYGTGGFAYGSGGGRDFGLPNDDDFQTGWTAGGGVEYALPTDSFLNFFR
                     SSSVTVKVEGLYVNLDRGRRFNGAFAVNNAGAIITTASPGVVVVNAGQFRRDTEFAVV
                     RAGLNYKFGTW"
     sig_peptide     complement(76821..76886)
                     /locus_tag="Mnod_7845"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 22"
     misc_feature    complement(76035..76883)
                     /locus_tag="Mnod_7845"
                     /note="Outer membrane protein beta-barrel domain; Region:
                     OMP_b-brl; cl17254"
                     /db_xref="CDD:266589"
     gene            complement(78182..78886)
                     /locus_tag="Mnod_7846"
                     /db_xref="GeneID:7295486"
     CDS             complement(78182..78886)
                     /locus_tag="Mnod_7846"
                     /inference="similar to AA sequence:KEGG:M446_1866"
                     /note="KEGG: met:M446_1866  insertion sequence
                     transposase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="insertion sequence transposase-like protein"
                     /protein_id="YP_002490042.1"
                     /db_xref="GI:220914734"
                     /db_xref="GeneID:7295486"
                     /translation="MILNALALTLKRQAQGDFRGRHFEATLIVQAVSWSLRDALSDRD
                     IAEMLLERGLTVDHSTLTRWVLADAPAIERRLRRFRKPPCGSVRVDETDIRVRGQWRS
                     PDRAIDKPGEAVDVLLTANRDLDAAKRLFRNGAGPYPPAIAESRKAGLLPRTPTHHVS
                     KPLQQGIASDPFRVKRAMPRVGGFRSFKTARRTIQGVKARLWRRKGFGFLGAWTVREQ
                     NQLLAHCFGLPVANKA"
     misc_feature    complement(78269..78637)
                     /locus_tag="Mnod_7846"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     gene            complement(79184..79372)
                     /locus_tag="Mnod_7847"
                     /pseudo
                     /db_xref="GeneID:7295487"
     gene            79436..80137
                     /locus_tag="Mnod_7848"
                     /db_xref="GeneID:7295488"
     CDS             79436..80137
                     /locus_tag="Mnod_7848"
                     /inference="similar to AA sequence:KEGG:Oant_4519"
                     /note="KEGG: oan:Oant_4519  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_002490043.1"
                     /db_xref="GI:220914735"
                     /db_xref="GeneID:7295488"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGAPA"
     misc_feature    79463..80092
                     /locus_tag="Mnod_7848"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    79634..79960
                     /locus_tag="Mnod_7848"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(80175..80351)
                     /locus_tag="Mnod_7849"
                     /pseudo
                     /db_xref="GeneID:7295489"
     gene            complement(80494..81264)
                     /locus_tag="Mnod_7850"
                     /db_xref="GeneID:7295490"
     CDS             complement(80494..81264)
                     /locus_tag="Mnod_7850"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
                     domain protein;
                     KEGG: pap:PSPA7_0908 3-oxoacyl-[acyl-carrier-protein]
                     reductase (3-ketoacyl-acyl carrier protein reductase)"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_002490044.1"
                     /db_xref="GI:220914736"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:7295490"
                     /translation="MERFTGKAVAITGGGSGIGKATAARFVAEGARVVINGRDVAKLE
                     ATAREIDPSGRNVVVSAGDIADPATGAALVEAAVSRFGQLDVLVNNAGVFNPKPFLEL
                     TEADYDWYLDTILKGKFFTAQAAAKAMKDRGGAIVQTGSMWAIQAIGATPSAAYSAAN
                     AGVHAMVRNLAIELAPFKIRINAVAPAVIETPVYSTFMSAQQVRDVLPTFNAFHPLGR
                     NGQPGDVAEAILFLASDQAAWITGTVLPVDGGVTAGRQ"
     misc_feature    complement(80512..81258)
                     /locus_tag="Mnod_7850"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(80521..81240)
                     /locus_tag="Mnod_7850"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(80689..80694,80698..80709,80785..80787,
                     80797..80799,80842..80850,80926..80928,80989..80997,
                     81073..81081,81148..81156,81211..81222,81226..81228))
                     /locus_tag="Mnod_7850"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(80785..80787,80797..80799,80842..80844,
                     80923..80925))
                     /locus_tag="Mnod_7850"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            81386..81883
                     /locus_tag="Mnod_7851"
                     /db_xref="GeneID:7295491"
     CDS             81386..81883
                     /locus_tag="Mnod_7851"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: pat:Patl_4127 TetR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="YP_002490045.1"
                     /db_xref="GI:220914737"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:7295491"
                     /translation="MDTAQAIMDAAERRIRSAGYSGFSFREIADEIGIKSASVHYHFP
                     TKEALAAAVTRRYNDRIAASIDAQIAAGTAPVEAWRHVFRAALADGARMCLCGALGVT
                     SGDLSEEVAAEVRRFFTYGVDKLKAGGLSEARAMQVLATLEGAILIASVRSDPAFFDL
                     STSDL"
     misc_feature    81389..81832
                     /locus_tag="Mnod_7851"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    81404..81544
                     /locus_tag="Mnod_7851"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(82602..83336)
                     /locus_tag="Mnod_7852"
                     /db_xref="GeneID:7295492"
     CDS             complement(82602..83336)
                     /locus_tag="Mnod_7852"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490046.1"
                     /db_xref="GI:220914738"
                     /db_xref="GeneID:7295492"
                     /translation="MADPHCVGVGLGKPLHLGGWHEPVFAPGSSLVDRAVLANAGDHV
                     LQGVPLRGGLTIWDDPRSPACIHSDRQIKCEWTMDRTPPAAFANRYTCSIVFNGVSTK
                     DLDSFFDNIAGFLAAVVIDHLVLSYDEVRYEEINKVVSRAHSITAVELRKQSLFQMQR
                     FNIDNEWCYADDSLFYLVDENAPVDERITYLEYFLMLCARRLQHQWHIIEGRVNWLLK
                     ASSIHLEYRDLYFRPMTAGLVRGDKS"
     gene            complement(83329..85683)
                     /locus_tag="Mnod_7853"
                     /db_xref="GeneID:7295493"
     CDS             complement(83329..85683)
                     /locus_tag="Mnod_7853"
                     /inference="protein motif:PFAM:PF00384"
                     /note="PFAM: molybdopterin oxidoreductase; molydopterin
                     dinucleotide-binding region;
                     KEGG: bja:bll6273 biotin sulfoxide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="YP_002490047.1"
                     /db_xref="GI:220914739"
                     /db_xref="InterPro:IPR006656"
                     /db_xref="InterPro:IPR006657"
                     /db_xref="GeneID:7295493"
                     /translation="MRDSRFGNPERESEVPFKPHSSHWGVFSARMIDGELEVRPYEGD
                     PDPNQIIENFPGALRHRARIAQPMVRRGWLERGPGPDEKRGQDEFVPMAWQEVLDLLG
                     RELVRVRDGFGPEAIFGGSYGWSSAGRFHHAQSQIHRFLNIACGGYVRSVTSYSSGSS
                     QVLIPHILGNHEELAKHNVTWEQVEKDSEIVIAFGGMALKNSMVAGGGISKHVERGVM
                     QRAAARGCEFILVSPLASDLPEEARPEWVSLIPASDTALMMAMVHTLVVEGRHDRAFL
                     ERYTVGWPTFERYLLGEADGIPKDAHWAAPLTGVPADAIMALARRLHGKRALVVVSHS
                     LQRARYGEQPVWMGMVLAAALGQIGLSGGGYAYPLGAIAYYGRRKNAVKLPTLSQGSN
                     SVREFIPVARIADMLLGPGEAYRFNGKTLTYPEIKLIYWAGGNPFHHHQDLNRLKKAF
                     AAVDTLVVHELAWTATARHADIVLPCTMTLERDDIGGSSNDPLLVPMRQIAPPYGEAR
                     DDFAIFADLAERLGARDAFTEGRTVRQWLEHLYEPTRLGLVQLNLPAPSFEDFWESSG
                     ILVPQGPDDGGNLRAFREDPLASPLETPSGKLEIFSETIASFGEADCPGHPAWLGSGY
                     LPTESAPLVLVSNQPRTRLHSQLDFGGHSGSGKHRGREIASMHPKDAAERGIADGDIV
                     RLFNERGACLAAIALTEDIRPGVIQLPTGAWYDPADPTEEKTLCVHGNPNVLTEDVGT
                     SALAQGCTGQLTTVEVERFDGNLPPIRAYDPPLSLPAPASHLDG"
     misc_feature    complement(83824..85629)
                     /locus_tag="Mnod_7853"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a  large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:263922"
     misc_feature    complement(83365..85620)
                     /locus_tag="Mnod_7853"
                     /note="molybdopterin guanine dinucleotide-containing
                     S/N-oxide reductases; Region: bisC_fam; TIGR00509"
                     /db_xref="CDD:233001"
     misc_feature    complement(order(84238..84240,84253..84258,84292..84294,
                     84301..84309,84379..84387,84688..84690,84922..84924,
                     84985..84993,85081..85086,85093..85095,85099..85104,
                     85213..85221,85225..85227,85534..85536))
                     /locus_tag="Mnod_7853"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:238218"
     misc_feature    complement(83410..83793)
                     /locus_tag="Mnod_7853"
                     /note="The MopB_DMSOR-BSOR-TMAOR CD contains
                     dimethylsulfoxide reductase (DMSOR), biotin sulfoxide
                     reductase (BSOR),  trimethylamine N-oxide reductase
                     (TMAOR) and other related proteins. DMSOR always catalyzes
                     the reduction of DMSO to dimethylsulfide, but its...;
                     Region: MopB_CT_DMSOR-BSOR-TMAOR; cd02793"
                     /db_xref="CDD:239194"
     misc_feature    complement(order(83434..83439,83488..83490,83554..83556,
                     83746..83754,83758..83760,83767..83772,83776..83778))
                     /locus_tag="Mnod_7853"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239194"
     gene            complement(85807..87045)
                     /locus_tag="Mnod_7854"
                     /db_xref="GeneID:7295494"
     CDS             complement(85807..87045)
                     /locus_tag="Mnod_7854"
                     /inference="protein motif:PFAM:PF00155"
                     /note="PFAM: aminotransferase class I and II;
                     KEGG: bvi:Bcep1808_6702 aminotransferase, class I and II"
                     /codon_start=1
                     /transl_table=11
                     /product="class I and II aminotransferase"
                     /protein_id="YP_002490048.1"
                     /db_xref="GI:220914740"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:7295494"
                     /translation="MENVAARSGSPVSKVIDGSIFDEIIERRDTNSLKWTYSEKLLAP
                     EEVAAGPLPMWVADTDWRAPAPVIDALQDAIKHGVFGYPAGATNGYMKAVTDWQARRF
                     GWEIAEEWVTQTAGIITALKTAVQAFSSPGDSILIQPPVYSHFHDDVLVNGRQLALAP
                     LLRWENGYRFDESIFEAAIGEGTKLFILSNPHNPTGNVWSEAELRVMGEICLRHNVLV
                     LSDEIHQDLIINPEKRHIPFASISEEFAQNSITCTAPSKTFNLAGLQCANIFIPNARI
                     RNQFARQYNRNVYPRVNVLGMVATEAAYSEGEPWLEEMLIYLRTNHDHFASSINNSLS
                     KIKVLPADSLYLAWMDCRGLGLDAETLDKLMLTKARVWLDKGQKFGAEGRGYMRANLG
                     CPRSTVDVAINRLISTFRAA"
     misc_feature    complement(85831..86985)
                     /locus_tag="Mnod_7854"
                     /note="putative C-S lyase; Region: C_S_lyase_PatB;
                     TIGR04350"
                     /db_xref="CDD:213963"
     misc_feature    complement(85831..86892)
                     /locus_tag="Mnod_7854"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(86251..86253,86275..86280,86284..86286,
                     86374..86376,86467..86469,86620..86622,86692..86700))
                     /locus_tag="Mnod_7854"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(86149..86151,86158..86160,86251..86259,
                     86395..86397,86590..86592,86689..86691))
                     /locus_tag="Mnod_7854"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(86275..86277)
                     /locus_tag="Mnod_7854"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(87313..88503)
                     /locus_tag="Mnod_7855"
                     /db_xref="GeneID:7295495"
     CDS             complement(87313..88503)
                     /locus_tag="Mnod_7855"
                     /inference="protein motif:PFAM:PF02746"
                     /note="PFAM: Mandelate racemase/muconate lactonizing
                     protein;
                     KEGG: pat:Patl_1686 mandelate racemase/muconate
                     lactonizing-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing protein"
                     /protein_id="YP_002490049.1"
                     /db_xref="GI:220914741"
                     /db_xref="InterPro:IPR001354"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="GeneID:7295495"
                     /translation="MMKIIKIETLEIELSGQCGIASWRPVFVRIHTDAGITGMGEVGL
                     AYGTGTPAAAPMIRIIGERLVLGRDPNDTETIWEHMLRRSFWAEGGGPVVFGAMSAID
                     AALWDIKGKAAGLPVHRLLGAETPLPLRCYASQMQFGWEDISVLKNSPSEYRDTAQTA
                     RAQGYDCVKVSPIYVAPDGQRARNRGVFTPEFRKLARARMEAVRDGVGPDADIILELN
                     SLTSTAGALQLAELFSDLGILFMEEPTHSNSPEAFVKVSSRSPIPLATGERLYTRWGF
                     LPYLQAGSIDMIQPDMGLVGGVSEGIKIAHLAHAFDVGFQAHICGSPLATAIALQVEA
                     AIPNLEIHEHHTFALKSCNRDLFEEDLQPVNGHLAVPTAPGFGMTLRKDAEKRMEISE
                     VSLA"
     misc_feature    complement(87352..88503)
                     /locus_tag="Mnod_7855"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    complement(87367..88497)
                     /locus_tag="Mnod_7855"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily. Enzymes of this subgroup share three
                     conserved carboxylate ligands for the essential divalent
                     metal ion (usually Mg2+), two aspartates and a glutamate,
                     and conserved catalytic residues; Region: MR_like;
                     cd03316"
                     /db_xref="CDD:239432"
     misc_feature    complement(order(87475..87477,87550..87552,87631..87633,
                     87700..87702,87778..87780,87856..87858,87976..87978,
                     87997..87999))
                     /locus_tag="Mnod_7855"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239432"
     gene            complement(88618..89952)
                     /locus_tag="Mnod_7856"
                     /db_xref="GeneID:7295496"
     CDS             complement(88618..89952)
                     /locus_tag="Mnod_7856"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_4843 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490050.1"
                     /db_xref="GI:220914742"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295496"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     misc_feature    complement(89491..89889)
                     /locus_tag="Mnod_7856"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    complement(88645..89124)
                     /locus_tag="Mnod_7856"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(88633..>88863)
                     /locus_tag="Mnod_7856"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            complement(90143..90928)
                     /locus_tag="Mnod_7857"
                     /db_xref="GeneID:7295497"
     CDS             complement(90143..90928)
                     /locus_tag="Mnod_7857"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: pmy:Pmen_3557 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490051.1"
                     /db_xref="GI:220914743"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:7295497"
                     /translation="MSQATTIDRANAATCEQPAIILDKVNKWYGAMHVLRDVSMTVSQ
                     KERVVVCGPSGSGKSTMIRCINRLEMHQEGRIIVDGTELTDDLRALDTIRREVGMVFQ
                     NFNLFPHLTILENCTFAPIWVRKMPKAEAEELAMSYLRRVKIPEQAKKYPGQLSGGQQ
                     QRVAIARALCMRPKIMLFDEPTSALDPEMIKEVLDTMIGLAEDGMTMVCVTHEMGFAR
                     KVADRVVFMDRGEIVEAGSPASIFEDPQTDRLKQFLSQILRGH"
     misc_feature    complement(90155..90877)
                     /locus_tag="Mnod_7857"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(90233..90871)
                     /locus_tag="Mnod_7857"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(90752..90775)
                     /locus_tag="Mnod_7857"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(90293..90295,90389..90394,90623..90625,
                     90749..90757,90761..90766))
                     /locus_tag="Mnod_7857"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(90623..90634)
                     /locus_tag="Mnod_7857"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(90437..90466)
                     /locus_tag="Mnod_7857"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(90389..90406)
                     /locus_tag="Mnod_7857"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(90371..90382)
                     /locus_tag="Mnod_7857"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(90287..90307)
                     /locus_tag="Mnod_7857"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(90940..92124)
                     /locus_tag="Mnod_7858"
                     /db_xref="GeneID:7295498"
     CDS             complement(90940..92124)
                     /locus_tag="Mnod_7858"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: bja:blr2913 ABC transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_002490052.1"
                     /db_xref="GI:220914744"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:7295498"
                     /translation="MSQTTTAKISEAAGDPVPSIAGIPAAPITRAPPLAAGAGPLGWA
                     RTNLFSSIPSTIVTLVLLILLARWATEFVNWAILHAVWSVPNTATGPDTAACRDAKGI
                     GACWAVISEKYRFILFGRYLYEEQWRPAIVIVLFIGLYVVSAMRQFWRKELILIWITT
                     LTVVGVLMWGGVFGLTYVPQDSWGGLPITLILATFGLACAFPLSILVALGRRATNLPA
                     IRVLCTVYVELIRGVPLITVLFMASVMFPLFMPAGLNPDKLLRAQVAVILFAAAYLAE
                     VVRGGLQTLPKGQYEAADALGLGYWHKTAFIILPQALRLVIPPLVNTFIGFFKDTSLV
                     LIIGLFDLLTAGKVAMADLVWQPYSTEVYLVLAAIYFAFCYVMARYSRGLEQGFSRST
                     KR"
     misc_feature    complement(90952..91626)
                     /locus_tag="Mnod_7858"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(91012..91569)
                     /locus_tag="Mnod_7858"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(91015..91020,91024..91029,91036..91041,
                     91075..91080,91117..91122,91129..91140,91159..91161,
                     91168..91173,91213..91215,91264..91266,91273..91278,
                     91288..91290,91294..91299,91306..91308,91312..91314,
                     91318..91323,91396..91398,91402..91407,91414..91443,
                     91447..91458,91486..91488,91504..91509,91516..91521))
                     /locus_tag="Mnod_7858"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(91123..91140,91396..91440))
                     /locus_tag="Mnod_7858"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(91039..91041,91075..91077,91084..91086,
                     91120..91122,91336..91338,91396..91398))
                     /locus_tag="Mnod_7858"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(91192..91194,91204..91209,91225..91263))
                     /locus_tag="Mnod_7858"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(92128..93339)
                     /locus_tag="Mnod_7859"
                     /db_xref="GeneID:7295499"
     CDS             complement(92128..93339)
                     /locus_tag="Mnod_7859"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: bbr:BB4447  amino acid ABC transporter permease
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_002490053.1"
                     /db_xref="GI:220914745"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:7295499"
                     /translation="MSGAVLDPRLHPVRAAPRKKLNFSWSDPRFRNIVWQVVILSAVT
                     AVAWFLISNTNRNLEQRRIATGFAFLSRTAGIPIGEHLIDYDPAVSTYGRALLIGVLN
                     TLKVAVVGVVLATLWGTLLGIARLSRNWLVSKLAAVYVEIIRDVPLLLQLLFWYSILQ
                     ALPAPRQSFHPVPGVFLSNRGVKIPFVEWDEPYWWALLALTVGAVGTWAWSRAATRRQ
                     ERIGTRPKVWPMAILLMVGFPVAVWAGLGAPFVADVPELRGFDFNGGGTISPEYGALT
                     MGLVIYTAAFIAEIVRSGILAVPTGQWEAAAALGVRRGIILRKIVLPQALRVIIPPMT
                     SQYLNLIKNSSLAVAIGYQDIVSIANTTLNQTGQAIEGIAMVMLVYLVISLSISLFMN
                     WYNGRIALVER"
     misc_feature    complement(92131..93270)
                     /locus_tag="Mnod_7859"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     BatB; COG4597"
                     /db_xref="CDD:226960"
     misc_feature    complement(<92872..93057)
                     /locus_tag="Mnod_7859"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:260417"
     misc_feature    complement(92173..>92505)
                     /locus_tag="Mnod_7859"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(92173..92178,92185..92190,92197..92202,
                     92206..92211,92218..92223,92251..92256,92293..92298,
                     92305..92316,92335..92337,92344..92349,92389..92391,
                     92440..92442,92449..92454,92464..92466,92470..92475,
                     92482..92484,92488..92490,92494..92499))
                     /locus_tag="Mnod_7859"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(92368..92370,92380..92385,92401..92439))
                     /locus_tag="Mnod_7859"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(92221..92223,92251..92253,92260..92262,
                     92296..92298))
                     /locus_tag="Mnod_7859"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     gene            complement(93464..94489)
                     /locus_tag="Mnod_7860"
                     /db_xref="GeneID:7295500"
     CDS             complement(93464..94489)
                     /locus_tag="Mnod_7860"
                     /inference="protein motif:PFAM:PF00497"
                     /note="PFAM: extracellular solute-binding protein family
                     3;
                     KEGG: hch:HCH_05807 amino acid ABC transporter periplasmic
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 3 extracellular solute-binding protein"
                     /protein_id="YP_002490054.1"
                     /db_xref="GI:220914746"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:7295500"
                     /translation="MNRVLAGAILFGALAAFADPSWAQGSGSKTIDDIRARGQLVCGV
                     TAGAAGFSLPDSRGVMRGIDADICRAVAAATLGEADKVRYVPTTVTNRFTALQSGEID
                     ILVRSTTWTLSREANLGLEFAGVYFFDGTGFMVNKSLGVKSSKELNGATICIQPGTST
                     ELAVADYFREHGMKFKPILIQDPAETQNTFISGRCDAYSMDISALASFRFQQGPKKDD
                     YVLLPEVISKEPVGVMVRKGDEKFFDLVRWSMIALLQGEESGVTQANVDQMLDSKDPT
                     IRRMLGLEGDLGKAMGVDNKWAYKILKSVGNFGEIWERNIAPLGISRGINALWTKGGL
                     HYPPPMR"
     sig_peptide     complement(94433..94489)
                     /locus_tag="Mnod_7860"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.895 at
                     residue 19"
     misc_feature    complement(93680..94372)
                     /locus_tag="Mnod_7860"
                     /note="Bacterial periplasmic substrate-binding proteins;
                     Region: PBPb; smart00062"
                     /db_xref="CDD:214497"
     misc_feature    complement(93710..94372)
                     /locus_tag="Mnod_7860"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(93887..93889,94013..94015,94148..94150,
                     94223..94225,94346..94348))
                     /locus_tag="Mnod_7860"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(93908..93910,93926..93928,93938..93940))
                     /locus_tag="Mnod_7860"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(93794..93805)
                     /locus_tag="Mnod_7860"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(95156..95977)
                     /locus_tag="Mnod_7861"
                     /db_xref="GeneID:7295501"
     CDS             complement(95156..95977)
                     /locus_tag="Mnod_7861"
                     /inference="protein motif:PFAM:PF00165"
                     /note="PFAM: helix-turn-helix- domain containing protein
                     AraC type;
                     KEGG: met:M446_1529 AraC family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002490055.1"
                     /db_xref="GI:220914747"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="GeneID:7295501"
                     /translation="MIWQTIAAPLSVPSPRPMTVRAQSIPARHYFSKHVHRWNQVVYA
                     IVGALTVATEGRSFVISPEQAVWLPTGLPHRVGSLLGAEFRNLWIADETGVGLPKSPT
                     VFNVLPLLQALIIEAAEIDGQEDQDGYAGRIAGLILDQLQRARPLPAALSWPRRGPLA
                     RICEAVYADPRDPRGPEERGKELGMSGRTLARHFQAELGISLRSWRRLLRLFKAIELL
                     GGGLDVTRTAIELDYDSTSAFIYAFRAEMGCSPQAYVRGHAAHRRFPTCCGNAPA"
     misc_feature    complement(<95711..95896)
                     /locus_tag="Mnod_7861"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    complement(95189..95566)
                     /locus_tag="Mnod_7861"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     gene            complement(96123..97355)
                     /locus_tag="Mnod_7862"
                     /db_xref="GeneID:7295502"
     CDS             complement(96123..97355)
                     /locus_tag="Mnod_7862"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: met:M446_1531 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_002490056.1"
                     /db_xref="GI:220914748"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:7295502"
                     /translation="MSQAAIEPAPKLAPALPARSGTGNVARLAIAQALAGANSTVVYA
                     TGAIVGNMLAPSPVLATLPISIFVVGMAACTLPAGAIARRHGRRAAFLAGTGCGVLVG
                     LLSALAIVSGSFWLFCAATFFGGAYAAVVLSFRFAAADCVSPEQRPRALSAVMAGGVF
                     AGVIGPQLVTHTMDLWPPYLFAATFLAQAVVAAVSALVLLGVRLPMPSAAETSRGRPL
                     GAIARQPRFITAVICGVVSYLLMNFLMTAAPLAMHLCGLSQEDANLGLQWHVIAMYAP
                     SFVTGRLIARFGAPRVVAAGLALTAASAAVGLAGVDVAHFWLTLVLLGVGWNFGFVGA
                     SALVLECHRPEERTRVQSLNDFIVFGTMALGSFSSGGLLASYGWDVVLWISFLPILLA
                     VGALVWTAAVRTTNTRLG"
     misc_feature    complement(96162..97283)
                     /locus_tag="Mnod_7862"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(96156..97274)
                     /locus_tag="Mnod_7862"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(order(96270..96272,96279..96284,96291..96296,
                     96303..96308,96339..96341,96348..96353,96363..96365,
                     96372..96377,96384..96386,96525..96527,96537..96539,
                     96546..96548,96558..96560,96570..96572,96609..96611,
                     96618..96623,96630..96635,96642..96644,96870..96872,
                     96888..96893,96900..96905,96939..96941,96948..96953,
                     96960..96965,96972..96977,97119..97124,97128..97133,
                     97143..97145,97152..97157,97164..97166,97215..97220,
                     97224..97232,97239..97241))
                     /locus_tag="Mnod_7862"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(97364..98683)
                     /locus_tag="Mnod_7863"
                     /db_xref="GeneID:7295503"
     CDS             complement(97364..98683)
                     /locus_tag="Mnod_7863"
                     /inference="similar to AA sequence:KEGG:M446_1530"
                     /note="KEGG: met:M446_1530 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490057.1"
                     /db_xref="GI:220914749"
                     /db_xref="GeneID:7295503"
                     /translation="MAPLDRRGLPLSTTSDRAAECYREGVDLLLTAWPGAAEALEEAV
                     AADPDFALAHAARARLHAMCAEPAQARARIAAAAERVARRGIERERSHVEVLSLAING
                     QPARALERALGHADAWPRDALILSLPLGAFGLLAFSGMTDHDQARVDLCERHARHYDA
                     DDWWFLTYRGWSHAENGAVKHGRALAERGFALRRANANGAHALSHAMFEGGAGEEAEA
                     LIAEWLPGYDRSGILHGHIAWHAALSALERDEPQRALAIYAEHVQPSVTAGLPINVVS
                     DTVSLLWRMQAYGYKVPAGLWDDAKVYSSKYFTKAGFAFADAHMGLLAAATGDKAAAV
                     ARIDALTDLVAAGTLAAGPVVPAICRAVLAFAEEDYAGCVRILEPVAAEVTRIGGSGA
                     QREIIEDTLLVALMRSGEAAKARALLDRRLHRRPSPRDTRWHTLLMA"
     misc_feature    complement(97478..98545)
                     /locus_tag="Mnod_7863"
                     /note="StaR_like; a well-conserved protein found in
                     bacteria, plants, and animals. A family member from
                     Streptomyces toyocaensis, StaR is part of a gene cluster
                     involved in the biosynthesis of glycopeptide antibiotics
                     (GPAs), specifically A47934. It has been...; Region:
                     StaR_like; cd05804"
                     /db_xref="CDD:100115"
     gene            98864..99091
                     /locus_tag="Mnod_7864"
                     /db_xref="GeneID:7295504"
     CDS             98864..99091
                     /locus_tag="Mnod_7864"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490058.1"
                     /db_xref="GI:220914750"
                     /db_xref="GeneID:7295504"
                     /translation="MPFALRRAMLTERATGAALGDRQHGPDMLDAGAAARGAQKFPRA
                     SSCRISLSSVRSAIALRRRAFSVSNSLIRRT"
     gene            complement(98977..99357)
                     /locus_tag="Mnod_7865"
                     /db_xref="GeneID:7295505"
     CDS             complement(98977..99357)
                     /locus_tag="Mnod_7865"
                     /inference="protein motif:PFAM:PF01527"
                     /note="PFAM: transposase IS3/IS911 family protein;
                     KEGG: mpo:Mpop_3816 transposase IS3/IS911 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS3/IS911 family protein"
                     /protein_id="YP_002490059.1"
                     /db_xref="GI:220914751"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="GeneID:7295505"
                     /translation="MLCRGLASPRRTRADPHLVASLASLQRATQRYKAIGTKKHKPEE
                     VVAKLRQVNVLVSQGHSVADAIRAIGVSEVTYYRWRKEFGGLKTDQVRRMRELETENA
                     RLRKAIADLTLDKLILQEEARGNF"
     misc_feature    complement(99028..99216)
                     /locus_tag="Mnod_7865"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            99433..100380
                     /locus_tag="Mnod_7866"
                     /db_xref="GeneID:7295506"
     CDS             99433..100380
                     /locus_tag="Mnod_7866"
                     /inference="protein motif:PFAM:PF02371"
                     /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
                     IS116/IS110/IS902 family protein;
                     KEGG: hne:HNE_3446 ISHne3, transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_002490060.1"
                     /db_xref="GI:220914752"
                     /db_xref="InterPro:IPR002525"
                     /db_xref="InterPro:IPR003346"
                     /db_xref="GeneID:7295506"
                     /translation="MDEHRTIFVGIDVSKDRLDVHLRPSDEALHVPRDAKGLDTLARR
                     LGRLPVALVVLEATGGFEASVAAALAAVGLPLCIVNPRQIRDFARAMGRLAKTDTLDA
                     EVIALFAERIRPPARPLPEPERSHFAELVSRRRQIIGMIGMETNRRDQAVDKQLIRRV
                     DRHIAFLERELVELDRDIDRAIKASPVWCETEALLKSVPGIGDVTARTLLAQLPELGT
                     IGRHQLAALVGIAPINRDSGLMRGRRSIAGGRTSVRGVLYMAALTAIRRGSPFRPFYE
                     RLTQRGRPRKVALVAVMRKLLVTLNAIVRERTPWRPLAA"
     misc_feature    99454..99873
                     /locus_tag="Mnod_7866"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    99457..100323
                     /locus_tag="Mnod_7866"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    100009..100260
                     /locus_tag="Mnod_7866"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            100565..101368
                     /locus_tag="Mnod_7867"
                     /db_xref="GeneID:7295507"
     CDS             100565..101368
                     /locus_tag="Mnod_7867"
                     /inference="protein motif:PFAM:PF07883"
                     /note="PFAM: helix-turn-helix- domain containing protein
                     AraC type; Cupin 2 conserved barrel domain protein;
                     KEGG: met:M446_1529 AraC family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002490061.1"
                     /db_xref="GI:220914753"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="GeneID:7295507"
                     /translation="MTWEAIEVPSGLAPPQPIRVRAQSIPARHYFPEHAHRWNQVVYA
                     ISGVLTVAVEGHSFVISPEQAVWLPTGLRHRVGSLLGAEFRSLWIADEAGRGLPESPT
                     VFGVAPLLNALIVEAAAIEGEADRDGYASRVSDLILDQLRRARPLPGALPWPRGGSSL
                     TALCEALYADPADARAPAAWGRELGMSERTLARRFETEVGMSFRSWRRRLRLFKAIEL
                     MGGGLDVTRTAMELGYGSTSAFVYAFRTEMGFSPQAYMRGRTPDQGTHC"
     misc_feature    100631..100831
                     /locus_tag="Mnod_7867"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    101102..101335
                     /locus_tag="Mnod_7867"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    <101108..101188
                     /locus_tag="Mnod_7867"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(101424..101656)
                     /locus_tag="Mnod_7868"
                     /pseudo
                     /db_xref="GeneID:7295508"
     gene            complement(101676..101906)
                     /locus_tag="Mnod_7869"
                     /pseudo
                     /db_xref="GeneID:7295509"
     gene            101969..102670
                     /locus_tag="Mnod_7870"
                     /db_xref="GeneID:7295510"
     CDS             101969..102670
                     /locus_tag="Mnod_7870"
                     /inference="similar to AA sequence:KEGG:Oant_4519"
                     /note="KEGG: oan:Oant_4519  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_002490062.1"
                     /db_xref="GI:220914754"
                     /db_xref="GeneID:7295510"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGAPA"
     misc_feature    101996..102625
                     /locus_tag="Mnod_7870"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    102167..102493
                     /locus_tag="Mnod_7870"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            102827..103069
                     /locus_tag="Mnod_7871"
                     /pseudo
                     /db_xref="GeneID:7295511"
     gene            complement(103841..104125)
                     /locus_tag="Mnod_7872"
                     /db_xref="GeneID:7295512"
     CDS             complement(103841..104125)
                     /locus_tag="Mnod_7872"
                     /inference="similar to AA sequence:KEGG:Xaut_4901"
                     /note="KEGG: xau:Xaut_4901 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490063.1"
                     /db_xref="GI:220914755"
                     /db_xref="GeneID:7295512"
                     /translation="MRKLIIAVAAAAFSTAVSAQTVPSNGQVTKIDAAQNKLTLKHGP
                     IKNLDMDGMTMVFSVADPAMLKTLKVGDKVKFDADRVNGRLTVTKIEKSK"
     sig_peptide     complement(104066..104125)
                     /locus_tag="Mnod_7872"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.987 at
                     residue 20"
     misc_feature    complement(103844..104050)
                     /locus_tag="Mnod_7872"
                     /note="Copper binding periplasmic protein CusF; Region:
                     CusF_Ec; pfam11604"
                     /db_xref="CDD:256526"
     gene            complement(104150..104620)
                     /locus_tag="Mnod_7873"
                     /db_xref="GeneID:7295513"
     CDS             complement(104150..104620)
                     /locus_tag="Mnod_7873"
                     /inference="protein motif:PFAM:PF00127"
                     /note="PFAM: blue (type 1) copper domain protein;
                     KEGG: xau:Xaut_4902 blue (type1) copper domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="blue (type 1) copper domain-containing protein"
                     /protein_id="YP_002490064.1"
                     /db_xref="GI:220914756"
                     /db_xref="InterPro:IPR000923"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="GeneID:7295513"
                     /translation="MKIQIILAGAAAMFLSTAALADPGHSHGDDRAYGKPGNPKQPAR
                     VVQVTMRESDGKMEFVPNRLEVLRGEQVRFVLRNNGELDHEIVLGTLEENLKHGEEMR
                     KNPDMEHDDPNAKRLAPKRTGEILWRFTKAGEFDFSCLIPGHREAGMFGTIIVK"
     sig_peptide     complement(104555..104620)
                     /locus_tag="Mnod_7873"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 22"
     misc_feature    complement(104156..104494)
                     /locus_tag="Mnod_7873"
                     /note="Uncharacterized Cupredoxin-like subfamily; Region:
                     Cupredoxin_like_2; cd04211"
                     /db_xref="CDD:259873"
     misc_feature    complement(order(104174..104176,104189..104191,
                     104204..104206,104369..104371))
                     /locus_tag="Mnod_7873"
                     /note="putative Type 1 (T1) Cu binding site [ion binding];
                     other site"
                     /db_xref="CDD:259873"
     gene            complement(104633..106027)
                     /locus_tag="Mnod_7874"
                     /db_xref="GeneID:7295514"
     CDS             complement(104633..106027)
                     /locus_tag="Mnod_7874"
                     /inference="protein motif:PFAM:PF07732"
                     /note="PFAM: multicopper oxidase type 2; multicopper
                     oxidase type 3;
                     KEGG: xau:Xaut_4903 multicopper oxidase type 3"
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase type 3"
                     /protein_id="YP_002490065.1"
                     /db_xref="GI:220914757"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="GeneID:7295514"
                     /translation="MSVSRRNFLSAAGGITLVSASAVSGRTAFASVPEAPTMKSPQMQ
                     PPLVPKTGPDYNPVVTLNGWTLPWRMNGDWKEFHLVAEPVVREFAPGMVGHLWGYNGQ
                     SPGPTIEAVEGDKVRLFVTNKLPEHTTIHWHGQLLPSGMDGVGGLTQPHIPVGKTFVY
                     EFQLQKSGTFMYHPHADEMVQMAMGMMGFFVVHPKDPAFRRVDRDFVFLMASYDIEPG
                     TYVPRVAEMTDFNMWTWNTRVFPGIDHIVAGKGDKVRIRFGNLTMTNHLIHMHGYDFK
                     VSCTDGGWVPEEAAWPEVTIDCAVGQMRAFDFVADKPGDWAIHCHKSHHTMNAMGHDL
                     NTFIGVDKRKVAKKIKRLVPDYMPMGTAGMADMGEMEMPLPDNTLPMMTGWGQFGSIE
                     MGGMFSVVKVREGLAANDYKDPGWFKHPEGTVACEWKGEPKKTERAPSPTPARRTAEF
                     NVVKPGRKSPHDNH"
     sig_peptide     complement(105935..106027)
                     /locus_tag="Mnod_7874"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.930 at
                     residue 31"
     misc_feature    complement(<104837..105805)
                     /locus_tag="Mnod_7874"
                     /note="Putative multicopper oxidases [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: SufI; COG2132"
                     /db_xref="CDD:225043"
     misc_feature    complement(105449..105805)
                     /locus_tag="Mnod_7874"
                     /note="The first cupredoxin domain of bacteria two domain
                     multicopper oxidase; Region: CuRO_1_2dMco_1; cd13860"
                     /db_xref="CDD:259929"
     misc_feature    complement(order(105482..105484,105497..105499,
                     105503..105505,105509..105511,105515..105517,
                     105620..105622,105626..105631,105635..105637))
                     /locus_tag="Mnod_7874"
                     /note="putative trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259929"
     misc_feature    complement(order(105503..105505,105509..105511,
                     105629..105631,105635..105637))
                     /locus_tag="Mnod_7874"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259929"
     misc_feature    complement(105005..105421)
                     /locus_tag="Mnod_7874"
                     /note="The second cupredoxin domain of bacterial two
                     domain multicopper oxidase McoN and similar proteins;
                     Region: CuRO_D2_2dMcoN_like; cd04202"
                     /db_xref="CDD:259865"
     misc_feature    complement(order(105050..105052,105056..105067,
                     105071..105073,105077..105097,105119..105133,
                     105137..105139,105143..105154,105179..105181,
                     105185..105190,105206..105217,105221..105223,
                     105227..105229,105335..105340))
                     /locus_tag="Mnod_7874"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259865"
     misc_feature    complement(order(105065..105067,105071..105073,
                     105215..105217,105221..105223))
                     /locus_tag="Mnod_7874"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259865"
     gene            complement(106041..107492)
                     /locus_tag="Mnod_7875"
                     /db_xref="GeneID:7295515"
     CDS             complement(106041..107492)
                     /locus_tag="Mnod_7875"
                     /inference="similar to AA sequence:KEGG:Xaut_4904"
                     /note="KEGG: xau:Xaut_4904 outer membrane efflux protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane efflux protein"
                     /protein_id="YP_002490066.1"
                     /db_xref="GI:220914758"
                     /db_xref="GeneID:7295515"
                     /translation="MKPPIRNHADSRLAVPAKRLSLIGTITLALGGCVTVTPDGGMQP
                     VAQEVAAAISKETVKIASQADAADAQARAKALLNKPLTAGTAVQIALLSNRGLQAEYN
                     ALGLSEVDFVEASLPPNPTVTLGRAVVDGTLDVERRIIANLLALLTQPTRRAIGELRF
                     EAARYRAIDGTFRTAANARKAYYAAVAARQKVNFLEQARASADAAADLTRSLGETGAA
                     KKLDQARTAAFYAEVSNELAAARLEAGTTREALTRSLGVWGSDINYKLPSELPRLPQR
                     LLSQQTAEADAIRKRVDLIASRLDLDALATSLRLDQATRYASAFELAGLSRFERSKVD
                     GIVEKTSSAGHSLDLAIEIPIFDLGETTRRRAVETYMQAVNRFAEQAVNIRSEARAAY
                     LTYRAAYDIALAYRNKIVPLRRTVNEQSLLEYNGMLIDIFVLLTTFREGIDSNIAAIG
                     AQRDFFIARVDFDAAIQGGGSGPGAAIRVAAGQ"
     misc_feature    complement(106725..107240)
                     /locus_tag="Mnod_7875"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    complement(106080..>107039)
                     /locus_tag="Mnod_7875"
                     /note="Outer membrane protein [Cell envelope biogenesis,
                     outer membrane / Intracellular trafficking and secretion];
                     Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     misc_feature    complement(106095..106652)
                     /locus_tag="Mnod_7875"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     gene            complement(107489..107710)
                     /locus_tag="Mnod_7876"
                     /db_xref="GeneID:7295516"
     CDS             complement(107489..107710)
                     /locus_tag="Mnod_7876"
                     /inference="similar to AA sequence:KEGG:Mpop_2556"
                     /note="KEGG: mpo:Mpop_2556 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490067.1"
                     /db_xref="GI:220914759"
                     /db_xref="GeneID:7295516"
                     /translation="MKFIFLMATAVVLSSCAEFPAIQVGADPADPRAPVRLSRYTPVT
                     AGTADYRPVEPKSWIQQNERVAPRNGSKP"
     sig_peptide     complement(107630..107710)
                     /locus_tag="Mnod_7876"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.977) with cleavage site probability 0.683 at
                     residue 27"
     gene            complement(107891..108400)
                     /locus_tag="Mnod_7877"
                     /db_xref="GeneID:7295517"
     CDS             complement(107891..108400)
                     /locus_tag="Mnod_7877"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: xau:Xaut_4905 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490068.1"
                     /db_xref="GI:220914760"
                     /db_xref="GeneID:7295517"
                     /translation="MIAGPGRKLFGLCPPLHLRHPHNAVWSAVMNRGCRTFWALLTAL
                     AVFLANASWAIDSAALAHGAAPVHAHPSASKHSSATDGYQHDEMKTGVAAHCADEGRS
                     GCEPDGNAGDRAQSCCGTIACHAVIPATSCETAFTPLIRSIRALPFDDTVKQQMLGRL
                     DRPPRSAGV"
     gene            complement(108531..108740)
                     /locus_tag="Mnod_7878"
                     /db_xref="GeneID:7295518"
     CDS             complement(108531..108740)
                     /locus_tag="Mnod_7878"
                     /inference="protein motif:PFAM:PF00403"
                     /note="PFAM: Heavy metal transport/detoxification protein;
                     KEGG: pap:PSPA7_1627 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal transport/detoxification protein"
                     /protein_id="YP_002490069.1"
                     /db_xref="GI:220914761"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="GeneID:7295518"
                     /translation="MYHFNIPDMTCGGCARSVTKALQSVDANARIDTDPAKREVRVES
                     SADEAAFRAVLMQAGYPADEKLPAA"
     misc_feature    complement(108555..108731)
                     /locus_tag="Mnod_7878"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    complement(order(108699..108701,108708..108716))
                     /locus_tag="Mnod_7878"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            109153..110604
                     /locus_tag="Mnod_7879"
                     /db_xref="GeneID:7295519"
     CDS             109153..110604
                     /locus_tag="Mnod_7879"
                     /inference="protein motif:PFAM:PF07731"
                     /note="PFAM: multicopper oxidase type 1; multicopper
                     oxidase type 2; multicopper oxidase type 3;
                     KEGG: rle:RL1889  multicopper oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="multicopper oxidase type 2"
                     /protein_id="YP_002490070.1"
                     /db_xref="GI:220914762"
                     /db_xref="InterPro:IPR001117"
                     /db_xref="InterPro:IPR002355"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR011706"
                     /db_xref="InterPro:IPR011707"
                     /db_xref="GeneID:7295519"
                     /translation="MTRRDFLQGLSAGAVASGAVGLTHPFGAAAFAAAPNSASLTLVS
                     RTLDVNGRSARVFGLVGPHGRSGLTFNAGDRFDVALESKIDAPTLIHWHGLTPPWEQD
                     GVPNNPAAMLEPAETRRYSFPVGKGGTHWMHAHTLQEQDLLAAPLIVRTAEDLKQDEQ
                     EVVILLHDFSFKSPEELLADLKGKEGHGGAHGGTNMSTMNHGAMKPGALGSGTMDHGT
                     MDLNDIEYDAYLANDRTLADPEVVQVEKGGRVRLRIINGATATAFTVDTGSLDATLIA
                     VDGQDVQPVAGRTFPVSMGQRIDLRVEVPRDGGALPVLALREGAPERTGIILASAGAS
                     VRKIDTTGAGKGPVLDLALEQRLRPVQPLAVRQADRTFALMLTGTMSGYTWNIEGAGD
                     GLGVKQGDRVEISMHNMSMMAHPMHLHGHHFQVVDINGARFSGAVRDTVLVPPMATVT
                     VAFDADNAGHWPLHCHHLYHMAAGMMTSVAYAR"
     sig_peptide     109153..109251
                     /locus_tag="Mnod_7879"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.973 at
                     residue 33"
     misc_feature    109159..110598
                     /locus_tag="Mnod_7879"
                     /note="Putative multicopper oxidases [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: SufI; COG2132"
                     /db_xref="CDD:225043"
     misc_feature    109264..109605
                     /locus_tag="Mnod_7879"
                     /note="The second cupredoxin domain of uncharacterized
                     multicopper oxidase; Region: CuRO_1_LCC_like_3; cd13865"
                     /db_xref="CDD:259933"
     misc_feature    order(109285..109287,109297..109302,109342..109344,
                     109357..109359,109411..109413,109429..109431,
                     109528..109545,109549..109551,109567..109575,
                     109582..109590,109594..109596)
                     /locus_tag="Mnod_7879"
                     /note="putative Domain 2 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259933"
     misc_feature    order(109423..109425,109429..109431,109438..109440,
                     109504..109509,109549..109551,109555..109557,
                     109567..109572)
                     /locus_tag="Mnod_7879"
                     /note="putative Domain 3 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259933"
     misc_feature    order(109423..109425,109429..109431,109549..109551,
                     109555..109557)
                     /locus_tag="Mnod_7879"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259933"
     misc_feature    109801..110142
                     /locus_tag="Mnod_7879"
                     /note="The second cupredoxin domain of uncharacterized
                     multicopper oxidase; Region: CuRO_2_MCO_like_2; cd13887"
                     /db_xref="CDD:259954"
     misc_feature    order(109801..109812,109822..109824,109834..109836,
                     109843..109854,109873..109875,109903..109905,
                     109909..109911,109915..109917,109984..109992,
                     110035..110037,110041..110043,110119..110121,
                     110125..110130)
                     /locus_tag="Mnod_7879"
                     /note="putative Domain 1 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259954"
     misc_feature    order(109930..109932,109936..109938,109972..109977,
                     109981..109995,109999..110007,110011..110013,
                     110023..110025,110029..110046)
                     /locus_tag="Mnod_7879"
                     /note="putative Domain 3 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259954"
     misc_feature    110257..110595
                     /locus_tag="Mnod_7879"
                     /note="The third cupredoxin domain of CopA copper
                     resistance protein family; Region: CuRO_3_CopA; cd13896"
                     /db_xref="CDD:259963"
     misc_feature    order(110305..110307,110389..110391,110395..110397,
                     110461..110472,110476..110478,110482..110484,
                     110542..110550,110554..110562)
                     /locus_tag="Mnod_7879"
                     /note="putative Domain 2 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259963"
     misc_feature    order(110392..110394,110545..110547,110560..110562,
                     110575..110577)
                     /locus_tag="Mnod_7879"
                     /note="Type 1 (T1) Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259963"
     misc_feature    order(110401..110403,110407..110412,110461..110463,
                     110470..110472,110527..110538,110542..110544,
                     110548..110550,110554..110559,110578..110580,
                     110584..110586)
                     /locus_tag="Mnod_7879"
                     /note="putative Domain 1 interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:259963"
     misc_feature    order(110401..110403,110407..110409,110542..110544,
                     110548..110550)
                     /locus_tag="Mnod_7879"
                     /note="trinuclear Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259963"
     gene            110618..112984
                     /locus_tag="Mnod_7880"
                     /db_xref="GeneID:7295520"
     CDS             110618..112984
                     /locus_tag="Mnod_7880"
                     /inference="protein motif:TFAM:TIGR01525"
                     /note="KEGG: xau:Xaut_4911 heavy metal translocating
                     P-type ATPase;
                     TIGRFAM: ATPase, P-type (transporting), HAD superfamily,
                     subfamily IC; copper-translocating P-type ATPase; heavy
                     metal translocating P-type ATPase;
                     PFAM: Haloacid dehalogenase domain protein hydrolase; YHS
                     domain protein; E1-E2 ATPase-associated domain protein;
                     SMART: TRASH domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="heavy metal translocating P-type ATPase"
                     /protein_id="YP_002490071.1"
                     /db_xref="GI:220914763"
                     /db_xref="InterPro:IPR001756"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006403"
                     /db_xref="InterPro:IPR006416"
                     /db_xref="InterPro:IPR007029"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR011017"
                     /db_xref="GeneID:7295520"
                     /translation="MSNHQHAHHREGHGSHHHKKSPPAGTAKDPVCGMDVDPATTPHH
                     TEYGGQTHHFCSVRCKGQFDADPAAYAAGKAMPRKAAPVAEGVIYTCPMHPQIRQPQP
                     GNCPICGMALELETPTLETGPSAELLDMRRRFWVGLVLTLPVFLLEMGGHLIDLHMWL
                     SPQISNWVQLVLATPVVLWAGWPFFERGWQSLVTRHLNMFTLIAMGTGVAWVYSVVAT
                     VMPGIFPETLRTMGGSVAVYFEAASVITVLVLLGQVLELRAREQTGGAIRALLDLAPK
                     TARRVKADGTDEDIELDAVVVGDRLRVRPGEKVPVDGTLLEGRSSVDESMITGESMPV
                     TKAPGAKLIGGTMNQTGGFVMEAAKVGRDTMLSQIVRMVADAQRSRAPIQRLADDVSG
                     WFVPAVIVIAIIAFFAWFLVGPEPRLAHALVAAVAVLIIACPCALGLATPMSIMVGVG
                     RGAGLGVLIKNAEALERFEKVDTLVVDKTGTLTEGRPKVTAIVPAEGISETELLRQAA
                     TLERSSEHPLALAVVNAALERNLALGDAQDFDSPVGKGVTGMVEGRKLILGSHTIMGE
                     EGVDISAMSAEAEELRDEGATVIFMATDGVLSGLFTIADPVKATTPQAVRELTARGIR
                     VVMLTGDNRTTAQAVARRLGISEVEAEVLPEDKSAIVARLRKEGRVVAMAGDGVNDAP
                     ALAAADVGIAIGTGTDVAIESAGVTLLKGDLQGIERALQLSRATMKNIRQNLFFAFIY
                     NAAGVPVAAGILYPSFGILLSPIIAAAAMALSSVSVIGNSLRLRSVRL"
     misc_feature    110693..110830
                     /locus_tag="Mnod_7880"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3350"
                     /db_xref="CDD:225886"
     misc_feature    111155..112912
                     /locus_tag="Mnod_7880"
                     /note="copper-(or silver)-translocating P-type ATPase;
                     Region: ATPase-IB1_Cu; TIGR01511"
                     /db_xref="CDD:233445"
     misc_feature    111347..112018
                     /locus_tag="Mnod_7880"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    112397..112696
                     /locus_tag="Mnod_7880"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(112397..112399,112502..112507)
                     /locus_tag="Mnod_7880"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    112397..112408
                     /locus_tag="Mnod_7880"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    112502..112504
                     /locus_tag="Mnod_7880"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    112511..112915
                     /locus_tag="Mnod_7880"
                     /note="MoCF_BD: molybdenum cofactor (MoCF) binding domain
                     (BD). This domain is found a variety of proteins involved
                     in biosynthesis of molybdopterin cofactor, like MoaB,
                     MogA, and MoeA. The domain is presumed to bind
                     molybdopterin; Region: MoCF_BD; cl00451"
                     /db_xref="CDD:260429"
     gene            113067..113312
                     /locus_tag="Mnod_7881"
                     /pseudo
                     /db_xref="GeneID:7295521"
     gene            complement(113365..114066)
                     /locus_tag="Mnod_7882"
                     /db_xref="GeneID:7295522"
     CDS             complement(113365..114066)
                     /locus_tag="Mnod_7882"
                     /inference="similar to AA sequence:KEGG:Oant_4519"
                     /note="KEGG: oan:Oant_4519  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_002490072.1"
                     /db_xref="GI:220914764"
                     /db_xref="GeneID:7295522"
                     /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITV
                     TYESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVL
                     DVLLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKR
                     ANNRAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFR
                     AEAFAMWRGAAGAPA"
     misc_feature    complement(113410..114039)
                     /locus_tag="Mnod_7882"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     misc_feature    complement(113542..113868)
                     /locus_tag="Mnod_7882"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            114134..114832
                     /locus_tag="Mnod_7883"
                     /pseudo
                     /db_xref="GeneID:7295523"
     gene            complement(115061..116296)
                     /locus_tag="Mnod_7884"
                     /db_xref="GeneID:7295524"
     CDS             complement(115061..116296)
                     /locus_tag="Mnod_7884"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: rpc:RPC_4224 major facilitator superfamily MFS_1"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_002490073.1"
                     /db_xref="GI:220914765"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:7295524"
                     /translation="MITSSAPGRSVSTFVPDSPAAWRRLLIALAIAAVGTVGTWSVVV
                     VLPMVQAELGVTRGAASLAYTLAMIGFALGGVVTGRLTDRLGIIPAMGMGILSLLFGY
                     LGAGISTALWQFAVAHFFIGLGASATFAPLMAEASRWFVRRRGIAVGIAGSGYYLSGA
                     FWPPLIERGIAQYGWQMTHIALGILCGAAMTVLLLILRLSIGRSQQRSLGTEGRPSVD
                     IDLSPNALTAVLSVASFFCCTAMAVPQVHIVALCGDLGYGVARGVEMLSLMLAFGAVS
                     RIGSGLIADRLGGLATLLIGSVAQASALTMYLFFDGLTPLYVVSALFGLFHGGIVSSY
                     AIIVRETMPTREAATRVGTVIMVSLFGMSFGGWISGVIFDMTGSYKVAFLNGLGWNAL
                     NVATVLLLLLRSRRRAAFA"
     misc_feature    complement(115166..116224)
                     /locus_tag="Mnod_7884"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(115199..116218)
                     /locus_tag="Mnod_7884"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(115211..115213,115220..115225,
                     115232..115237,115244..115249,115280..115282,
                     115289..115294,115304..115306,115313..115318,
                     115325..115327,115466..115468,115478..115480,
                     115487..115489,115499..115501,115511..115513,
                     115550..115552,115559..115564,115571..115576,
                     115583..115585,115820..115822,115838..115843,
                     115850..115855,115886..115888,115895..115900,
                     115907..115912,115919..115924,116060..116065,
                     116069..116074,116084..116086,116093..116098,
                     116105..116107,116156..116161,116165..116173,
                     116180..116182))
                     /locus_tag="Mnod_7884"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(116407..116828)
                     /locus_tag="Mnod_7885"
                     /pseudo
                     /db_xref="GeneID:7295525"
     gene            complement(117146..118939)
                     /locus_tag="Mnod_7886"
                     /db_xref="GeneID:7295526"
     CDS             complement(117146..118939)
                     /locus_tag="Mnod_7886"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490074.1"
                     /db_xref="GI:220914766"
                     /db_xref="GeneID:7295526"
                     /translation="MQIRYSEYNTDSGSGTYDRLRQIARHRTASSKRATVEPLSIPQR
                     DLTNLIFDLFRGFRSNAFIGLSERATRRIQKPGRWKEVSCSSLICEIVTDKLVRKGPL
                     SDNGRLARCEQIQRAVERGSVRFAILLLPFRTPSPLKHRVGLPDLGEIYTLVLLESIA
                     KACEHAQESMIAKARVVATSLSSAQLDSYGPREASFSPTNVNCDEIMAQAFAIVEAQS
                     LSRAEAAKRKRCIRESLFNRKAHKIRDARSFAELLAALSKWSLSLEAFAAFRNGEVVP
                     VSILAIQDAERYPCYSDLSHAVVAEYRSFLMKMTDLLDIERRHLDLVAYRDVAERTDE
                     TAQRRRDAFYENRLQALRAPIAAGLSRLLLCCGKEKFTQCLREVDADGIVGPLFEPLL
                     LSVQHPRLAECALKWDREYEEVFFQCMTNIYDPSEDAELEQLRQHLIQRTLEAACQYC
                     AAYEANTGLKNGDRFDDVSIRFPNTLRMSIHSKSESMGQFSISVSPTKTRTPWHGTAA
                     LSGSSDGAPIVLSIDLAGGLEATGKYAAVVVEAEDGSQRSGPFEGHAYCGQPIFYLSA
                     DLLSTDREGGPGAIWRELAFRGLRGFTQAAQ"
     misc_feature    complement(<118106..118237)
                     /locus_tag="Mnod_7886"
                     /note="Ubiquitin-like proteins; Region: UBQ; cl00155"
                     /db_xref="CDD:260222"
     misc_feature    complement(117413..>118072)
                     /locus_tag="Mnod_7886"
                     /note="Pyoverdine/dityrosine biosynthesis protein; Region:
                     DIT1_PvcA; cl19832"
                     /db_xref="CDD:268185"
     gene            complement(118941..119577)
                     /locus_tag="Mnod_7887"
                     /pseudo
                     /db_xref="GeneID:7295527"
     gene            complement(119641..120795)
                     /locus_tag="Mnod_7888"
                     /pseudo
                     /db_xref="GeneID:7295528"
     gene            complement(120898..121797)
                     /locus_tag="Mnod_7889"
                     /db_xref="GeneID:7295529"
     CDS             complement(120898..121797)
                     /locus_tag="Mnod_7889"
                     /inference="protein motif:PFAM:PF05175"
                     /note="PFAM: methyltransferase small;
                     KEGG: ppu:PP_3777 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase small"
                     /protein_id="YP_002490075.1"
                     /db_xref="GI:220914767"
                     /db_xref="InterPro:IPR007848"
                     /db_xref="GeneID:7295529"
                     /translation="MIGVSDKSWLVDLLSTVAPDRPDLVPEIAADSDKHIYSTYFGLG
                     HQLKMHDRPGVFKVSLAGMALGSYLLKGLAQDELTGRLLDLGTGSGILALLLRSLGAH
                     DITASDVSTSAVGLALENESLNFRSSRIRFFSGDLFVGLPEGDRYDTVIFNPPGWRTP
                     SEKLLDRLRGNEDGIGMTPETMFYGDELLLRFLKDLPDRMNRTGRAIVGLNSLVGIRD
                     VLARYKAFYPTGAPLQFQLLERHSLPLLFYSPGWKRAEPFLREEFEAWRDSYGAAYTI
                     DGQGRLYWSYEVVECRRAPTALG"
     misc_feature    complement(121120..>121572)
                     /locus_tag="Mnod_7889"
                     /note="Methylase of polypeptide chain release factors
                     [Translation, ribosomal structure and biogenesis]; Region:
                     HemK; COG2890"
                     /db_xref="CDD:225443"
     misc_feature    complement(<121327..121557)
                     /locus_tag="Mnod_7889"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(121339..121341,121387..121395,
                     121471..121476,121525..121545))
                     /locus_tag="Mnod_7889"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(121794..122624)
                     /locus_tag="Mnod_7890"
                     /db_xref="GeneID:7295530"
     CDS             complement(121794..122624)
                     /locus_tag="Mnod_7890"
                     /EC_number="1.5.1.2"
                     /inference="protein motif:TFAM:TIGR00112"
                     /note="TIGRFAM: pyrroline-5-carboxylate reductase;
                     PFAM: NADP oxidoreductase coenzyme F420-dependent;
                     KEGG: ppu:PP_3778 pyrroline-5-carboxylate reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroline-5-carboxylate reductase"
                     /protein_id="YP_002490076.1"
                     /db_xref="GI:220914768"
                     /db_xref="InterPro:IPR000304"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="GeneID:7295530"
                     /translation="MKTTLVLFGVGHMGSAIARGMLQTGNTDLRIIDPDLSALQEFSA
                     LGIRTDTACLSLAPNDVLMLAMPPQVFGAFSSDTPCVHHHQGLVISVMAGIRISSIQQ
                     MLGTQNVVRSIPNTPSEVFEGMTVYCRSSSVGENLARKARDVLESFGRAVEVSDEALI
                     DPATALCGGGPAFVAYFADALQEFGIKAGLSKDAALAITIQLLRGTSALLATTGKPVM
                     QLCREVMTPGGTTERGIWHFDDEGVGRTVLDALSKSSARSRELGLAITESLSQFEVAK
                     "
     misc_feature    complement(121839..122624)
                     /locus_tag="Mnod_7890"
                     /note="pyrroline-5-carboxylate reductase; Reviewed;
                     Region: PRK11880"
                     /db_xref="CDD:237008"
     sig_peptide     complement(122568..122624)
                     /locus_tag="Mnod_7890"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.735) with cleavage site probability 0.605 at
                     residue 19"
     misc_feature    complement(122343..122615)
                     /locus_tag="Mnod_7890"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; cl19126"
                     /db_xref="CDD:267479"
     misc_feature    complement(121842..122159)
                     /locus_tag="Mnod_7890"
                     /note="Pyrroline-5-carboxylate reductase dimerization;
                     Region: P5CR_dimer; pfam14748"
                     /db_xref="CDD:258885"
     gene            complement(122714..124389)
                     /locus_tag="Mnod_7891"
                     /pseudo
                     /db_xref="GeneID:7295531"
     gene            124727..125896
                     /locus_tag="Mnod_7892"
                     /db_xref="GeneID:7295532"
     CDS             124727..125896
                     /locus_tag="Mnod_7892"
                     /inference="protein motif:PFAM:PF02515"
                     /note="PFAM: L-carnitine dehydratase/bile acid-inducible
                     protein F;
                     KEGG: abo:ABO_1529 CaiB/BaiF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_002490077.1"
                     /db_xref="GI:220914769"
                     /db_xref="InterPro:IPR003673"
                     /db_xref="GeneID:7295532"
                     /translation="MGPLKGFRVIEMAGIGPGPFCGMLLSDLGAQVLRVERHGASADA
                     HDPLQRNRLRLALDLKDPQQVGVLLDIVEHADALFEGYRPGVAERLGFGPDDCLQRNA
                     KLVYGRMTGWGQDGPLASTAGHDINYIALSGALHAIGRSGERPVPPLNLVGDFGGGGM
                     LLAFGMVCALLERERSGQGQVVDAAMVDGSIALMAMFLGMQARGLSCNQVGSHFLSGA
                     AHYYDTYQTKDGKFMAVGALEPQFYGELIAKAGLDPNVFGGSSFMSPAGHDPRRWAEL
                     KPLLAEQFMTRTRDEWCAVFAGSDACVAPVLTLEEAAQHPHNRARHAFVTVAGVTQNA
                     PAPRFSRTPAAHPELATADSTAVDALLSQWGCNREQLVNIAALSAQRAVAADSAS"
     misc_feature    124727..125875
                     /locus_tag="Mnod_7892"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            126370..126585
                     /locus_tag="Mnod_7893"
                     /pseudo
                     /db_xref="GeneID:7295533"
     gene            126959..127384
                     /locus_tag="Mnod_7894"
                     /db_xref="GeneID:7295534"
     CDS             126959..127384
                     /locus_tag="Mnod_7894"
                     /inference="protein motif:PFAM:PF01575"
                     /note="PFAM: MaoC domain protein dehydratase;
                     KEGG: bam:Bamb_1546 dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC domain-containing protein dehydratase"
                     /protein_id="YP_002490078.1"
                     /db_xref="GI:220914770"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="GeneID:7295534"
                     /translation="MAMRAYPRERFSSEVTLSLSQVTQFADAVGDNNPIHHDAEYAAT
                     TRFGRPTASGPHATSLLLALTASHFSKKGAMLGLEFCVRFRRPIYADETIRLEWLVVK
                     VAWNEKLRGEIVELRGRIKGQDGKTSVGAKGRVLVTDRL"
     misc_feature    126980..127351
                     /locus_tag="Mnod_7894"
                     /note="(R)-hydratase [(R)-specific enoyl-CoA hydratase].
                     Catalyzes the hydration of trans-2-enoyl CoA to
                     (R)-3-hydroxyacyl-CoA as part of the PHA
                     (polyhydroxyalkanoate) biosynthetic pathway.  The
                     structure of the monomer includes a five-strand
                     antiparallel...; Region: R_hydratase_like; cd03441"
                     /db_xref="CDD:239525"
     misc_feature    order(127034..127036,127049..127051,127055..127057,
                     127064..127066,127109..127111,127118..127123)
                     /locus_tag="Mnod_7894"
                     /note="active site"
                     /db_xref="CDD:239525"
     misc_feature    order(127049..127051,127055..127057,127064..127066,
                     127118..127120)
                     /locus_tag="Mnod_7894"
                     /note="catalytic site [active]"
                     /db_xref="CDD:239525"
     gene            complement(127536..128613)
                     /locus_tag="Mnod_7895"
                     /pseudo
                     /db_xref="GeneID:7295535"
     gene            128634..128827
                     /locus_tag="Mnod_7896"
                     /pseudo
                     /db_xref="GeneID:7295536"
     gene            128880..129188
                     /locus_tag="Mnod_7897"
                     /db_xref="GeneID:7295537"
     CDS             128880..129188
                     /locus_tag="Mnod_7897"
                     /inference="protein motif:TFAM:TIGR02384"
                     /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
                     family;
                     PFAM: RelB antitoxin;
                     KEGG: smd:Smed_3232 addiction module antitoxin, RelB/DinJ
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="RelB/DinJ family addiction module antitoxin"
                     /protein_id="YP_002490079.1"
                     /db_xref="GI:220914771"
                     /db_xref="InterPro:IPR007337"
                     /db_xref="GeneID:7295537"
                     /translation="MPANALVQTRIDADVRDRASAVLENMGLTVSDAVRILLTRTANE
                     GALPLELVTNSEAHDAWFRAKVLEALDDTRPDVPDDQAEAHFAQRRAAARRRAGELKS
                     "
     misc_feature    128880..>129107
                     /locus_tag="Mnod_7897"
                     /note="DNA-damage-inducible protein J [DNA replication,
                     recombination, and repair]; Region: RelB; COG3077"
                     /db_xref="CDD:225619"
     gene            129185..129478
                     /locus_tag="Mnod_7898"
                     /db_xref="GeneID:7295538"
     CDS             129185..129478
                     /locus_tag="Mnod_7898"
                     /inference="protein motif:TFAM:TIGR02385"
                     /note="TIGRFAM: addiction module toxin, RelE/StbE family;
                     PFAM: plasmid stabilization system;
                     KEGG: nha:Nham_4667 addiction module toxin, RelE/StbE"
                     /codon_start=1
                     /transl_table=11
                     /product="RelE/StbE family addiction module toxin"
                     /protein_id="YP_002490080.1"
                     /db_xref="GI:220914772"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="InterPro:IPR012753"
                     /db_xref="GeneID:7295538"
                     /translation="MKLVWSAFALSDRGGIFTHIEADNPAAAIVIDERIVAATRRLRD
                     FPESGRPGRIAGTRELVVTGTPYIAAYQVTGETVRILRVLHGAQQWPDDLPEG"
     misc_feature    129185..129472
                     /locus_tag="Mnod_7898"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(129708..129959)
                     /locus_tag="Mnod_7899"
                     /pseudo
                     /db_xref="GeneID:7295539"
     gene            complement(130044..130379)
                     /locus_tag="Mnod_7900"
                     /pseudo
                     /db_xref="GeneID:7295540"
     gene            complement(130527..131762)
                     /locus_tag="Mnod_7901"
                     /db_xref="GeneID:7295541"
     CDS             complement(130527..131762)
                     /locus_tag="Mnod_7901"
                     /inference="protein motif:PFAM:PF07756"
                     /note="PFAM: protein of unknown function DUF1612;
                     KEGG: nha:Nham_4505 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490081.1"
                     /db_xref="GI:220914773"
                     /db_xref="InterPro:IPR011670"
                     /db_xref="GeneID:7295541"
                     /translation="MRSPYAIDELFTGSTWRRLAGPAERAAEALLRLDERLARTEPAL
                     ADGVRARAHFVDAQAALGLEGRLVLMEDLVLHDAAMPVRQPTPELARAMHVLAIRRRI
                     AAARPDWPFAREGWSALFGAVGRDPDGTEAPLESPRVEAPRRGDATEPQPWAMPRFGQ
                     DSFDDEDDGATSSGDEDELWTADEASDPAFAGIDRLLARSRRTLADYNDLTTDEGRAA
                     LRVRDPQYGEAERLAAWRRIALKDVRELPAVLAAAVVLDAWFVLDPSERQPFLGPLLA
                     AALLHQRGTARHHLPALALGLRESRTRWLTVHPAPERLGAILRAAEAAAHAASRDLDR
                     LSLARALMLRRVQAKRRTSRLPQLVEVFLASPLVTVQSAAQRLGTSAQVVEAMLTGLG
                     PACPRELTGRRRYRAWGIV"
     misc_feature    complement(130722..131102)
                     /locus_tag="Mnod_7901"
                     /note="Protein of unknown function (DUF1612); Region:
                     DUF1612; pfam07756"
                     /db_xref="CDD:149040"
     misc_feature    complement(130530..130700)
                     /locus_tag="Mnod_7901"
                     /note="HTH DNA binding domain; Region: HTH_13; pfam11972"
                     /db_xref="CDD:152407"
     gene            131937..132998
                     /locus_tag="Mnod_7902"
                     /db_xref="GeneID:7295542"
     CDS             131937..132998
                     /locus_tag="Mnod_7902"
                     /inference="protein motif:PFAM:PF00589"
                     /note="PFAM: integrase family protein;
                     KEGG: mrd:Mrad2831_6128 integrase family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase family protein"
                     /protein_id="YP_002490082.1"
                     /db_xref="GI:220914774"
                     /db_xref="InterPro:IPR002104"
                     /db_xref="GeneID:7295542"
                     /translation="MEFDPADPAPAPPHGSSFALSVPLAAALPPGPALLERLEAYARA
                     AQGAFAPNTLRALAADSRIFAAWCRAHGRSVLPAAPQTVADFIDAQAARKSRATVERY
                     RSSIAMLHRAAGLPNPCTDERVRLAVKRMSRAKGRRQKQAEPLNRPSIDRMLAVKTPE
                     RLHRRVAEGDREVPLIALRNAALMAVAYDTLLRRSELVSLLIEDLERVEDGSGTILVR
                     RTKTDQEGEGAVKYLAPDTVGHVSAWLEAAGLTSGPLFRPVTKGGRVGAAALGDAEVY
                     RLYREIALAAGVKLARPPSGHSTRVGATQDMFAAGFELLEVMQAGSWKTPAMPARYGE
                     RLRAQRGAARKLATLQNRA"
     misc_feature    132087..132965
                     /locus_tag="Mnod_7902"
                     /note="Cre recombinase, C-terminal catalytic domain.
                     Cre-like recombinases belong to the superfamily of DNA
                     breaking-rejoining enzymes, which share the same fold in
                     their catalytic domain and the overall reaction mechanism.
                     The bacteriophage P1 Cre...; Region: INT_Cre; cd00799"
                     /db_xref="CDD:238414"
     misc_feature    order(132090..132095,132099..132101,132120..132122,
                     132225..132230,132237..132239,132471..132473,
                     132513..132521,132708..132716,132756..132758,
                     132762..132764,132819..132827,132930..132932)
                     /locus_tag="Mnod_7902"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238414"
     misc_feature    order(132177..132179,132186..132191,132309..132311,
                     132315..132317,132321..132326,132375..132377,
                     132498..132503,132843..132845,132855..132857,
                     132960..132965)
                     /locus_tag="Mnod_7902"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238414"
     misc_feature    order(132513..132515,132597..132599,132825..132827,
                     132834..132836,132903..132905,132930..132932)
                     /locus_tag="Mnod_7902"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238414"
     misc_feature    order(132513..132515,132597..132599,132825..132827,
                     132834..132836,132930..132932)
                     /locus_tag="Mnod_7902"
                     /note="active site"
                     /db_xref="CDD:238414"
     gene            133595..134050
                     /locus_tag="Mnod_7903"
                     /db_xref="GeneID:7295543"
     CDS             133595..134050
                     /locus_tag="Mnod_7903"
                     /inference="protein motif:TFAM:TIGR01764"
                     /note="TIGRFAM: DNA binding domain protein, excisionase
                     family;
                     KEGG: rpc:RPC_4424 excisionase/Xis, DNA-binding"
                     /codon_start=1
                     /transl_table=11
                     /product="excisionase family DNA binding domain-containing
                     protein"
                     /protein_id="YP_002490083.1"
                     /db_xref="GI:220914775"
                     /db_xref="InterPro:IPR010093"
                     /db_xref="GeneID:7295543"
                     /translation="MTMPAFAEPLGGRLPSDDEKAAANQLRKIIAAHAADDAKLRVID
                     EDKKPIDITLTPALSNLLMEVLRHVGSGDVVTLVPVGQMMSTQQAADILNVSRPFLIS
                     LLDRGDIRHTKVGRHRRIKAEDLFAYKKRRDEGHNEALSALTEMDAEYL"
     misc_feature    133844..133987
                     /locus_tag="Mnod_7903"
                     /note="DNA binding domain, excisionase family; Region:
                     excise; TIGR01764"
                     /db_xref="CDD:200128"
     gene            134054..134395
                     /locus_tag="Mnod_7904"
                     /pseudo
                     /db_xref="GeneID:7295544"
     gene            complement(134340..134924)
                     /locus_tag="Mnod_7905"
                     /pseudo
                     /db_xref="GeneID:7295545"
     gene            135023..135875
                     /locus_tag="Mnod_7906"
                     /pseudo
                     /db_xref="GeneID:7295546"
     gene            136232..136888
                     /locus_tag="Mnod_7907"
                     /db_xref="GeneID:7295547"
     CDS             136232..136888
                     /locus_tag="Mnod_7907"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490084.1"
                     /db_xref="GI:220914776"
                     /db_xref="GeneID:7295547"
                     /translation="MRVLGPIVLAQILLLMGVQAEVSVRGRIGAALVRHQHLRRRALL
                     LDQLAKQLQGRLLVALGLNQQIQRDDGHALALQLRPCTARHQSDGSVVVDRTVIRSRR
                     KSRRNPDIDARWSPADARKALLWRETRKFRPLVIGSCPSIWGKVPTMFLCQSKSMRRN
                     EVCENNPKSPTCPSPSPISGGPLERCPIRLRRKHRPRIRRPRRSCGPPRVRSACRLGG
                     "
     gene            complement(136896..137061)
                     /locus_tag="Mnod_7908"
                     /pseudo
                     /db_xref="GeneID:7295548"
     gene            137164..138498
                     /locus_tag="Mnod_7909"
                     /db_xref="GeneID:7295549"
     CDS             137164..138498
                     /locus_tag="Mnod_7909"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_4843 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490085.1"
                     /db_xref="GI:220914777"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295549"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     misc_feature    137227..137625
                     /locus_tag="Mnod_7909"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    137992..138471
                     /locus_tag="Mnod_7909"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <138253..138483
                     /locus_tag="Mnod_7909"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            complement(138712..140289)
                     /locus_tag="Mnod_7910"
                     /db_xref="GeneID:7295550"
     CDS             complement(138712..140289)
                     /locus_tag="Mnod_7910"
                     /inference="similar to AA sequence:KEGG:Nther_2816"
                     /note="KEGG: nth:Nther_2816 glucose/sorbosone
                     dehydrogenase-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose/sorbosone dehydrogenase-like protein"
                     /protein_id="YP_002490086.1"
                     /db_xref="GI:220914778"
                     /db_xref="GeneID:7295550"
                     /translation="MQAISDSQLNGCPPNGKIGDGPDNDSHASPENVVLPDGYSLQAF
                     ATGLTFPTAITFSNDQVWVSESGPTPDTVPQVVQIGPDGHPIPVLSSDQLPAGVLAGP
                     ITDITFHDGEIWVAHRQVGANGWLVGAISKFDPANPVDTFTTVLTNLPSTGDHYTEEI
                     TFDASGRLYFSQGSATNSSVVGPDNELVSGWLSQFPDFHDFAAHDVVLNGTEFHAPVS
                     IPGLNPENQVTAPFMPFGSGPIAPGTVIPAATPDAPQEGMIAGNAAVYSFDPTADDPA
                     STLQLEGWGFRNPFGIGFDPFNPDLLFATNNGADIRSAPLDGLQVVESRPIANDFDDL
                     FVMNAGGTAEFFGWPDFFHDPNTGAVLPVTDPLFAQGDLPIPPPGFVLDENFRSGLQT
                     EPAVAQFEYHSSANKFDFSTDDQFGSVGDLFVAETGSFVPVTGAQDLVGYKVVQVDRD
                     TGTVSDFITHTSNTVDDIFDPNGFNKPIDIKFQDSTMFIVDFGVFEPGLNLAQPETGK
                     VWILSPTTNDPNGALLE"
     misc_feature    complement(139003..140253)
                     /locus_tag="Mnod_7910"
                     /note="Glucose/sorbosone dehydrogenases [Carbohydrate
                     transport and metabolism]; Region: COG2133"
                     /db_xref="CDD:225044"
     gene            complement(140845..141411)
                     /locus_tag="Mnod_7911"
                     /db_xref="GeneID:7295551"
     CDS             complement(140845..141411)
                     /locus_tag="Mnod_7911"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: mxa:MXAN_3443 transcriptional regulator, TetR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="YP_002490087.1"
                     /db_xref="GI:220914779"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:7295551"
                     /translation="MPLPRFERLPIETRTAFLAVARSHFARDGRDGASLNKIIGDSGF
                     SKTSAYNYFDGKDDLFEAVVADSFRRVSEVLGEWPVARDEAALWRNFHAANDRLNRFL
                     LANPDDRSLLAGAGSRSEPPKWLHAFFTNAVELGLVDVSPGRELLESATLAVLRSFDE
                     WALGRLPAEADAGATARVKELLRRLWAC"
     misc_feature    complement(140851..141411)
                     /locus_tag="Mnod_7911"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(141223..141360)
                     /locus_tag="Mnod_7911"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(141418..141969)
                     /locus_tag="Mnod_7912"
                     /db_xref="GeneID:7295561"
     CDS             complement(141418..141969)
                     /locus_tag="Mnod_7912"
                     /inference="similar to AA sequence:KEGG:Bcenmc03_0034"
                     /note="KEGG: bcm:Bcenmc03_0034 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490088.1"
                     /db_xref="GI:220914780"
                     /db_xref="GeneID:7295561"
                     /translation="MIPLKLALTAVIVALLTQPLWAPQWGGGILAEIGAFGPAGAAIV
                     VLVFFSLVALYCLSLQRMLEAIAPAKRAASPRSVWLMFVIPSNFVEDFFIVGSIAASL
                     RNDGRTHARTQLVWLILGMSWCGLQIVSLLPGPVGVVSGGIALLAWAAHWMLTNHMTR
                     ALLDSSPSEVPAPSAGQAPASRA"
     gene            complement(141986..142261)
                     /locus_tag="Mnod_7913"
                     /db_xref="GeneID:7295562"
     CDS             complement(141986..142261)
                     /locus_tag="Mnod_7913"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rsq:Rsph17025_0807 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490089.1"
                     /db_xref="GI:220914781"
                     /db_xref="GeneID:7295562"
                     /translation="MIRPDSPTVAEAEQKIAEHFHFVPPDHRAAEAGRLIEWWDRRIV
                     YSLCGERERVIVLSLRAALLDRPVGNEGILTSLLRRRERACTGGTHR"
     gene            complement(142258..142709)
                     /locus_tag="Mnod_7914"
                     /pseudo
                     /db_xref="GeneID:7295563"
     gene            complement(142838..143830)
                     /locus_tag="Mnod_7915"
                     /db_xref="GeneID:7295564"
     CDS             complement(142838..143830)
                     /locus_tag="Mnod_7915"
                     /inference="protein motif:PFAM:PF00165"
                     /note="PFAM: helix-turn-helix- domain containing protein
                     AraC type;
                     KEGG: mrd:Mrad2831_1512 AraC family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002490090.1"
                     /db_xref="GI:220914782"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="GeneID:7295564"
                     /translation="MPLEDISIDGRDMSLRERKLCWQALVGEHLADVELDASPDIPAG
                     EAFAGTLRIRSFERGTLADIASGGQVLTRTADRIRRAKSDAVLFNIILSGHCRLEQDG
                     RQAVPTAGSLFLYESARPYHIETSPDFRTIVVMIDRGRLERSLGNLRFYTGRAMCSVD
                     TVARIAGSFWQTLSSQLDGVPDAAANTLIEAGIDVVIPALRSMAGDRAEGSEACELTV
                     MRATAFIASAFHRESLTVDDIAAAAGVSTRRLQECFKEKGLTPMEQLRKHRLKHAHDR
                     LNDGHCQNLSVLSIMSQSGFSDPAHFSRAFRKEYGISPSAARSASQRRPAVRVA"
     misc_feature    complement(143228..143767)
                     /locus_tag="Mnod_7915"
                     /note="AraC-binding-like domain; Region: AraC_binding_2;
                     pfam14525"
                     /db_xref="CDD:258665"
     misc_feature    complement(142865..143707)
                     /locus_tag="Mnod_7915"
                     /note="DNA-binding transcriptional activator FeaR;
                     Provisional; Region: PRK09685"
                     /db_xref="CDD:236612"
     misc_feature    complement(143033..143137)
                     /locus_tag="Mnod_7915"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(142877..143002)
                     /locus_tag="Mnod_7915"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            144051..145202
                     /locus_tag="Mnod_7916"
                     /db_xref="GeneID:7295565"
     CDS             144051..145202
                     /locus_tag="Mnod_7916"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: bsu:BSU05800 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_002490091.1"
                     /db_xref="GI:220914783"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:7295565"
                     /translation="MSTALSMAFGAFVVGVSELMTAGISDVMATDLGVSVASVGSLIF
                     WHAVAYAVAPPLLLSLRPRRERRTLLLVSAAIFTLASVAVAGAPGIGTALVGRVVQGG
                     ASGIVLAIAISCAGESVPGNQRGRAMATVLMGLSLALVAGVPLGVLIAEVSGWRSAFY
                     GVAAGGAGLCGLLIAQPDLGQAGPHGRHEGGGHPQPMGRRQVAALVVSLAWMSAYSTM
                     FSYAAPLLKHRFDLDGAGLSVAIVAFGTACMGGGYLGGALSDAISEHRAAILAIVLNA
                     LVIAAFPFLAGGLASAVTFMAAWGLSSWMVVAPVQAILASGEGSVDVALGLNNSGIQV
                     GIGIGALIGGILHEQHPAHHASASLLLLLLALGACLAVPRMQARAAPMT"
     misc_feature    144063..144998
                     /locus_tag="Mnod_7916"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    144069..145052
                     /locus_tag="Mnod_7916"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(144102..144104,144111..144119,144123..144128,
                     144177..144179,144186..144191,144198..144200,
                     144210..144215,144219..144224,144360..144365,
                     144372..144377,144384..144389,144396..144398,
                     144432..144437,144444..144449,144465..144467,
                     144684..144686,144693..144698,144705..144710,
                     144717..144719,144759..144761,144771..144773,
                     144783..144785,144792..144794,144804..144806,
                     144948..144950,144957..144962,144969..144971,
                     144981..144986,144993..144995)
                     /locus_tag="Mnod_7916"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            145266..145655
                     /locus_tag="Mnod_7917"
                     /db_xref="GeneID:7295566"
     CDS             145266..145655
                     /locus_tag="Mnod_7917"
                     /inference="protein motif:PFAM:PF00903"
                     /note="PFAM: Glyoxalase/bleomycin resistance
                     protein/dioxygenase;
                     KEGG: bpt:Bpetpseudo_20 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Glyoxalase/bleomycin resistance
                     protein/dioxygenase"
                     /protein_id="YP_002490092.1"
                     /db_xref="GI:220914784"
                     /db_xref="InterPro:IPR004360"
                     /db_xref="GeneID:7295566"
                     /translation="MYSHIVVGTDDLQTALAFYDRVLAVLGLRRIAADDVSGAIGYAA
                     DGGSRAPMFFVGPPLNGCAAAPGNGTTVAFLAQDEEVVRQWHAAALAAGGSDEGPPGL
                     RPQYHPGYYAAYSRDPDGNKLCCVFHG"
     misc_feature    145269..145646
                     /locus_tag="Mnod_7917"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_19; cd07262"
                     /db_xref="CDD:176683"
     gene            145853..146581
                     /locus_tag="Mnod_7918"
                     /db_xref="GeneID:7295567"
     CDS             145853..146581
                     /locus_tag="Mnod_7918"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490093.1"
                     /db_xref="GI:220914785"
                     /db_xref="GeneID:7295567"
                     /translation="MTNAFYLARNESIVPLKIGLNLTYDEVASSYPETLYEDLATKLV
                     SRFGLDLRISKCFDHGIKAVIKGRSFHYLHEISSPTKIFMLLHTLGHYQFITRAARLG
                     IQRYDYIYETSEDGDAHVYRYRAASGGGPVVTPKILCDRIEFEVRANDFAVETARALG
                     LGQLVPLIRLYEPADIRYIIDVMDGGVDAIVSDRDYVEGYVLSGLGVPQQHNEEKIFD
                     RRFFSVEDIDWELLRTRKIEIHFL"
     gene            146626..147234
                     /locus_tag="Mnod_7919"
                     /db_xref="GeneID:7295568"
     CDS             146626..147234
                     /locus_tag="Mnod_7919"
                     /EC_number="3.5.4.16"
                     /inference="protein motif:PFAM:PF01227"
                     /note="PFAM: GTP cyclohydrolase I;
                     KEGG: amt:Amet_2160 GTP cyclohydrolase I"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I"
                     /protein_id="YP_002490094.1"
                     /db_xref="GI:220914786"
                     /db_xref="InterPro:IPR001474"
                     /db_xref="GeneID:7295568"
                     /translation="MGNIDTTAKIAAGAILQRREAMAASVRSLLVCVGEDVDREGLRD
                     TPARVARMYEEVFSGLNEDPVLHLKTQFCDDGHEEIVVVRDIEFYSMCEHHLVPFFGK
                     AHVAYVPQGGRLTGLSKIARCVQTIARRPQLQERLTSQIVAALEEALTPLGAMALVEA
                     EHLCMAMRGVRSSHSFTRTLVASGCLKTDPEQRAEAFQMLKG"
     misc_feature    146674..147231
                     /locus_tag="Mnod_7919"
                     /note="GTP cyclohydrolase I; Provisional; Region: folE;
                     PRK09347"
                     /db_xref="CDD:236472"
     misc_feature    order(146920..146922,146926..146928,147097..147099,
                     147166..147168)
                     /locus_tag="Mnod_7919"
                     /note="active site"
                     /db_xref="CDD:238351"
     gene            147242..148018
                     /locus_tag="Mnod_7920"
                     /db_xref="GeneID:7295569"
     CDS             147242..148018
                     /locus_tag="Mnod_7920"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: short-chain dehydrogenase/reductase SDR;
                     KEGG: ret:RHE_CH01480 short chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_002490095.1"
                     /db_xref="GI:220914787"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="GeneID:7295569"
                     /translation="MCIRFTDRRGVALVTGGAKRIGRQISKRLYLEGYAVAIHSHRSY
                     GEACALAHEIAGSRGDAVALRADLACPASIATLVNRAEQALGPVTLLVNNASEFENDS
                     ADDLCRRQWNRHFDVNLAAPAFLMSDMAQRLPPAATGAIVNIIDQRVWKLTPQFISYT
                     LSKSALWTATRTFAQALAPRIRVNAVGPGPTLGNARQSFEDFEMQRSACLLGNGSSAD
                     DVAEAVAFLAAAKSITGQMIAVDGGQHLAWRTPDVDGIAE"
     misc_feature    147257..148015
                     /locus_tag="Mnod_7920"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK09134"
                     /db_xref="CDD:236389"
     misc_feature    147272..147970
                     /locus_tag="Mnod_7920"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(147287..147289,147293..147298,147302..147304,
                     147359..147367,147521..147529,147671..147679,
                     147716..147718,147728..147730,147803..147814)
                     /locus_tag="Mnod_7920"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(147593..147595,147677..147679,147716..147718,
                     147728..147730)
                     /locus_tag="Mnod_7920"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            148072..148800
                     /locus_tag="Mnod_7921"
                     /db_xref="GeneID:7295570"
     CDS             148072..148800
                     /locus_tag="Mnod_7921"
                     /inference="protein motif:TFAM:TIGR00697"
                     /note="TIGRFAM: conserved hypothetical integral membrane
                     protein;
                     PFAM: protein of unknown function DUF165;
                     KEGG: nar:Saro_2496 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490096.1"
                     /db_xref="GI:220914788"
                     /db_xref="InterPro:IPR003744"
                     /db_xref="GeneID:7295570"
                     /translation="MQNRKYLLLLAGVFCGTLVCTIILSGKIVSIFGLTFPASIVLFP
                     ATFMFGDILTEVYGYSVTRQVVWAGLISEIVWVAGYWTAAALPPAPFWSAQDAFVTVL
                     GLTPRIAVAGMTAYVVGEFVNSYVLAKLKVMTGGRYLAVRLVGSTVFGAAADTVIVLG
                     IAFAGIYTISQMFWMGLSVWFLKVVWELVALPVSMPLIAWLKRQENEDYYDRDTDFSP
                     FTLADRKRSLERARPAAGSAVSPL"
     sig_peptide     148072..148149
                     /locus_tag="Mnod_7921"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.783) with cleavage site probability 0.350 at
                     residue 26"
     misc_feature    148180..148620
                     /locus_tag="Mnod_7921"
                     /note="Uncharacterized ACR, YhhQ family COG1738; Region:
                     DUF165; pfam02592"
                     /db_xref="CDD:251400"
     gene            148816..149586
                     /locus_tag="Mnod_7922"
                     /db_xref="GeneID:7295571"
     CDS             148816..149586
                     /locus_tag="Mnod_7922"
                     /inference="protein motif:PFAM:PF01596"
                     /note="PFAM: O-methyltransferase family 3;
                     KEGG: aeh:Mlg_0966 caffeoyl-CoA O-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="O-methyltransferase family protein"
                     /protein_id="YP_002490097.1"
                     /db_xref="GI:220914789"
                     /db_xref="InterPro:IPR002935"
                     /db_xref="GeneID:7295571"
                     /translation="MTNCIADARSQEYIRAHYTRETPVLRELREYNATRPDSFLQITP
                     DQGAALRMLVGACGAKRILEIGVYTGYSAIWMASVLPEDGFLLACDIDPGVLAIAEPY
                     LRKAGLIDRIDFAVGPAQATLAKLLDQGAEGSFDLAFIDADKEPMNVYYEACLRLVRT
                     GGLIVVDNVLWEGRVADPDSTDPDAAAMRAIAARITADSRVDSCVLSVGDGLLVARKL
                     REAETVGIATGALSQELERGRSVGRSCLLSEPGRKEIE"
     misc_feature    148996..149313
                     /locus_tag="Mnod_7922"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(149008..149028,149083..149088,149164..149172)
                     /locus_tag="Mnod_7922"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(149666..149925)
                     /locus_tag="Mnod_7923"
                     /pseudo
                     /db_xref="GeneID:7295572"
     gene            complement(150098..151816)
                     /locus_tag="Mnod_7924"
                     /db_xref="GeneID:7295573"
     CDS             complement(150098..151816)
                     /locus_tag="Mnod_7924"
                     /inference="protein motif:PFAM:PF07714"
                     /note="PFAM: tyrosine protein kinase; Stage II sporulation
                     E family protein; Protein phosphatase 2C-like;
                     SMART: protein phosphatase 2C domain protein;
                     serine/threonine protein kinase;
                     KEGG: rpa:RPA3200  dual serine/threonine-protein
                     kinase/phosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_002490098.1"
                     /db_xref="GI:220914790"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR001245"
                     /db_xref="InterPro:IPR001932"
                     /db_xref="InterPro:IPR002290"
                     /db_xref="InterPro:IPR008266"
                     /db_xref="InterPro:IPR010822"
                     /db_xref="InterPro:IPR014045"
                     /db_xref="GeneID:7295573"
                     /translation="MRSVLSVSIGQYSSAGRKAANQDFHGALIPDGAMLAAKGIAVAL
                     ADGISTSRVSHVAAETAVKSLLTDYYCTSDAWSVKTSVRRVLNATNSWLHAETKRGQH
                     AYDLDKGYICTLSALVLKGRRAHLFHVGDCRVFRLSRGTLEQLTEDHRVILSSQESYL
                     GRALGMAPHVEIDYQAFDLDEGDIFILATDGVYQHAAPGFMARAVQDAGDKLDAAARR
                     IAEEAFARGSPDNLTVQAVRIDSLPDWDASAFAGFSQTLPAPPLLEARAVLDGYTILR
                     PLHHSHRSHLYLASDDASGSLVALKIPSVDLRDDPAYLQRFMMEEWIARRLDSPYVAK
                     APAQDRRRTQLYTVIEYVDGQTLAQWMTDHPEPDLETVRRIVEQIAAGLHAFHRREMV
                     HQDLRPENIMIDRHGTVKIVDFGSTRVLGVEEAQPLPHTDEGLGTLQYAAPEYFVGEV
                     GTPSSDLFSLGVIGYQMMTGRLPYGVEVARARTHKQQKRLTYIPAENLPDWIDGALRK
                     AVHPDPFRRYRALSEFLYDLRHPNPAFLGRGRIPLYERNPLLVWQALCFFLVLIIVCL
                     LTVHSR"
     misc_feature    complement(151100..151798)
                     /locus_tag="Mnod_7924"
                     /note="Serine/threonine phosphatases, family 2C, catalytic
                     domain; The protein architecture and deduced catalytic
                     mechanism of PP2C phosphatases are similar to the PP1,
                     PP2A, PP2B family of protein Ser/Thr phosphatases, with
                     which PP2C shares no sequence...; Region: PP2Cc; cd00143"
                     /db_xref="CDD:238083"
     misc_feature    complement(order(151127..151129,151247..151249,
                     151673..151681,151748..151753,151763..151765))
                     /locus_tag="Mnod_7924"
                     /note="active site"
                     /db_xref="CDD:238083"
     misc_feature    complement(150224..150958)
                     /locus_tag="Mnod_7924"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    complement(150416..150958)
                     /locus_tag="Mnod_7924"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(150500..150511,150569..150571,
                     150578..150580,150611..150613,150617..150622,
                     150626..150628,150632..150634,150743..150745,
                     150749..150751,150761..150772,150818..150820,
                     150914..150916,150920..150922))
                     /locus_tag="Mnod_7924"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(150578..150580,150611..150613,
                     150617..150622,150626..150628,150632..150634,
                     150749..150751,150761..150772,150818..150820,
                     150914..150916,150920..150922))
                     /locus_tag="Mnod_7924"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(150500..150511,150569..150571,
                     150620..150622,150626..150628,150632..150634,
                     150743..150745,150749..150751))
                     /locus_tag="Mnod_7924"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(150500..150511,150563..150583))
                     /locus_tag="Mnod_7924"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            complement(151868..152713)
                     /locus_tag="Mnod_7925"
                     /db_xref="GeneID:7295574"
     CDS             complement(151868..152713)
                     /locus_tag="Mnod_7925"
                     /inference="protein motif:PFAM:PF01226"
                     /note="PFAM: formate/nitrite transporter;
                     KEGG: mex:Mext_1131 formate/nitrite transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="formate/nitrite transporter"
                     /protein_id="YP_002490099.1"
                     /db_xref="GI:220914791"
                     /db_xref="InterPro:IPR000292"
                     /db_xref="GeneID:7295574"
                     /translation="MAYLAPSEFVTKMVDAGESKIFMSTRDTVIRAYMAGALLALAAV
                     FAVTVTVQTGSPLVGAILFPVGFCMLYLLGFDLLTGVFVLAPLALIDRRPGVTLGGVL
                     RNWGLVFIGNFAGALTVAVMMAIIFTFGFTTPPDPVGQRIGSIGESRTVGYAAHGAAG
                     MLTLFIRGMLCNWMVSTGVVGAMISTTVPGKVIAMWMPIMVFFFMTFEHSVVNMFLFP
                     SGLMLGGKFSIGDYLIWNEIPTVLGNLVGGLAFTGLTLYTTHIRTGEKRPARDARGAV
                     VYPAE"
     misc_feature    complement(151934..152698)
                     /locus_tag="Mnod_7925"
                     /note="Formate/nitrite transporter; Region:
                     Form_Nir_trans; pfam01226"
                     /db_xref="CDD:250459"
     gene            complement(153048..154472)
                     /locus_tag="Mnod_7926"
                     /db_xref="GeneID:7295575"
     CDS             complement(153048..154472)
                     /locus_tag="Mnod_7926"
                     /EC_number="3.5.2.2"
                     /inference="protein motif:TFAM:TIGR02033"
                     /note="catalyzes the hydrolytic cleavage of hydantoin with
                     aromatic side chains at the 5'position"
                     /codon_start=1
                     /transl_table=11
                     /product="phenylhydantoinase"
                     /protein_id="YP_002490100.1"
                     /db_xref="GI:220914792"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR011778"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="GeneID:7295575"
                     /translation="MSKYDLIIRGGTVVTAADTIRADVAIHAGRIVAVADRLSGGTRE
                     IDAGGLLVMPGGIDSHVHLAQPAFGGPAMADDFESGTRSAIAGGTTTILPFALQPRGA
                     SLRQSVLDYHKEADGKSYCDYGFHLIISDPTPSVLGQELPALVADGYTSFKVFMTYDD
                     LVLNDRQLLEVFDCARDCGALVMVHCEGYDAIRFMTEKLERAGKTAPYYHAASRPASV
                     EREATHRAISHAELVEVPIMIVHVSGREPMEQIRWAQQKGLKVYGETCPQYIALTADD
                     LKGLNMDESGGKYVCSPPPRDRASWDAIWEGIRTGVFQTFSSDHCPFFYEGNQGKLNP
                     KARTSFRWVPNGIPGVETRLQILFSKGVVEGRITLNDFVALTSTNHAKMYGLYPGKGS
                     IAPGFDADIVIWDPNRKETIRQELMHHGADYTPYEGIAVTGWPIMTILRGKLVAEEGR
                     ILGTPGRGRFLKRSLSPFAEPRHS"
     misc_feature    complement(153066..154463)
                     /locus_tag="Mnod_7926"
                     /note="phenylhydantoinase; Validated; Region: PRK08323"
                     /db_xref="CDD:236240"
     misc_feature    complement(153099..154457)
                     /locus_tag="Mnod_7926"
                     /note="D-hydantoinases (D-HYD) also called
                     dihydropyrimidases (DHPase) and related proteins; DHPases
                     are a family of enzymes that catalyze the reversible
                     hydrolytic ring opening of the amide bond in five- or
                     six-membered cyclic diamides, like dihydropyrimidine...;
                     Region: D-HYD; cd01314"
                     /db_xref="CDD:238639"
     misc_feature    complement(order(153297..153299,153312..153314,
                     153327..153329,153696..153701,153705..153710,
                     153789..153791,153798..153800,153810..153812,
                     153822..153824,153891..153893,153900..153902,
                     153909..153911,153972..153974,154371..154376,
                     154413..154415,154419..154424))
                     /locus_tag="Mnod_7926"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238639"
     misc_feature    complement(order(153516..153518,153750..153752,
                     153918..153920,154014..154016,154287..154289,
                     154293..154295))
                     /locus_tag="Mnod_7926"
                     /note="active site"
                     /db_xref="CDD:238639"
     gene            complement(154603..155409)
                     /locus_tag="Mnod_7927"
                     /db_xref="GeneID:7295576"
     CDS             complement(154603..155409)
                     /locus_tag="Mnod_7927"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     short-chain dehydrogenase/reductase SDR; KR domain
                     protein;
                     KEGG: azc:AZC_4370  dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_002490101.1"
                     /db_xref="GI:220914793"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:7295576"
                     /translation="MTDAEPIAVDGNRRLAGQTCIVTGAASGIGRAIARVFARHGAHV
                     VVADISETVLEGGEPTVKLIAHEGGSASFRKTDVSDATAVDALVADTSRLTGRLDVIV
                     NNACIRHARRLAELEEGDWDRMMAVNLKGVFLCCRAAVRQMLTQEIRNEARGRIINLS
                     SQHGMIAAPDDLAYGVGKAGIAYLTRQVAADYAADGIICNAVAPGKIVTGQGGRLLDE
                     AVLDRARRRTPWPRFGRPDDVAQAALFLASGEASFVTGINLMVDGGWMAA"
     misc_feature    complement(154609..155370)
                     /locus_tag="Mnod_7927"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK05565"
                     /db_xref="CDD:235506"
     misc_feature    complement(154624..155352)
                     /locus_tag="Mnod_7927"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(154780..154785,154789..154800,
                     154876..154878,154888..154890,154927..154935,
                     155029..155031,155092..155100,155176..155184,
                     155260..155268,155323..155334,155338..155340))
                     /locus_tag="Mnod_7927"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(154876..154878,154888..154890,
                     154927..154929,155026..155028))
                     /locus_tag="Mnod_7927"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(155406..156374)
                     /locus_tag="Mnod_7928"
                     /db_xref="GeneID:7295577"
     CDS             complement(155406..156374)
                     /locus_tag="Mnod_7928"
                     /inference="protein motif:PFAM:PF01370"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     dTDP-4-dehydrorhamnose reductase; Male sterility domain;
                     KEGG: azc:AZC_4371  short-chain dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_002490102.1"
                     /db_xref="GI:220914794"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR013120"
                     /db_xref="GeneID:7295577"
                     /translation="MTTLITGVSGFVGGALAAALVARSEDVIGVDRAPSPADPREGHG
                     TYRFQAADLRQNGALDPILAEARVDRLIIGAAITADAARERSDPVGVITVNVAAVADA
                     VRSAARHNVGRVLYLGSGAVYGDSAAGAGALVEDETPLRPRSLYAITKQAGEATALRL
                     ADTFGLDLVAARLGTCFGPYERDTGMRDTLSAPYQILRLAASGEPVRLPRPGRRDWLY
                     IRDAVSGLLDAERLNHPVYNVAAGHEWPLTEWCAHVASAYSDFRWSVSGPETANVNLY
                     DAFDRAPMSVARITADTTYRPAFDLAAVARDFLQEPFLQEPWSARQ"
     misc_feature    complement(155442..156374)
                     /locus_tag="Mnod_7928"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     sig_peptide     complement(156300..156374)
                     /locus_tag="Mnod_7928"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.713 at
                     residue 25"
     misc_feature    complement(155655..>156053)
                     /locus_tag="Mnod_7928"
                     /note="extended (e) SDRs; Region: SDR_e; cd08946"
                     /db_xref="CDD:212494"
     misc_feature    complement(order(155733..155735,155751..155753,
                     155787..155789,155850..155852,155937..155939,
                     156018..156020))
                     /locus_tag="Mnod_7928"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212494"
     misc_feature    complement(order(155925..155927,155937..155939,
                     156018..156020))
                     /locus_tag="Mnod_7928"
                     /note="active site"
                     /db_xref="CDD:212494"
     gene            complement(156393..157400)
                     /locus_tag="Mnod_7929"
                     /db_xref="GeneID:7295578"
     CDS             complement(156393..157400)
                     /locus_tag="Mnod_7929"
                     /inference="similar to AA sequence:KEGG:AZC_4375"
                     /note="KEGG: azc:AZC_4375 ABC transporter
                     substrate-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_002490103.1"
                     /db_xref="GI:220914795"
                     /db_xref="GeneID:7295578"
                     /translation="MKAVRRWLACLAMIPLMAAAASAQDKPKIKLGFAKCAHCTPLVL
                     TPEYAKDIDLEVVPFNTGNDVLTALVSKSIDVGQITYLHYATALDKGFDVMAISGQVN
                     GGSQILLSNDLPVEPNDWAGLKTMIAERKAAGKPLKVAASRGNAQDIHMRGAFAKQGI
                     DIAKDVEFVNIPNPSDHAQALRRGEVDLICSVEPFATQIRQVKAGKFFTYPYDQSAGE
                     LTNLMLTRSDVIVANRKGLQSTVGAIVKVDDFVAKNHDAWVGVITKVTGLDKTIAEGA
                     IENLKPDYRMYKPQALAIAAMMKELKYISKDVSAEVSKNMDYSFLQAASGLSAADLGN
                     K"
     misc_feature    complement(156408..157400)
                     /locus_tag="Mnod_7929"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     sig_peptide     complement(157329..157400)
                     /locus_tag="Mnod_7929"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.995 at
                     residue 24"
     misc_feature    complement(156630..157337)
                     /locus_tag="Mnod_7929"
                     /note="NMT1-like family; Region: NMT1_2; cl17432"
                     /db_xref="CDD:266680"
     gene            complement(157429..158094)
                     /locus_tag="Mnod_7930"
                     /db_xref="GeneID:7295579"
     CDS             complement(157429..158094)
                     /locus_tag="Mnod_7930"
                     /inference="protein motif:PFAM:PF07729"
                     /note="PFAM: regulatory protein GntR HTH; GntR domain
                     protein;
                     KEGG: bja:bll3290 transcriptional regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002490104.1"
                     /db_xref="GI:220914796"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="GeneID:7295579"
                     /translation="MRAGLHERAAERLRNMIVRGDLAPGAALIEVELSEMLGISRTPI
                     REAIKLLAQQGLVELRANRSPCVRPLRVAEIRELFEALAGIERIAAEFAAMRITEAEL
                     KRLHELQAEIVREHKAGRRDSYSAANRTIHRTIVLAARNAPLAEAHAALLSRAEQVRV
                     FALGLEDRWEQSILEHQAILDALETRDSGQAGRLLQEHVGQTADVVAASLAGRNSPTS
                     SAA"
     misc_feature    complement(157441..158082)
                     /locus_tag="Mnod_7930"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(157906..158082)
                     /locus_tag="Mnod_7930"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(157906..157911,157915..157920,
                     157948..157950,157957..157962,157966..157980,
                     158002..158007,158077..158079))
                     /locus_tag="Mnod_7930"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(157498..157866)
                     /locus_tag="Mnod_7930"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            158195..158353
                     /locus_tag="Mnod_7931"
                     /db_xref="GeneID:7295580"
     CDS             158195..158353
                     /locus_tag="Mnod_7931"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490105.1"
                     /db_xref="GI:220914797"
                     /db_xref="GeneID:7295580"
                     /translation="MNASYPHFRDADADRLRIYRRFYSHFAQIACSRQKVLARCAAGS
                     PSSVLQPR"
     gene            158397..159248
                     /locus_tag="Mnod_7932"
                     /db_xref="GeneID:7295581"
     CDS             158397..159248
                     /locus_tag="Mnod_7932"
                     /inference="protein motif:PFAM:PF00528"
                     /note="PFAM: binding-protein-dependent transport systems
                     inner membrane component;
                     KEGG: bja:blr3292 ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="binding-protein-dependent transport system inner
                     membrane protein"
                     /protein_id="YP_002490106.1"
                     /db_xref="GI:220914798"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="GeneID:7295581"
                     /translation="MQTASERLPAVRHAAAWRIWSKLERVVVPVLILAGWEAFSRSGY
                     LPQSLLPPPSAVLHALGDWVLGVDGSTQDYSGTWLRHALSSTWRVLAGFVIAGLSGIL
                     IGTAIGWSRSAEKTLEPTLQMLRPVPPVSWIPLAIIWFGIADKPAIFLVFLGAFFPTL
                     MNTIHGVKTIDRNLIRAGAMMGATGRQLLMHIVVPAALPSIFAGLRIAIGSAWMLTVT
                     AEMVAVKSGVGYVLWDSYYFLRYDMVIASMVSIGLLGYLSDFAIKQLMSVVLRWQRNT
                     TVQGREG"
     misc_feature    158448..159212
                     /locus_tag="Mnod_7932"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    158649..159167
                     /locus_tag="Mnod_7932"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(158688..158693,158700..158705,158718..158720,
                     158745..158756,158760..158789,158796..158801,
                     158805..158807,158853..158858,158862..158864,
                     158868..158870,158877..158882,158886..158888,
                     158898..158903,158910..158912,158961..158963,
                     159003..159008,159015..159017,159036..159047,
                     159054..159059,159096..159101,159129..159134,
                     159141..159146,159150..159155,159162..159167)
                     /locus_tag="Mnod_7932"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(158763..158807,159036..159053)
                     /locus_tag="Mnod_7932"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(158805..158807,158838..158840,159054..159056,
                     159090..159092,159099..159101,159129..159131)
                     /locus_tag="Mnod_7932"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(158913..158951,158967..158972,158982..158984)
                     /locus_tag="Mnod_7932"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            159251..160027
                     /locus_tag="Mnod_7933"
                     /db_xref="GeneID:7295582"
     CDS             159251..160027
                     /locus_tag="Mnod_7933"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: bja:blr3293 ABC transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490107.1"
                     /db_xref="GI:220914799"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:7295582"
                     /translation="MAEIAIRNIVKTFTDRARGREVMALDNVSLNIGDHDFVCLLGPS
                     GCGKSTLLNMIAGFEGPSSGRVEVGGSLVTRPGADRGVVFQQPTLMPWLNVADNVAFH
                     LKLRGVRRAERRERAQHFIDLVGLNGFEGHYPSELSGGMNQRVGIARVLLMNPRVILM
                     DEPFAALDAQTKLDMQEELVAIWQRIRCTIVFVTHSVDEALVLGNKIAVMTRRPGRIR
                     DYFDFDMPRPRDITSPEFNDAKRRVLGLIREEAGTSRKAA"
     misc_feature    159251..160000
                     /locus_tag="Mnod_7933"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    159260..159925
                     /locus_tag="Mnod_7933"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    159374..159397
                     /locus_tag="Mnod_7933"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    order(159383..159388,159392..159400,159503..159505,
                     159731..159736,159833..159835)
                     /locus_tag="Mnod_7933"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    159494..159505
                     /locus_tag="Mnod_7933"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    159659..159688
                     /locus_tag="Mnod_7933"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    159719..159736
                     /locus_tag="Mnod_7933"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    159743..159754
                     /locus_tag="Mnod_7933"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    159821..159841
                     /locus_tag="Mnod_7933"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            160045..160491
                     /locus_tag="Mnod_7934"
                     /pseudo
                     /db_xref="GeneID:7295583"
     gene            160500..161279
                     /locus_tag="Mnod_7935"
                     /db_xref="GeneID:7295584"
     CDS             160500..161279
                     /locus_tag="Mnod_7935"
                     /inference="protein motif:PFAM:PF01177"
                     /note="PFAM: Asp/Glu/hydantoin racemase;
                     KEGG: met:M446_0462 Asp/Glu/hydantoin racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="YP_002490108.1"
                     /db_xref="GI:220914800"
                     /db_xref="InterPro:IPR015942"
                     /db_xref="GeneID:7295584"
                     /translation="MTVSHAPKPIRLGMLTPSSNTVLEPVLARMTAQTDISVHYSRFR
                     VTEISLSQQGLGQFAFDAMVQAAELLAHAKVDVIAWNGTSAGWLGFPQDEELCARITA
                     TTGILATSSVLAFRDAFRSLGTKRVGLVTPYTTDVQRRITANWEAAGFPCTAERHLGL
                     ADNFSFAETTGEVIADLVRQVARDGCEAAAIVCTNMRGAAVAPMLERELGIPVIDSVA
                     VTLWASLRLIGAATGDFVDWGQIFSISNAASGASLNVKAIA"
     misc_feature    160530..161186
                     /locus_tag="Mnod_7935"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:260472"
     gene            161276..162046
                     /locus_tag="Mnod_7936"
                     /db_xref="GeneID:7295585"
     CDS             161276..162046
                     /locus_tag="Mnod_7936"
                     /inference="protein motif:PFAM:PF01177"
                     /note="PFAM: Asp/Glu/hydantoin racemase;
                     KEGG: cti:RALTA_A2548  hydantoin racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="Asp/Glu/hydantoin racemase"
                     /protein_id="YP_002490109.1"
                     /db_xref="GI:220914801"
                     /db_xref="InterPro:IPR015942"
                     /db_xref="GeneID:7295585"
                     /translation="MTGPRILLLNPNTSAEMTERMLAAGQSAAAPGTTLVPLTAGRGV
                     PYIATRAEAQIGGAIALEMLAEHHREVDAAIIAAFGDPGLFGARELFDIPVVGLAEAA
                     MLTACMLGRRFAIVSFARALGPWYEECVAMHGLAGRCAGIRLLDSPFQQVAEVQEEKE
                     DLLVQLANKSVREDEADVVILAGAPLSGLAAKVAHRILVPVVDQVAAAVKQAEALLAL
                     KPRKATEGTFKRPPAKRVIGLPDSLAARITHSDGNFET"
     misc_feature    161285..161968
                     /locus_tag="Mnod_7936"
                     /note="Asp/Glu/Hydantoin racemase; Region: Asp_Glu_race;
                     cl00518"
                     /db_xref="CDD:260472"
     gene            162142..162988
                     /locus_tag="Mnod_7937"
                     /pseudo
                     /db_xref="GeneID:7295586"
     gene            complement(163127..164074)
                     /locus_tag="Mnod_7938"
                     /db_xref="GeneID:7295587"
     CDS             complement(163127..164074)
                     /locus_tag="Mnod_7938"
                     /inference="protein motif:PFAM:PF00766"
                     /note="PFAM: Electron transfer flavoprotein
                     alpha/beta-subunit ; Electron transfer flavoprotein alpha
                     subunit;
                     KEGG: met:M446_2006 electron transfer flavoprotein alpha
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit alpha"
                     /protein_id="YP_002490110.1"
                     /db_xref="GI:220914802"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="InterPro:IPR014731"
                     /db_xref="GeneID:7295587"
                     /translation="MATLLLVEHAHGAPKDGSLKALTAARQLGAPVHALVTGAGSRPA
                     AEATARLEGVEKVLLAENAAFDHLLAEPTAALLAELAAGYDAVIAAASTEGKNVLPRV
                     AALLDVAQVSDITKVVAPDTFERPIYAGNAIQTVQVSEPKKVITVRTAAFKAAEAGGA
                     PAPIEAAAAAVAPEVKSAFKGEEIAQSDRPELASARIVVSGGRSLGSAEKFRELIEPL
                     ADALGAAVGASRAAVDAGYAPNDWQVGQTGKVVAPELYVAVGISGAIQHLAGMKDSKV
                     IVAINKDEEAPIFQVADYGLVGDLFQIVPELMDAIEHGR"
     misc_feature    complement(163142..164071)
                     /locus_tag="Mnod_7938"
                     /note="electron transfer flavoprotein subunit alpha;
                     Provisional; Region: PLN00022"
                     /db_xref="CDD:215032"
     misc_feature    complement(163616..164068)
                     /locus_tag="Mnod_7938"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_alpha; cd01715"
                     /db_xref="CDD:238848"
     misc_feature    complement(163250..163510)
                     /locus_tag="Mnod_7938"
                     /note="Electron transfer flavoprotein FAD-binding domain;
                     Region: ETF_alpha; pfam00766"
                     /db_xref="CDD:189709"
     gene            complement(164106..164855)
                     /locus_tag="Mnod_7939"
                     /db_xref="GeneID:7295588"
     CDS             complement(164106..164855)
                     /locus_tag="Mnod_7939"
                     /inference="protein motif:PFAM:PF01012"
                     /note="PFAM: Electron transfer flavoprotein
                     alpha/beta-subunit;
                     KEGG: met:M446_2007 electron transfer flavoprotein
                     alpha/beta-subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="electron transfer flavoprotein subunit
                     alpha/beta"
                     /protein_id="YP_002490111.1"
                     /db_xref="GI:220914803"
                     /db_xref="InterPro:IPR000049"
                     /db_xref="InterPro:IPR014730"
                     /db_xref="GeneID:7295588"
                     /translation="MNILVPVKRVVDYNVKIRVKPDGSGVDLANVKMAMNPFDEIAVE
                     EAIRLKEKAKVSEIVAVSIGPQQAQETLRTALAMGADRGILVRTDAPVEPLAVAKLLR
                     ALVDKEQPQLVILGKQAIDDDANQTGQMLAALLGWPQGTFAYRIELGEGSLEVTREID
                     GGLQTLTLALPAIVTTDLRLNEPRYASLPNIMKAKKKPLDTLEPAALGVDVAPRLKVL
                     KTVEPGGRQAGVKVASAAELVSKLKGEAGVL"
     misc_feature    complement(164250..164852)
                     /locus_tag="Mnod_7939"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_beta; cd01714"
                     /db_xref="CDD:238847"
     misc_feature    complement(order(164475..164486,164499..164504,
                     164508..164513,164667..164669,164739..164741,
                     164748..164750,164835..164840))
                     /locus_tag="Mnod_7939"
                     /note="Ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:238847"
     gene            complement(164878..165831)
                     /locus_tag="Mnod_7940"
                     /pseudo
                     /db_xref="GeneID:7295589"
     gene            165912..166193
                     /locus_tag="Mnod_7941"
                     /db_xref="GeneID:7295590"
     CDS             165912..166193
                     /locus_tag="Mnod_7941"
                     /inference="similar to AA sequence:KEGG:M446_3774"
                     /note="KEGG: met:M446_3774 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490112.1"
                     /db_xref="GI:220914804"
                     /db_xref="GeneID:7295590"
                     /translation="MRTAGTAAVAIVLSALGIGAAEAKGCIKGAIIGGVAGHYLANRG
                     IVGAVAGCLGGRYIASRNARREVDYGARVAPPGSGYGPGRPYSRREYNY"
     sig_peptide     165912..165983
                     /locus_tag="Mnod_7941"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.997) with cleavage site probability 0.682 at
                     residue 24"
     gene            166254..166727
                     /locus_tag="Mnod_7942"
                     /db_xref="GeneID:7295591"
     CDS             166254..166727
                     /locus_tag="Mnod_7942"
                     /inference="protein motif:PFAM:PF06078"
                     /note="PFAM: protein of unknown function DUF937;
                     KEGG: met:M446_3775 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490113.1"
                     /db_xref="GI:220914805"
                     /db_xref="InterPro:IPR009282"
                     /db_xref="GeneID:7295591"
                     /translation="MSEGYPSMTALLGLLALAGYQNRDKLAELFGGGGQQSAPVAGAP
                     SGEGNSGGLGGLLGSLGGAPGGAGAGRFLHSGLAEMLERFQQSGHGPIAQSWVNHGPN
                     QEISPQQLEQAIGPDVLATLSQRTGLSREELLSRLSRDLPQAVDRYTPDGRVPAY"
     misc_feature    <166479..166721
                     /locus_tag="Mnod_7942"
                     /note="Bacterial protein of unknown function (DUF937);
                     Region: DUF937; cl01528"
                     /db_xref="CDD:260981"
     gene            166871..167134
                     /locus_tag="Mnod_7943"
                     /db_xref="GeneID:7295592"
     CDS             166871..167134
                     /locus_tag="Mnod_7943"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mrd:Mrad2831_2432 acetylornithine deacetylase
                     or succinyl-diaminopimelate desuccinylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490114.1"
                     /db_xref="GI:220914806"
                     /db_xref="GeneID:7295592"
                     /translation="MGQDVVFDLPLADLPAVGTEPSDRLAMTKSWIVREVTQAAGEVI
                     GMPCFTDGSVLQGAFGRCPTVILGPGEHSQAHQTNECYGIQWA"
     misc_feature    <166880..167110
                     /locus_tag="Mnod_7943"
                     /note="Zinc peptidases M18, M20, M28, and M42; Region:
                     Zinc_peptidase_like; cl14876"
                     /db_xref="CDD:265470"
     gene            complement(167122..168561)
                     /locus_tag="Mnod_7944"
                     /db_xref="GeneID:7295593"
     CDS             complement(167122..168561)
                     /locus_tag="Mnod_7944"
                     /EC_number="3.5.2.2"
                     /inference="protein motif:PFAM:PF01979"
                     /note="PFAM: amidohydrolase; Amidohydrolase 3;
                     KEGG: bav:BAV0626 hydantoinase"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="YP_002490115.1"
                     /db_xref="GI:220914807"
                     /db_xref="InterPro:IPR006680"
                     /db_xref="InterPro:IPR013108"
                     /db_xref="GeneID:7295593"
                     /translation="MSTDYDLLIRGGEAVLPGRGRTACDIAVRDGRIAAILAPGAPAT
                     APSELDARGLVVMPGAIDVHLHLGHGRDIARPRVPEDAARESAAAASGGITCFIPYLM
                     TSEPFSTVLPEVIAVTQAGSRIDFSYHPIISTEEQLAEVERCAREFGAPTFKIFMNNR
                     GGEGARLGLPDIDDGFLLRLCEAAARAGGMVCPHPETIELAWVTRDRAKAADPDGIGG
                     LATWNASRPPFVEADAVQRAGYVAKTAGAPLYVVHTSSAEALAAGLRQRQAGATLFLE
                     TCPHYLTHDIGWTGGDLGKINPPLREAADREALWAGILSGAIDTIATDHVHRGLEAKA
                     GGIWAASPGCPGLETLLPVLLSEGYHARGLSLERVVDLVSTNPARLMGLAHRKGAIAP
                     GLDADLAVIDLDAAWTFDRGAVLSSAGYSLYEGWQFRGRVVHTAVRGHLVLRDGALQD
                     ERIGIGRYVSRSLATQHRCAAPSGLLHAH"
     misc_feature    complement(167224..168549)
                     /locus_tag="Mnod_7944"
                     /note="Dihydroorotase and related cyclic amidohydrolases
                     [Nucleotide transport and metabolism]; Region: PyrC;
                     COG0044"
                     /db_xref="CDD:223122"
     misc_feature    complement(167218..168543)
                     /locus_tag="Mnod_7944"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    complement(order(167590..167592,167803..167805,
                     167980..167982,168364..168366,168370..168372))
                     /locus_tag="Mnod_7944"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            complement(168558..169955)
                     /locus_tag="Mnod_7945"
                     /db_xref="GeneID:7295594"
     CDS             complement(168558..169955)
                     /locus_tag="Mnod_7945"
                     /inference="protein motif:PFAM:PF03972"
                     /note="PFAM: MmgE/PrpD family protein;
                     KEGG: rfr:Rfer_4189 MmgE/PrpD"
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="YP_002490116.1"
                     /db_xref="GI:220914808"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="GeneID:7295594"
                     /translation="MTIARSLARRVRALARDKLPPAVDAAARLHLLDAIGVGLAAAAS
                     EAGAPYRRYAAGVARGGPAPILGLSATAAPADAALVNGGLIHGLEFDDTHTGSIVHGS
                     AVLAPAALAAGQAAGSSGAAVLSGYALGWEALIRIGLAAPGAFQAWGFQITSVGGALV
                     AALIAAELAGLSEDETVAAVGIALSGASGGFEFLTNGASVKSLHPGFAAHAGLTAAAL
                     AQAGLTGPETAFEGRCGLFAAFAGDARAAEAFAASLDDLGTVWHLQDAAFKFHPCCHY
                     LHPFVEAAGMLAARGVEADDIASLTCRVPAGAGPVICEPWEAKQAPVTGHAARWSLPV
                     VVAARLVEGRVDLATFEAPAGEAVRALSRRIGWEPLAGARFPAVFEAEILALMRDGEQ
                     HHVRVDDVYGNAGRPAEAAAVREKFRSNAARALASDAIRGVEAAVDELTAAPSLDALE
                     AALSKAASHPARSDA"
     misc_feature    complement(168699..169955)
                     /locus_tag="Mnod_7945"
                     /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
                     /db_xref="CDD:260693"
     gene            complement(169952..171322)
                     /locus_tag="Mnod_7946"
                     /db_xref="GeneID:7295595"
     CDS             complement(169952..171322)
                     /locus_tag="Mnod_7946"
                     /inference="protein motif:PFAM:PF00890"
                     /note="PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein; FAD dependent oxidoreductase;
                     KEGG: bpa:BPP1131  fumarate reductase flavoprotein
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase/succinate dehydrogenase
                     flavoprotein domain-containing protein"
                     /protein_id="YP_002490117.1"
                     /db_xref="GI:220914809"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:7295595"
                     /translation="MSEDDLDILVIGAGACGLAAAVAGHDAGASVAVIEKQERPGGNS
                     SLSTGSVPAAGSRFQREAGIDDDPARMVRDLMAIARETDDRALVERLAGVSAETVEWL
                     VDTVGARLALITAYKHIGHSVPRLHAPVSRRGQDLVDDLVAAAERRGIPIAVGNGATD
                     LLVEDGAVRGAIVSVEGERTEIRAGKTILALNGFAANPDLVRRFCPEIAGAQYFGARG
                     STGEAVLWGERLGAALANMAAYQGYAAVAYPQGSLLSWTTVEKGGIIVGDDARRFGDE
                     SLGYSGYARIVLSRGGDAYVVFDQKIFDVAAAEEEFMELWTYGGLKRGETPAEIARPF
                     GLDAAALGEEIAMRNAAAAGTAPDRHGRRDFGLGPLEPPFYIGRVVPGLFHTQGGLKV
                     DGDARVLRPDGTPVPNLFAGGGAAAGISGRSGALGYASGNGLLSAIALGRLAALAAAR
                     ELGRTP"
     misc_feature    complement(170093..171304)
                     /locus_tag="Mnod_7946"
                     /note="flavocytochrome c; Region: flavo_cyto_c; TIGR01813"
                     /db_xref="CDD:233583"
     misc_feature    complement(170021..171244)
                     /locus_tag="Mnod_7946"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(171319..172710)
                     /locus_tag="Mnod_7947"
                     /db_xref="GeneID:7295596"
     CDS             complement(171319..172710)
                     /locus_tag="Mnod_7947"
                     /inference="protein motif:PFAM:PF03972"
                     /note="PFAM: MmgE/PrpD family protein;
                     KEGG: bbr:BB1350 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MmgE/PrpD family protein"
                     /protein_id="YP_002490118.1"
                     /db_xref="GI:220914810"
                     /db_xref="InterPro:IPR005656"
                     /db_xref="GeneID:7295596"
                     /translation="MKARRDAGLRARTAEAARALAAWAAEAVRGDLPDAVRDRAALIL
                     ADDLGAMVAAADEPPVARMRAVLARSSGVPEATVFAPGAPRLDRASAASANGLAATWC
                     ELDEGYRGAPCHAGAYVLPALLAEAEARSETVSAVLAALAVSYEIAVRCARAFPFETM
                     TVHPHAAFATIGAAAGIGLIRGFDAERLLDAVSAAATMAFAGPYDHAIEGALVRNAWT
                     SAGAWIGLRAADGAEAGIAGLPESFYDVFAGAFGTGCVPQALAEGLGTDWAVLGGYHK
                     VFACCQYAHAAIEATLALRQRFAGCRPEEIEEIVVETHPRGLTLTNVEPATVLAAKFS
                     MPHAVAASAITGTGGQGAFDQRTLDDPQIAALRRRVRLEALPEIGPPPHDRPSRVTWR
                     LRDGAWLTELCESARGGADQPFDTGTMLEKLRETTRGFPRMASCLGAIVQGGRGAAPW
                     RDCVAEMTSEVVR"
     misc_feature    complement(171424..172620)
                     /locus_tag="Mnod_7947"
                     /note="MmgE/PrpD family; Region: MmgE_PrpD; cl00912"
                     /db_xref="CDD:260693"
     gene            complement(172714..173397)
                     /locus_tag="Mnod_7948"
                     /db_xref="GeneID:7295597"
     CDS             complement(172714..173397)
                     /locus_tag="Mnod_7948"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: nca:Noca_0215 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490119.1"
                     /db_xref="GI:220914811"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:7295597"
                     /translation="MLEIRSLSAGYGTLTALDGISARLSAGARLGIFGHNGAGKTTLL
                     RCIVGAHAARAGEVVFDGEPVRPGNVPATIRRGIAFVPQGHNVFPNLTVAQNLATAGL
                     LFDRGFVGEVLKIFPLLEERRSQRAGSLSGGEQQMLALGMALMTQPKWLLLDEPSTGL
                     APVIVRNVMSQLAKVNAAFGTGLIIVEQNVPATLKVVEHCLILKSGRTVFEGTAETLS
                     AKPDLWEWF"
     misc_feature    complement(172729..173397)
                     /locus_tag="Mnod_7948"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    complement(172741..173394)
                     /locus_tag="Mnod_7948"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    complement(173275..173298)
                     /locus_tag="Mnod_7948"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(order(172834..172836,172933..172938,
                     173149..173151,173272..173280,173284..173289))
                     /locus_tag="Mnod_7948"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(173149..173160)
                     /locus_tag="Mnod_7948"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(172981..173010)
                     /locus_tag="Mnod_7948"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(172933..172950)
                     /locus_tag="Mnod_7948"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(172915..172926)
                     /locus_tag="Mnod_7948"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    complement(172828..172848)
                     /locus_tag="Mnod_7948"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            complement(173402..174160)
                     /locus_tag="Mnod_7949"
                     /db_xref="GeneID:7295598"
     CDS             complement(173402..174160)
                     /locus_tag="Mnod_7949"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: met:M446_2268 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490120.1"
                     /db_xref="GI:220914812"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:7295598"
                     /translation="MTPVLEIAGLDKRFGGIVVADGIDLTLPAGRIVGLIGPNGAGKT
                     SLFNLISGVFPSDAGTIRLDGQRLDGLPMHRRAGLGLARTWQNLRLFPSLSVLDNLMV
                     GPRRYPGDRLLRLALDPFGVRAQEAETRRRAREILERTRLAAVAATRAADLTFGQQKL
                     VGVARALMNDARCLLLDEPMAGVEGQAYEVMQQVVRDVAAGGVAVCVVEHNVAFIRDL
                     CDEGVFMFAGKVLARGPVADLIADPRLTELYFGT"
     misc_feature    complement(173405..174160)
                     /locus_tag="Mnod_7949"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(173429..174148)
                     /locus_tag="Mnod_7949"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    complement(174029..174052)
                     /locus_tag="Mnod_7949"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(order(173531..173533,173627..173632,
                     173903..173905,174026..174034,174038..174043))
                     /locus_tag="Mnod_7949"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(173903..173914)
                     /locus_tag="Mnod_7949"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(173675..173704)
                     /locus_tag="Mnod_7949"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(173627..173644)
                     /locus_tag="Mnod_7949"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(173609..173620)
                     /locus_tag="Mnod_7949"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    complement(173525..173545)
                     /locus_tag="Mnod_7949"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            complement(174160..175041)
                     /locus_tag="Mnod_7950"
                     /db_xref="GeneID:7295599"
     CDS             complement(174160..175041)
                     /locus_tag="Mnod_7950"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: bpt:Bpet0797 ABC transporter permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_002490121.1"
                     /db_xref="GI:220914813"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:7295599"
                     /translation="MDYLFTLAILIGLSIALASSFNLIIGYAGLISIAHPVFYAIGAY
                     VSALLARDLGVPVPLAMLCGALAAAAASAAVALPSLRVSGDYLLIASIGFQLGVLEAI
                     KNIAVTGGAGGLTNIPPFLVHEAGRGAYVALVLGFAALTVWLNWTIAHGPYGRALSAM
                     RDDELAFAGLGRNAVSMKVAVFAFGSAVAGLAGALYAHYFRFVTPEQFEILQSAALLT
                     MVVVGGIRTTWGPVLGAVLLQALPQAITFLDLPPALLGPLQGLMFTGLVLVFMFWRPQ
                     GLIAAGDAWRPSKRETA"
     sig_peptide     complement(174985..175041)
                     /locus_tag="Mnod_7950"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.899) with cleavage site probability 0.748 at
                     residue 19"
     misc_feature    complement(174205..175011)
                     /locus_tag="Mnod_7950"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    complement(174493..174549)
                     /locus_tag="Mnod_7950"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(175044..176012)
                     /locus_tag="Mnod_7951"
                     /db_xref="GeneID:7295600"
     CDS             complement(175044..176012)
                     /locus_tag="Mnod_7951"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: mes:Meso_4481 inner-membrane translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_002490122.1"
                     /db_xref="GI:220914814"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:7295600"
                     /translation="MLTFDILAQVLWTSFATSTYLVLFAVAFALVLKVNRIFNFAQAA
                     VMTVAFYAAHATVSMAGLPGWLGCLLALVAAVTASALLELVGFRSLRRRRATPMFVFI
                     FTLIVSEMVAYLAMLIFGTWPTTIFPSLFWPVTLVGNVAVSDWDLPAIASMVGALALL
                     FGFLRYAQTGRFMIAVADNPDLAELYGIEKDRVYLATIVTAGLLVGIGMCLYGSRAQV
                     QPTTSIELMLFAVAATIIGGIGNLWGAALTAVALGVVQNASVLFIPAEWQGFLLYVFL
                     FLAIVFLPNGIRLPDRRRGLARRIARVDLGETKPAETAAASGRGKA"
     misc_feature    complement(175152..175952)
                     /locus_tag="Mnod_7951"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    complement(175416..175472)
                     /locus_tag="Mnod_7951"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            complement(176048..177202)
                     /locus_tag="Mnod_7952"
                     /db_xref="GeneID:7295601"
     CDS             complement(176048..177202)
                     /locus_tag="Mnod_7952"
                     /inference="protein motif:PFAM:PF01094"
                     /note="PFAM: Extracellular ligand-binding receptor;
                     KEGG: bvi:Bcep1808_4051 extracellular ligand-binding
                     receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular ligand-binding receptor"
                     /protein_id="YP_002490123.1"
                     /db_xref="GI:220914815"
                     /db_xref="InterPro:IPR000709"
                     /db_xref="InterPro:IPR001828"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:7295601"
                     /translation="MRQSAPSVSRRAFLAASLAAAAIGPARAEEALRFGMAMPLSGGQ
                     ATYGQDQVKAAEWAVAAINERGGVAGRKLEMIVLDTRADPQAGIQAANRLISVDKVPV
                     FVSAWSAVVKAVAPVANDSRTVQLSVGANSAEIARLGDYTYTTFPLASVDITAVATYA
                     AKQMGKKRAAVLYINNETGTVAAQIYRDVFAKSGGQVVAYEAYDPRASDWTGPLLKVR
                     AAQPDIVHIQGLVADTPQVIAQMRQLGLTLPVSSYSAVYNPKLIEQLGKAAEGVIATS
                     LAPGVTDSPAVAAYVERWKKEVGREPNGLPYTQYLYDAPYIVAEVYRSLIEKKIPLSG
                     ENFRKEMLAIRSFDLPLTGKLVINDDHTVNKPVFLMEVKGGRWVQKAVVE"
     sig_peptide     complement(177116..177202)
                     /locus_tag="Mnod_7952"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 29"
     misc_feature    complement(176246..177106)
                     /locus_tag="Mnod_7952"
                     /note="Periplasmic binding domain of ATP-binding cassette
                     transporter-like systems that belong to the type I
                     periplasmic binding fold protein superfamily; Region:
                     PBP1_ABC_transporter_LIVBP_like; cd06268"
                     /db_xref="CDD:107263"
     misc_feature    complement(176123..177043)
                     /locus_tag="Mnod_7952"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    complement(176813..176818)
                     /locus_tag="Mnod_7952"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107263"
     gene            complement(177279..177962)
                     /locus_tag="Mnod_7953"
                     /db_xref="GeneID:7295602"
     CDS             complement(177279..177962)
                     /locus_tag="Mnod_7953"
                     /inference="protein motif:PFAM:PF00857"
                     /note="PFAM: isochorismatase hydrolase;
                     KEGG: bbr:BB1344 hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_002490124.1"
                     /db_xref="GI:220914816"
                     /db_xref="InterPro:IPR000868"
                     /db_xref="GeneID:7295602"
                     /translation="MDRKPWDGLISEEEQRAYNAAGFGRATGLGRRPALLIIDVQYRT
                     TGTTPMPFWEAIKEYPTACGDVAWAAVERIERLLGLFRERGWPVLYPLVAPKAAFDRG
                     RLSDKVPAIMTVAAKGYEFPPEIAPREGDILLPKKHPSAFFGTPLTSYLINLQADSLV
                     VTGCSTSGCVRGSVVDAFAYNFRVLVPHDAVYDRSATSHAVNLFDMASKYADVMSTDE
                     ALEALRALV"
     misc_feature    complement(177303..177863)
                     /locus_tag="Mnod_7953"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cl00220"
                     /db_xref="CDD:260273"
     misc_feature    complement(order(177456..177458,177555..177557,
                     177846..177848))
                     /locus_tag="Mnod_7953"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    complement(177468..177473)
                     /locus_tag="Mnod_7953"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238245"
     gene            complement(177974..178840)
                     /locus_tag="Mnod_7954"
                     /db_xref="GeneID:7295603"
     CDS             complement(177974..178840)
                     /locus_tag="Mnod_7954"
                     /inference="similar to AA sequence:KEGG:BB4108"
                     /note="KEGG: bbr:BB4108 carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /protein_id="YP_002490125.1"
                     /db_xref="GI:220914817"
                     /db_xref="GeneID:7295603"
                     /translation="MRATQTLKSILARREAVSVPGAANALFARVIEDLGFEAVYVTGA
                     GVANMQLGAPDIGLTSITEVASTVAAVADAVALPIIVDADTGFGNAVNMIRTVRLLER
                     AGAAGIQIEDQVFPKKCGHFTGKDVIPRDEMVQKVKAAVDARRDGDLQIIARTDARAV
                     EGLERAIERAQAYIEAGADATFVEAPVSAEELGRIARDLKVPQVANIVFGGKTPDPGR
                     ERLAEMGFSIVLYANAALQAALKASYEVLGALKRDGSLSAVADRLASFEERQRAVAKD
                     EWDALEARYRAA"
     misc_feature    complement(178094..178822)
                     /locus_tag="Mnod_7954"
                     /note="Members of the ICL/PEPM enzyme family catalyze
                     either P-C or C-C bond formation/cleavage. Known members
                     are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
                     hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
                     oxaloacetate hydrolase (OAH), isocitrate...; Region:
                     ICL_PEPM; cd00377"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(178097..178105,178109..178117,
                     178121..178129,178415..178417,178424..178429,
                     178436..178438,178445..178450,178535..178537,
                     178544..178546,178556..178561,178577..178579,
                     178619..178624,178631..178636,178640..178645,
                     178652..178657,178661..178672,178679..178684,
                     178694..178699,178709..178711,178730..178738,
                     178742..178744,178751..178756,178760..178774,
                     178778..178789,178793..178795,178814..178816))
                     /locus_tag="Mnod_7954"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(178145..178147,178217..178219,
                     178223..178225,178289..178291,178379..178381,
                     178508..178510,178589..178591,178595..178597,
                     178676..178678,178709..178717,178721..178723))
                     /locus_tag="Mnod_7954"
                     /note="active site"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(178508..178510,178589..178591,
                     178595..178597,178676..178678))
                     /locus_tag="Mnod_7954"
                     /note="Mg2+/Mn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:119340"
     gene            179328..180029
                     /locus_tag="Mnod_7955"
                     /db_xref="GeneID:7295604"
     CDS             179328..180029
                     /locus_tag="Mnod_7955"
                     /inference="protein motif:PFAM:PF07729"
                     /note="PFAM: regulatory protein GntR HTH; GntR domain
                     protein;
                     KEGG: pap:PSPA7_4721 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002490126.1"
                     /db_xref="GI:220914818"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="GeneID:7295604"
                     /translation="MTALFPIAATSLVDEAFTKLVAAITSGEFAPGERLSEAELARQL
                     GISRGPLREALHRLEGRLVVRTPRIGVRVVEFDRDTLEQLFLVREALEGMAARLAAER
                     MTSREQDEIANLLDRHAGQPDVASGKSYVQVSTDEDFHFAIVRSSRNPRLEQLLLDEV
                     YYQLRLHRLRSSTRPGRAQAALAEHREILAALQSRDPDRAEEAMRKHIRSARFSALAD
                     LEATGTSKSRSKHKA"
     misc_feature    179328..179963
                     /locus_tag="Mnod_7955"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    179358..179546
                     /locus_tag="Mnod_7955"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(179358..179360,179364..179366,179436..179441,
                     179463..179477,179481..179486,179493..179495,
                     179520..179525,179529..179540)
                     /locus_tag="Mnod_7955"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    179574..179957
                     /locus_tag="Mnod_7955"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(180031..180562)
                     /locus_tag="Mnod_7956"
                     /pseudo
                     /db_xref="GeneID:7295605"
     gene            180742..181329
                     /locus_tag="Mnod_7957"
                     /db_xref="GeneID:7295606"
     CDS             180742..181329
                     /locus_tag="Mnod_7957"
                     /inference="protein motif:PFAM:PF02525"
                     /note="PFAM: NAD(P)H dehydrogenase (quinone);
                     NADPH-dependent FMN reductase;
                     KEGG: mpo:Mpop_3256 NAD(P)H dehydrogenase (quinone)"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H dehydrogenase (quinone)"
                     /protein_id="YP_002490127.1"
                     /db_xref="GI:220914819"
                     /db_xref="InterPro:IPR003680"
                     /db_xref="InterPro:IPR005025"
                     /db_xref="GeneID:7295606"
                     /translation="MRVLLIYSHPCSDSFSSTLRQIAAEALSSAGHEVEVRDLYAESF
                     DPVLSEQERRTYYDESTISEGAGDHVASLRQAQALVFVYPTWWFGSPAMLKGWFDRVW
                     LPGVAFRLSGPNDLQPRLTNIQRIVVVTTYGSPRWLLWLLGWPDWRVFKRAIRTLCAP
                     RCRLEWLSLTGMDNCTDDKRRRFAAKIRVRLSNWK"
     misc_feature    180742..181326
                     /locus_tag="Mnod_7957"
                     /note="Putative NADPH-quinone reductase (modulator of drug
                     activity B) [General function prediction only]; Region:
                     MdaB; COG2249"
                     /db_xref="CDD:225158"
     gene            complement(181615..181989)
                     /locus_tag="Mnod_7958"
                     /db_xref="GeneID:7295607"
     CDS             complement(181615..181989)
                     /locus_tag="Mnod_7958"
                     /inference="similar to AA sequence:KEGG:M446_5600"
                     /note="KEGG: met:M446_5600 response regulator receiver
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_002490128.1"
                     /db_xref="GI:220914820"
                     /db_xref="GeneID:7295607"
                     /translation="MTGERVSRGCILIAEDEALIGIELADQLELRGFAAAGPFTTCSE
                     AEQWLRYNEPVAAILDNTLADGPCDALAQDLESRGIPFIVYSGYDHTASLPSVFQRAP
                     WIVKPASVETVLDHLSGLLGDK"
     misc_feature    complement(181621..181959)
                     /locus_tag="Mnod_7958"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cl19078"
                     /db_xref="CDD:267431"
     gene            complement(182143..183393)
                     /locus_tag="Mnod_7959"
                     /db_xref="GeneID:7295608"
     CDS             complement(182143..183393)
                     /locus_tag="Mnod_7959"
                     /inference="protein motif:PFAM:PF07536"
                     /note="PFAM: GAF domain protein; HWE histidine kinase;
                     KEGG: met:M446_5599 signal transduction histidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_002490129.1"
                     /db_xref="GI:220914821"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR011102"
                     /db_xref="GeneID:7295608"
                     /translation="MPEAGIWRKRLPRLNPGLSCVVAVYPALRVPRVAGASECAAWDE
                     EKRLAALRAYQVLDTPNEDGFDEIVQLAAQICQTPMAAISLVEDRRQWFKAEVGLGIR
                     ETPIDASVCATTVLAPGLTIVPDMILDARFATNPLIASCPYLRFYAGARLETPDGLPL
                     GSLCVLDRNPRPGLSSEQASALMTLSRQVTNQLELRRTVIERDEALSRVRQTETRQHL
                     LVRELHHRTRNNLAVLQALFGVTTRASGSVDELYRSFADRIASLARTQALLSDDYWQT
                     ARLHDMLAHEFEWHIKHRNGRVVLDGPELDLAADLAVPFGMALHELRSNAERHGALSS
                     ADGKVEVKWSLIRQDGKRLLHLNWSEQGGPRARKPFRAGVGMKIQRMLEVQCGAEVKT
                     EFLTEGLHVSITAPLIEARLVPEY"
     misc_feature    complement(182776..183273)
                     /locus_tag="Mnod_7959"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    complement(182161..182808)
                     /locus_tag="Mnod_7959"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG3920"
                     /db_xref="CDD:226434"
     misc_feature    complement(182482..182730)
                     /locus_tag="Mnod_7959"
                     /note="HWE histidine kinase; Region: HWE_HK; pfam07536"
                     /db_xref="CDD:148894"
     gene            183767..184327
                     /locus_tag="Mnod_7960"
                     /db_xref="GeneID:7295609"
     CDS             183767..184327
                     /locus_tag="Mnod_7960"
                     /inference="similar to AA sequence:KEGG:M446_5853"
                     /note="KEGG: met:M446_5853 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490130.1"
                     /db_xref="GI:220914822"
                     /db_xref="GeneID:7295609"
                     /translation="MTRKRVQRPFTVEVKGRSRLQPAGQEISKPSTSSPPPSVLWAGT
                     DLGRELARAGEKFSNLVSARPAEKQKVEARRVLPSLLVAEPITVEPDPEPTLEPRLPR
                     VRRVTSAKKVTKTTRSKRNAASPANSQPPIRVEPAPQPTPATPARSAAPPIPLRVTRS
                     RRSRAEAVQPLKPGQRWKRRLSRFCR"
     gene            complement(184620..184916)
                     /locus_tag="Mnod_7961"
                     /db_xref="GeneID:7295610"
     CDS             complement(184620..184916)
                     /locus_tag="Mnod_7961"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490131.1"
                     /db_xref="GI:220914823"
                     /db_xref="GeneID:7295610"
                     /translation="MSRSAGMIPFHSVQRSAPPAGTRMPDRATAVAQAEIAAAGGAKE
                     NSIPVKALASAAVSRRKRLRTQPRCLNCRRDSAGVITDLLPVTAWSRTCSKTAA"
     gene            185004..185276
                     /locus_tag="Mnod_7962"
                     /db_xref="GeneID:7295611"
     CDS             185004..185276
                     /locus_tag="Mnod_7962"
                     /inference="similar to AA sequence:KEGG:M446_1049"
                     /note="KEGG: met:M446_1049 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490132.1"
                     /db_xref="GI:220914824"
                     /db_xref="GeneID:7295611"
                     /translation="MSDTAGIPGDRIRTIIERVEKLEEEIKDLTEAKKEIFLEAKSDG
                     LDVKILKEIIKLRKQDQDERDEHETLLDVYLRAMDAPTPTPSAQAA"
     misc_feature    185022..185237
                     /locus_tag="Mnod_7962"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2312); Region: DUF2312; pfam10073"
                     /db_xref="CDD:204391"
     gene            complement(185405..185943)
                     /locus_tag="Mnod_7963"
                     /pseudo
                     /db_xref="GeneID:7295612"
     gene            186105..187151
                     /locus_tag="Mnod_7964"
                     /db_xref="GeneID:7295613"
     CDS             186105..187151
                     /locus_tag="Mnod_7964"
                     /inference="protein motif:PFAM:PF02371"
                     /note="PFAM: transposase IS116/IS110/IS902 family protein;
                     KEGG: nha:Nham_4120 transposase IS116/IS110/IS902"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS116/IS110/IS902 family protein"
                     /protein_id="YP_002490133.1"
                     /db_xref="GI:220914825"
                     /db_xref="InterPro:IPR003346"
                     /db_xref="GeneID:7295613"
                     /translation="MKYYAGLDVSLEETAICVVDDTGRIVREARAASEPGALVQALNQ
                     IGLPLERIGLEACSLTAWLHDGLREAGLPAICIETRQANAAMKTMPNKTDRNDARALA
                     QIMRTGWFRQVHVKSRQCRPWRSLLVARRTVLNEMRSIENVVRGILREAGLKLGTPGR
                     AAFAGRVRELAEGVPLMTQLVEPLLEVLASMLTALAGLTKQVMDLVKKEAVCQRLMSV
                     PGVGPITALAFRATIDRPDRFRRSRDVGAHLGLTPARYQSGETDIQGKISRCGDELAR
                     TALYEAAHTLLVRSQKWSSLRAWGMKIARRRGMARARVAVARKLAVILHRMWSDGTAF
                     RWGKEPAEGATLAG"
     misc_feature    186114..186521
                     /locus_tag="Mnod_7964"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    186123..187088
                     /locus_tag="Mnod_7964"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    186738..186998
                     /locus_tag="Mnod_7964"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            complement(187848..188387)
                     /locus_tag="Mnod_7965"
                     /db_xref="GeneID:7295614"
     CDS             complement(187848..188387)
                     /locus_tag="Mnod_7965"
                     /inference="similar to AA sequence:KEGG:Rsph17025_3315"
                     /note="KEGG: rsq:Rsph17025_3315 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490134.1"
                     /db_xref="GI:220914826"
                     /db_xref="GeneID:7295614"
                     /translation="MDGSGSRHSRGPTAAAILFGLGLGGFFDGSVRHQILHGPHMLTS
                     AGYPADRVGNLKANTLGDGLFHASTSLVTWAGLFILWRDARQNHIRWSGLLLPGGILM
                     GFGIFNLVEGTVDHHLRGPHQVNQTVPRETWIYWDGGFLLWGAAMLIGGWAMLRQGQA
                     STRAKAASKPLWTAKITSD"
     misc_feature    complement(187911..188306)
                     /locus_tag="Mnod_7965"
                     /note="Predicted membrane protein (DUF2243); Region:
                     DUF2243; cl01783"
                     /db_xref="CDD:261066"
     gene            complement(188635..189660)
                     /locus_tag="Mnod_7966"
                     /db_xref="GeneID:7295615"
     CDS             complement(188635..189660)
                     /locus_tag="Mnod_7966"
                     /inference="protein motif:PFAM:PF00353"
                     /note="PFAM: Hemolysin-type calcium-binding region;
                     KEGG: met:M446_3007 hemolysin-type calcium-binding region"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin-type calcium-binding protein"
                     /protein_id="YP_002490135.1"
                     /db_xref="GI:220914827"
                     /db_xref="InterPro:IPR001343"
                     /db_xref="GeneID:7295615"
                     /translation="MAIINGTPGPDQLVGTNGPDLINGLAGDDILLGLAGNDEINGGP
                     GFDRIDGQDGNDILDGGDDVDYIAGGLGNDTIYGRGGADQLIGEAGDDLIFGNEGDDY
                     AAGNPGNDILYGGDGNDFFVGEAGFDYVSGDNGNDFVKGGDDDDTVLGGTGDDLVEGD
                     LGNDFLDGGAGRDVLYGDAGNDRILAGLDDDQALGGLGDDVLFGEFGNDFLRGEDGND
                     FIGAGAGNDDLSGGAGNDALYGEAGNDLLFGNAGNDELVGGTGSDTFGFGRGDGQDLI
                     RDFVTGGPERDVIAFNGGVFTSFAAVQAATQQVGADAVISYGAGDTIRLQNVQASSLT
                     AANFTFS"
     misc_feature    complement(188704..189660)
                     /locus_tag="Mnod_7966"
                     /note="RTX toxins and related Ca2+-binding proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG2931"
                     /db_xref="CDD:225483"
     gene            190139..190249
                     /locus_tag="Mnod_7967"
                     /db_xref="GeneID:7295616"
     CDS             190139..190249
                     /locus_tag="Mnod_7967"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490136.1"
                     /db_xref="GI:220914828"
                     /db_xref="GeneID:7295616"
                     /translation="MSNGEHRSRRRRLVAVIVGFLVALFLTAAVLLIWVK"
     sig_peptide     190139..190225
                     /locus_tag="Mnod_7967"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.996) with cleavage site probability 0.978 at
                     residue 29"
     gene            complement(190832..191848)
                     /locus_tag="Mnod_7968"
                     /db_xref="GeneID:7295617"
     CDS             complement(190832..191848)
                     /locus_tag="Mnod_7968"
                     /inference="protein motif:PFAM:PF01551"
                     /note="PFAM: Peptidase M23;
                     KEGG: swi:Swit_4002 peptidase M23B"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M23"
                     /protein_id="YP_002490137.1"
                     /db_xref="GI:220914829"
                     /db_xref="InterPro:IPR016047"
                     /db_xref="GeneID:7295617"
                     /translation="MRSVLRTALSIPILLAEVSVARAEGISLRLPLACEPGHTCFVQH
                     YVDHDPSPGIRDYACGSQTNDGHDGTDFRPPTRAAEAREVGTVLAAASGRVLRTRNDV
                     PDVSVRETGRAAVAGVECGNGLVIAHAGGYETQYCHLARDSLRVRSGDVVAAGQPIGQ
                     AGLSGATEFPHLHFTVRQHGKVVDPFAPGATTGACDAEAKLVSALWDEVARGRLVYRA
                     GTVLNSGFAGGPVSMDAVEAEATEAAGPNADALVAWVRAIGLAPGDVQQLNLTGPDGK
                     VIIERQEPPLVRPRAQSLLYAGKKRPPEGWLPGTYTATFKVMRSGSAAIEHTFTAMLP
                     TQVP"
     sig_peptide     complement(191777..191848)
                     /locus_tag="Mnod_7968"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.930) with cleavage site probability 0.802 at
                     residue 24"
     misc_feature    complement(191282..>191833)
                     /locus_tag="Mnod_7968"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    complement(191294..191653)
                     /locus_tag="Mnod_7968"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            complement(192260..192940)
                     /locus_tag="Mnod_7969"
                     /db_xref="GeneID:7295618"
     CDS             complement(192260..192940)
                     /locus_tag="Mnod_7969"
                     /inference="protein motif:SMART:SM00091"
                     /note="SMART: PAS domain containing protein;
                     KEGG: mex:Mext_1329 PAS sensor protein"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor protein"
                     /protein_id="YP_002490138.1"
                     /db_xref="GI:220914830"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="GeneID:7295618"
                     /translation="MVVVRHLRADPRMGSDLGSSPQDLLADEAELFQIIVESALDFAI
                     FTIDESGIATSWNTGAERLLGLARSEAIGESADVIFTPEDRAEGIPEAERHKAPGRGR
                     ALAPAQGRLPLLGVRAFSCRCAMVSRVSPRSSAIALKLSRPSSGSGRTRSASASSPPA
                     SRSSSSAARATAAARGVAPNGKTTRELCQPPTPPCRVRRSRSTSRPSPLSSHGTPSHA
                     DGGQSTGH"
     misc_feature    complement(<192680..192823)
                     /locus_tag="Mnod_7969"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(192695..192706,192743..192745,
                     192761..192763,192773..192775))
                     /locus_tag="Mnod_7969"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     gene            complement(192984..193466)
                     /locus_tag="Mnod_7970"
                     /db_xref="GeneID:7295619"
     CDS             complement(192984..193466)
                     /locus_tag="Mnod_7970"
                     /inference="protein motif:SMART:SM00448"
                     /note="SMART: response regulator receiver;
                     KEGG: mpo:Mpop_1920 response regulator receiver protein"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver and SARP
                     domain-containing protein"
                     /protein_id="YP_002490139.1"
                     /db_xref="GI:220914831"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:7295619"
                     /translation="MYRRVLVVEDEYLLAYDLARALQKLGAFVVGPVPELEQVLALPA
                     DEPMDAAVLDVNLKGQFVFPLADALREDGVPFVFATGYNESAIPGAHKDVPRWEKPFK
                     PEDLTRALPEIVQQSKECCWRNRREDPPERGSLLLRAKRSSRHGCTLTDVNAGGNLPP
                     "
     misc_feature    complement(193137..193451)
                     /locus_tag="Mnod_7970"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(193167..193172,193188..193190,
                     193227..193229,193281..193283,193305..193307,
                     193437..193442))
                     /locus_tag="Mnod_7970"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(193305..193307)
                     /locus_tag="Mnod_7970"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(193281..193289,193293..193298))
                     /locus_tag="Mnod_7970"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(193164..193172)
                     /locus_tag="Mnod_7970"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            194084..194272
                     /locus_tag="Mnod_7971"
                     /db_xref="GeneID:7295620"
     CDS             194084..194272
                     /locus_tag="Mnod_7971"
                     /inference="similar to AA sequence:KEGG:M446_4060"
                     /note="KEGG: met:M446_4060 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490140.1"
                     /db_xref="GI:220914832"
                     /db_xref="GeneID:7295620"
                     /translation="MRSSITFRGRGSASLMGDRIILHVCPLCSQRNIAVVAPQGRCAW
                     CDYVPDPRDVETTGNEAD"
     gene            194814..195053
                     /locus_tag="Mnod_7972"
                     /db_xref="GeneID:7295621"
     CDS             194814..195053
                     /locus_tag="Mnod_7972"
                     /inference="similar to AA sequence:KEGG:M446_0567"
                     /note="KEGG: met:M446_0567 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490141.1"
                     /db_xref="GI:220914833"
                     /db_xref="GeneID:7295621"
                     /translation="MPLLEAYNLFRRKGKPALCCAVRQDRPVPTFVQSEAWEEAWEYA
                     GTVSASDSTPAGFKAKAAREATAVSGYYLFYALNG"
     gene            195330..195548
                     /locus_tag="Mnod_7973"
                     /db_xref="GeneID:7295622"
     CDS             195330..195548
                     /locus_tag="Mnod_7973"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mrd:Mrad2831_4647 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490142.1"
                     /db_xref="GI:220914834"
                     /db_xref="GeneID:7295622"
                     /translation="MAPASEISIEEIRTRAYDIWERNHCPSGFEVEFWLLAERELRAE
                     REAKRRDASDAGPADERAASNQAPNSSC"
     misc_feature    195357..195461
                     /locus_tag="Mnod_7973"
                     /note="Protein of unknown function (DUF2934); Region:
                     DUF2934; pfam11154"
                     /db_xref="CDD:256323"
     gene            195764..197407
                     /locus_tag="Mnod_7974"
                     /db_xref="GeneID:7295623"
     CDS             195764..197407
                     /locus_tag="Mnod_7974"
                     /inference="protein motif:PFAM:PF00128"
                     /note="PFAM: alpha amylase catalytic region;
                     SMART: alpha amylase catalytic sub domain;
                     KEGG: met:M446_3483 alpha amylase catalytic region"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha amylase"
                     /protein_id="YP_002490143.1"
                     /db_xref="GI:220914835"
                     /db_xref="InterPro:IPR006047"
                     /db_xref="InterPro:IPR006589"
                     /db_xref="GeneID:7295623"
                     /translation="MRETADKLDRSRLNDAHSPADRPWWQQEVIYQIFTPSFQDSNGD
                     GIGDLAGILSRVDYLARLGIGAVWLTPIYPSPLLDAGYDIADFTGVGSCFGDLATFDR
                     LLTALHDRGIRLILDLVPNHTSDQHPWFIESRSSRYNPKRDWYIWADPVPGPLPPNNW
                     LSRFGASAWAYDPTTGQSYYHAFLPEQPDLNWRNPQVRAAIHDAMRFWLRRGVDGFRV
                     DAAAVLAEDALLRDEPPNPDFDGDTPRPERFRRTRTDSQAVTRGYLTELRRVVDEFPD
                     RVLLGEVDTTPDKLPSFYGEDEPRLHLPLNYRLLEVPWKPDAVGRAVQAFLDTMPESA
                     WPDWVLGSHDKPRIASRLGPEQARVAAMLLMTLPGTPILYAGDEIGMENVPVPPALGQ
                     DPFERCVPGYGLSRDPFRVPLRWAPESGAGFTTGEPWLPTGPLPLGSTVAEQEEDPCS
                     LLALYRRLTGLRRDRPELQAGRYRRILSEGGVLAYARWLDGSGLVIALNLSASDVAPT
                     LDCRGRVVLGTVLDRDGERIDGCIRLSPHEGVIIAAEDG"
     misc_feature    195830..197179
                     /locus_tag="Mnod_7974"
                     /note="Alpha amylase catalytic domain found in
                     oligo-1,6-glucosidase (also called isomaltase;
                     sucrase-isomaltase; alpha-limit dextrinase) and related
                     proteins; Region: AmyAc_OligoGlu_like; cd11331"
                     /db_xref="CDD:200470"
     misc_feature    195833..197389
                     /locus_tag="Mnod_7974"
                     /note="alpha,alpha-phosphotrehalase; Region:
                     trehalose_treC; TIGR02403"
                     /db_xref="CDD:233851"
     misc_feature    order(195998..196000,196007..196009,196118..196120,
                     196127..196129,196253..196255,196310..196312,
                     196322..196324,196418..196420,196607..196609,
                     196790..196795)
                     /locus_tag="Mnod_7974"
                     /note="active site"
                     /db_xref="CDD:200470"
     misc_feature    order(196418..196420,196607..196609,196793..196795)
                     /locus_tag="Mnod_7974"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200470"
     misc_feature    197123..197386
                     /locus_tag="Mnod_7974"
                     /note="Domain of unknown function (DUF3459); Region:
                     DUF3459; pfam11941"
                     /db_xref="CDD:256746"
     gene            197587..198126
                     /locus_tag="Mnod_7975"
                     /db_xref="GeneID:7295624"
     CDS             197587..198126
                     /locus_tag="Mnod_7975"
                     /inference="protein motif:PFAM:PF05974"
                     /note="PFAM: protein of unknown function DUF892;
                     KEGG: mpo:Mpop_4293 protein of unknown function DUF892"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490144.1"
                     /db_xref="GI:220914836"
                     /db_xref="InterPro:IPR010287"
                     /db_xref="GeneID:7295624"
                     /translation="MAAKPKTLQDAFYETLRDVYYAERQSVRALKNSAKAAENEELRQ
                     AFETHAEESANQVERLQEVFDLIGKPARGKTCEAMQGLTAEMEEDLEDFGDSPAADAV
                     LVGCAQAVEHYEIARYGTLKTWAIQLGYKDAAKLLDETLQEEKKTDQLLTQIAERINV
                     EATGTTQGGGAQGKSGKEA"
     misc_feature    197611..198051
                     /locus_tag="Mnod_7975"
                     /note="YciF bacterial stress response protein,
                     ferritin-like iron-binding domain; Region: YciF; cd07909"
                     /db_xref="CDD:153118"
     misc_feature    order(197626..197628,197638..197640,197812..197820,
                     197827..197829,197839..197841,197854..197856,
                     197899..197904,197908..197910,197923..197925,
                     197935..197937,197944..197946)
                     /locus_tag="Mnod_7975"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153118"
     misc_feature    order(197653..197655,197731..197733,197743..197745,
                     197752..197754,197917..197919,197926..197928,
                     197938..197940,198016..198018)
                     /locus_tag="Mnod_7975"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:153118"
     gene            198566..199039
                     /locus_tag="Mnod_7976"
                     /pseudo
                     /db_xref="GeneID:7295625"
     gene            complement(199097..202216)
                     /locus_tag="Mnod_7977"
                     /db_xref="GeneID:7295626"
     CDS             complement(199097..202216)
                     /locus_tag="Mnod_7977"
                     /inference="protein motif:TFAM:TIGR00229"
                     /note="KEGG: ret:RHE_PF00076 chemotaxis methyltransferase
                     protein;
                     TIGRFAM: PAS sensor protein;
                     PFAM: GAF domain protein; HWE histidine kinase; PAS fold-3
                     domain protein; PAS fold-4 domain protein; PAS fold domain
                     protein;
                     SMART: PAS domain containing protein; PAC
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_002490145.1"
                     /db_xref="GI:220914837"
                     /db_xref="InterPro:IPR000014"
                     /db_xref="InterPro:IPR000700"
                     /db_xref="InterPro:IPR001610"
                     /db_xref="InterPro:IPR003018"
                     /db_xref="InterPro:IPR011102"
                     /db_xref="InterPro:IPR013655"
                     /db_xref="InterPro:IPR013656"
                     /db_xref="InterPro:IPR013767"
                     /db_xref="GeneID:7295626"
                     /translation="MLSATRGDLPIGVDDVLITAELASRPSRTPDYEAESRALGLLAQ
                     EMATNPDRVLQRCAELVIELCHADSAGISILEPGGTTGIFRWHAAAGRFAANLHGTMP
                     REASPCETVIARNSVLLFNEAERFFPDQRRVVPPVYESLLAPWQLNGKPIGTLWALKH
                     TPEGRFDAEDARLLQSLARFASAAYQMTSALKEAKAGREELEWRVAERTIAYSQAYNA
                     AQTSEARLRAALEIETVGAIYLAPEGLIIDANGAFLAMGGYSRADLEGGRLTWQTLTP
                     PEWMAASERALAELKATGQSPPYEKEYFRKDGSRWHALFAGKLLPDGLIFEFVLDITA
                     RKQAEQALATELKAMTRLHELSRQVVNGAGLQAALDAILDAAMDLHGADFGDIQLYDE
                     ETRTLRIAAQRGFGQPFLDHFAEVDAAEDSACGVALARRERVVIEDVEQEPAFAPSLE
                     AARAAGYRAVQSTPLFTPTGETLGMLSTHFRQPHRLSDLDLRLIDVYGRLASDTIAWM
                     RAETALRESEARLAHELDGARQLQRISSELLPEQRPAALYEQILDAMMAVMGSQAASM
                     QILDPDTGTLKLLAWRGFHPDAAAFWDRVDSNSASTCGEALKTGRRTLVSDIESCGFM
                     AGTKDLEAYRRSNLRAVQSTPLMSRTGRALGMVSTHWREPHEPSIDDFSRFDVLTRQA
                     ADLIERAQTEAALRESEERFRQFGETSSDLLWIRDADTLRFEYLNPAFDTIYGECRDR
                     VMGDNTIEQWAELTHPDDRKQALNTLDRLRRGEFVEHEFRIVRPSDGQVRWIRDTDFP
                     LLDVAGQVQRIAGIAKDVTKQKETAERMKVLVAELQHRTRNLIGVVRSTFDRTLAKSS
                     SLDEHRDAFHGCLAALARVNGLLSRLNEGDRISFDELLQAELAGQGVMDREEHGPQVT
                     LAGPKGVRLRSSTVQTLALGLHELVTNAVKHGALSQPEGRLLVQWCVIHGDHGEPRLR
                     VEWQDSGVPVALSPEGQPPRQGYGRELIERALPYQLGAETAYELTPDGVRCTITLPIS
                     TRQVEIVDA"
     misc_feature    complement(201665..202072)
                     /locus_tag="Mnod_7977"
                     /note="GAF domain; Region: GAF_3; pfam13492"
                     /db_xref="CDD:257816"
     misc_feature    complement(201191..201553)
                     /locus_tag="Mnod_7977"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(201248..201514)
                     /locus_tag="Mnod_7977"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(201293..201295,201308..201310,
                     201386..201397,201440..201442,201458..201460,
                     201470..201472))
                     /locus_tag="Mnod_7977"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(201266..201268,201272..201274,
                     201356..201361,201368..201370,201392..201394,
                     201404..201406))
                     /locus_tag="Mnod_7977"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(200699..201094)
                     /locus_tag="Mnod_7977"
                     /note="GAF domain; Region: GAF_2; pfam13185"
                     /db_xref="CDD:257553"
     misc_feature    complement(200156..200596)
                     /locus_tag="Mnod_7977"
                     /note="GAF domain; Region: GAF_2; pfam13185"
                     /db_xref="CDD:257553"
     misc_feature    complement(199742..200125)
                     /locus_tag="Mnod_7977"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(199769..200092)
                     /locus_tag="Mnod_7977"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(199856..199858,199874..199876,
                     199949..199960,200009..200011,200027..200029,
                     200039..200041))
                     /locus_tag="Mnod_7977"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(199829..199831,199835..199837,
                     199919..199924,199931..199933,199955..199957,
                     199967..199969))
                     /locus_tag="Mnod_7977"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(199127..199783)
                     /locus_tag="Mnod_7977"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG3920"
                     /db_xref="CDD:226434"
     misc_feature    complement(199463..199723)
                     /locus_tag="Mnod_7977"
                     /note="HWE histidine kinase; Region: HWE_HK; smart00911"
                     /db_xref="CDD:214907"
     misc_feature    complement(199139..199444)
                     /locus_tag="Mnod_7977"
                     /note="Histidine kinase-like ATPase domain; Region:
                     HATPase_c_2; pfam13581"
                     /db_xref="CDD:257897"
     gene            202714..202956
                     /locus_tag="Mnod_7978"
                     /db_xref="GeneID:7295627"
     CDS             202714..202956
                     /locus_tag="Mnod_7978"
                     /inference="protein motif:COG:COG1671"
                     /note="KEGG: met:M446_0652 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490146.1"
                     /db_xref="GI:220914838"
                     /db_xref="GeneID:7295627"
                     /translation="MSQPDQIAIFVDADACSVKDKVYRVAARYGLHVFMVANSFMNLP
                     REPWIERVVVQQRSSATHRRHGRRPPRSGRWWWSIP"
     misc_feature    202738..>202878
                     /locus_tag="Mnod_7978"
                     /note="Uncharacterized BCR, YaiI/YqxD family COG1671;
                     Region: DUF188; cl00727"
                     /db_xref="CDD:260591"
     gene            complement(203835..203981)
                     /locus_tag="Mnod_7979"
                     /db_xref="GeneID:7295628"
     CDS             complement(203835..203981)
                     /locus_tag="Mnod_7979"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490147.1"
                     /db_xref="GI:220914839"
                     /db_xref="GeneID:7295628"
                     /translation="MGPLVVPFVRRIGSEVMMPAMMAVSPILHLMQHLGLRLRRQAGG
                     PAQR"
     gene            complement(204059..204538)
                     /locus_tag="Mnod_7980"
                     /db_xref="GeneID:7295629"
     CDS             complement(204059..204538)
                     /locus_tag="Mnod_7980"
                     /inference="protein motif:PFAM:PF04214"
                     /note="PFAM: protein of unknown function DUF411;
                     KEGG: mpo:Mpop_2562 protein of unknown function DUF411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490148.1"
                     /db_xref="GI:220914840"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR007332"
                     /db_xref="GeneID:7295629"
                     /translation="MISRPPLTRRTLLAGLGSLVAVVPLRAAAGSLPRVAVTKDPNCG
                     CCEAWVAHLRTAGFPVAVTTGPVAPLKATLGVPRALASCHTAQVGGYVIEGHVPAEAI
                     TRLLTEKPAATGLAVPGMPIGSPGMEVEGMDPDTYEVVLFGPAGTRTFARYRGATLL"
     sig_peptide     complement(204449..204538)
                     /locus_tag="Mnod_7980"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.814 at
                     residue 30"
     misc_feature    complement(204074..204514)
                     /locus_tag="Mnod_7980"
                     /note="Protein of unknown function, DUF; Region: DUF411;
                     cl01142"
                     /db_xref="CDD:242329"
     gene            complement(204560..207733)
                     /locus_tag="Mnod_7981"
                     /db_xref="GeneID:7295630"
     CDS             complement(204560..207733)
                     /locus_tag="Mnod_7981"
                     /inference="protein motif:TFAM:TIGR00914"
                     /note="TIGRFAM: heavy metal efflux pump, CzcA family;
                     PFAM: acriflavin resistance protein;
                     KEGG: mpo:Mpop_2563 heavy metal efflux pump, CzcA family"
                     /codon_start=1
                     /transl_table=11
                     /product="CzcA family heavy metal efflux pump"
                     /protein_id="YP_002490149.1"
                     /db_xref="GI:220914841"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="InterPro:IPR004763"
                     /db_xref="GeneID:7295630"
                     /translation="MIARLIGWSARNLVLVLIGTVFAVAAGLHALRTLPLDAIPDLSD
                     VQTIVYTEYPGQAPQVVEDQVTYPLTTAMLTVPKSKVVRGFSFFGVSFVYVIFEDGTD
                     PYWARSRVLEYLSTAASRLPAGVTPGLGPDATGVGWVYQYAILAKQKTLAELRSLQDW
                     VVRFGASRAEGVAEVASVGGFVKQYNVVVDPNRLRALGLPLTKLREAIRASNTDVGGR
                     TVELSEFEFMVRGRGYLKSPADLENIVLKTEGGTPLRLRDVARVELGPDERRGLTELN
                     GDGEVAGGIILQRFGANALTVIESAKQRLAEIAHSLPAGTEIVPVYDRSQLIDAAIET
                     LKSTLIEESLIVALVCVVFLLHLRSALVAILMLPVGILMALGAMRFLGIGANIMSLGG
                     IAIAVGAMIDAAIVMIENAHKHLERAPPDAPRTQILIDAAGEVGPSLFFSLLVITVSF
                     LPIFTLESQEGRLFGPLAFTKTFAMAAAALLSVTLVPALMVVFVRGRIIPEHRNPLNR
                     LLIRLYRPVIRGVLRARLLTILLAVVALGATVWPARQLGSEFMPELNEGTLMYMPTTL
                     PGVSITKAAELLATQDRIIKSFPEVASVYGKAGRANTATDPAPTEMFETIINLKPKAE
                     WRPGVTLASLKAEMDAALQFPGVSNAWTQPIRARIDMLATGIRTPVGVKIFGTDLGAM
                     EQVARQVEAVIRAVPGTASAYAERVIGGYFLDITPDREALGRYGLMVGDVQDVIAMAL
                     GGESVTTTVEGRERYTVNLRYPRAFRASPQAIAGEVQVPLPAGGTVPLGEVAKVQLTR
                     GPTSIRTENGRLAVYLFVDISGRDLGGYVAAAQAAVAHEVKLPPGMSLQWSGQFEYLE
                     RAEARLRIVVPLTLLVIVLLLYLNFRRLTETLIVMLSLPFALVGGVWLLWWMGFNLSV
                     AVVVGFIALAGVAAETGVIMLVYLDHALAEVRAVRDKAGQPLTRDDLRQAIMVGAVER
                     VRPKMMTVAAIMAGLLPILWSTGAGSEVMQRIAVPMIGGMVSSTVLTLVVIPAVYALI
                     KGRGLPRAAGTAAPPAVAAQSYRHAAE"
     misc_feature    complement(204623..207733)
                     /locus_tag="Mnod_7981"
                     /note="Putative silver efflux pump [Inorganic ion
                     transport and metabolism]; Region: COG3696"
                     /db_xref="CDD:226220"
     sig_peptide     complement(207656..207733)
                     /locus_tag="Mnod_7981"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.931) with cleavage site probability 0.556 at
                     residue 26"
     misc_feature    complement(206177..>206728)
                     /locus_tag="Mnod_7981"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            complement(207730..209190)
                     /locus_tag="Mnod_7982"
                     /db_xref="GeneID:7295631"
     CDS             complement(207730..209190)
                     /locus_tag="Mnod_7982"
                     /inference="protein motif:TFAM:TIGR01730"
                     /note="TIGRFAM: efflux transporter, RND family, MFP
                     subunit;
                     PFAM: secretion protein HlyD family protein;
                     KEGG: mpo:Mpop_4111 efflux transporter, RND family, MFP
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_002490150.1"
                     /db_xref="GI:220914842"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:7295631"
                     /translation="MSRSAWLAGTLAALAAGGAGYWAGHGSNPAPALLDRARTEFALW
                     LPPAAAPPPAAPAPAPRGPVVYYQDPDGRPAYSLEPTRTPDGRAFRPVHASEDIHFET
                     DDMEADGPADRPPDAPAGGEKKRILYYRNPMGLPDTSPVPKKDSMGMDYLPVYAGEDT
                     DGSAVTISPGKIQRTGVRSETIERRVLSQPVRAPGTVEEDERRVSVIATRTDAFVETV
                     ESVTTGDHVHKGQPLLRLFSPEINAAAAQYLSAIGYEGARRRLENLAIPPEVIDEIER
                     TRKVPAAITWTSPRDGVVVERNVSDGMRAQAGAVLFRIVDHSRVWVLADVPERDLAAV
                     AEGQRAIVRARAFPDRAFTGTVTRIYPHLSTGTRTARLRIELPNPNGDLRPAMYADVE
                     ITTGSDAPVVAVPDDAVIDTGTRQVVILDKGEGRFEPREVKVGRRGDGYVEIREGLQA
                     GAQVVTAANFLIDAESNLKAALQSMAAATPAPEAAR"
     sig_peptide     complement(209119..209190)
                     /locus_tag="Mnod_7982"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.537 at
                     residue 24"
     misc_feature    complement(207766..208863)
                     /locus_tag="Mnod_7982"
                     /note="copper/silver efflux system membrane fusion protein
                     CusB; Provisional; Region: PRK09783"
                     /db_xref="CDD:236625"
     misc_feature    complement(208450..208584)
                     /locus_tag="Mnod_7982"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    complement(208036..208338)
                     /locus_tag="Mnod_7982"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(209187..209522)
                     /locus_tag="Mnod_7983"
                     /pseudo
                     /db_xref="GeneID:7295632"
     gene            complement(209668..210057)
                     /locus_tag="Mnod_7984"
                     /db_xref="GeneID:7295633"
     CDS             complement(209668..210057)
                     /locus_tag="Mnod_7984"
                     /inference="similar to AA sequence:KEGG:Mrad2831_3810"
                     /note="KEGG: mrd:Mrad2831_3810 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490151.1"
                     /db_xref="GI:220914843"
                     /db_xref="GeneID:7295633"
                     /translation="MFWKALMRLLATLAVVSLALAPVTTSVAAAAPGMSAAMVDHAVD
                     PAEPMDGMAATAMDDMPCCPPAKPAMPDCQKGCPLAALCLAKLAPALPAGIGVPMPVA
                     VAQTAPWWVSAAFRSLAPPPPSEPPRA"
     sig_peptide     complement(209965..210057)
                     /locus_tag="Mnod_7984"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.490 at
                     residue 31"
     gene            complement(210130..210255)
                     /locus_tag="Mnod_7985"
                     /db_xref="GeneID:7295634"
     CDS             complement(210130..210255)
                     /locus_tag="Mnod_7985"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490152.1"
                     /db_xref="GI:220914844"
                     /db_xref="GeneID:7295634"
                     /translation="MMHGAMADMGGMMGSMAIFGLLVLLLLILAIAALIKFLLAR"
     gene            complement(210467..211801)
                     /locus_tag="Mnod_7986"
                     /db_xref="GeneID:7295635"
     CDS             complement(210467..211801)
                     /locus_tag="Mnod_7986"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_4843 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490153.1"
                     /db_xref="GI:220914845"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295635"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDVMAVTGLNRPD
                     FRTIAEFRKRHLAALSDLFVQVLRLCQAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKTTEAALAAEVEAWLAQAAEMDAAEDRAHGMDRRGDETPDWMADKQRRLAAIRAAKA
                     ALEAEAADPPAPEDESGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTEPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAQRLVTNAADYRALVPLIDDVSAHLGRKPREVSGDAGF
                     ATEANLTALQARRIRGYLPPGRARHGEAHAAGRRKLTKMPLMSAMAQRLKRAGRRSRY
                     RLRKQVVEPVFGQMKQARGFRQFLLRGLEQVRGEWAMICTAHNLLKLAQAAR"
     misc_feature    complement(211340..211738)
                     /locus_tag="Mnod_7986"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    complement(210494..210973)
                     /locus_tag="Mnod_7986"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(210482..>210712)
                     /locus_tag="Mnod_7986"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            211965..212891
                     /locus_tag="Mnod_7987"
                     /pseudo
                     /db_xref="GeneID:7295636"
     gene            complement(213276..214346)
                     /locus_tag="Mnod_7988"
                     /db_xref="GeneID:7295637"
     CDS             complement(213276..214346)
                     /locus_tag="Mnod_7988"
                     /inference="similar to AA sequence:KEGG:M446_6157"
                     /note="KEGG: met:M446_6157 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490154.1"
                     /db_xref="GI:220914846"
                     /db_xref="GeneID:7295637"
                     /translation="MSDTNPHPFKMAIVWWGDAEERAAARPETSRLKAIFAALERHGI
                     TAEPAVWSDALTDKVRAQLMSVDGVLVWVNPITTPGGEGRGVLDDLLREVAAAGIFVS
                     SHPDIIARMGVKEVLYRTRKLGWGTDTHVYGTYVAFRAEFPERVATGPRVLKQNRGNG
                     GLGVWKIERAAGVDVVVQEAWGSRRVRTIPLDVFMEERAVNFTAAGTLIDQPFQARHL
                     EGMIRCYLSGDQVVGFGHQLVRALAPPEAGPAGPRLYFGPDDPRFQRLRGLLEQEWTP
                     QMAHLLGLGLGDLPVIWDADFLLGPQTPTGEDTYVLCEINASSVFPIPDEAPEAIART
                     TFRRLEATPRSRASHSSTQADQ"
     gene            complement(214458..215465)
                     /locus_tag="Mnod_7989"
                     /db_xref="GeneID:7295638"
     CDS             complement(214458..215465)
                     /locus_tag="Mnod_7989"
                     /inference="protein motif:PFAM:PF01436"
                     /note="PFAM: NHL repeat containing protein;
                     KEGG: met:M446_6158 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NHL repeat containing protein"
                     /protein_id="YP_002490155.1"
                     /db_xref="GI:220914847"
                     /db_xref="InterPro:IPR001258"
                     /db_xref="GeneID:7295638"
                     /translation="MLPKPFGSALVRTAAGLLLAVQLAPGRAADTAPMLLDQKIPLGN
                     VRGRIDHLAFDAARHRLFIAELGNDSIGIVDVSDGKLVHRIPGLHEPQGIAYLASNDT
                     VFVANAGDGTVRWYNGSDYASLGAMRLGEDADNIRLDQRTGQVIVGYGQGAIAVLAPD
                     GTKLEEIRLAGHPESFQLGPQGSQIYVNVPDAHEIAVLDRDNGRQIAHWSLPSARANF
                     PMALDPSGERLLVVYRKPALLAVFDIKDGSALAQVPTCGDADDIWVDRKRRRIYISCG
                     EGALDVLQEEGRSYRELARIPTVSGARTSLFLPKLDRLFLAVRASNREGAAIWVFRPA
                     D"
     sig_peptide     complement(215379..215465)
                     /locus_tag="Mnod_7989"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.975) with cleavage site probability 0.669 at
                     residue 29"
     misc_feature    complement(<215148..>215354)
                     /locus_tag="Mnod_7989"
                     /note="SdiA-regulated; Region: SdiA-regulated; cl19046"
                     /db_xref="CDD:267399"
     misc_feature    complement(<214827..>215288)
                     /locus_tag="Mnod_7989"
                     /note="FOG: WD40 repeat [General function prediction
                     only]; Region: COG2319"
                     /db_xref="CDD:225201"
     gene            complement(215495..216112)
                     /locus_tag="Mnod_7990"
                     /db_xref="GeneID:7295639"
     CDS             complement(215495..216112)
                     /locus_tag="Mnod_7990"
                     /inference="protein motif:PFAM:PF02777"
                     /note="PFAM: manganese and iron superoxide dismutase;
                     KEGG: met:M446_6159 manganese and iron superoxide
                     dismutase"
                     /codon_start=1
                     /transl_table=11
                     /product="manganese and iron superoxide dismutase"
                     /protein_id="YP_002490156.1"
                     /db_xref="GI:220914848"
                     /db_xref="InterPro:IPR001189"
                     /db_xref="GeneID:7295639"
                     /translation="MTYAIKPLGCDPARIKGMSERLIVSHYENNYGGAVKRLNLIEEQ
                     LAGLDYETTPGFVINGLKREQLIAMNSMILHELFFGGLGQESEPGPVLRKALARSFGS
                     FERWRSEFIAMGKALAGGSGWVLLSWSPRDGQLVNQWAADHAHTLAGGVPILALDMYE
                     HSYQIDYGSKAATYVDTFMQAIRWENADRLFFSLREGERTTMTPG"
     misc_feature    complement(215540..215854)
                     /locus_tag="Mnod_7990"
                     /note="Iron/manganese superoxide dismutases, C-terminal
                     domain; Region: Sod_Fe_C; pfam02777"
                     /db_xref="CDD:251524"
     gene            complement(216223..217185)
                     /locus_tag="Mnod_7991"
                     /db_xref="GeneID:7295640"
     CDS             complement(216223..217185)
                     /locus_tag="Mnod_7991"
                     /inference="protein motif:PFAM:PF07485"
                     /note="PFAM: protein of unknown function LppY and LpqO;
                     KEGG: met:M446_6160 protein of unknown function LppY and
                     LpqO"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490157.1"
                     /db_xref="GI:220914849"
                     /db_xref="InterPro:IPR011094"
                     /db_xref="GeneID:7295640"
                     /translation="MRRQIASLFALSLVALAPPVQAAETWQQAIATGLGKPGTEMPGG
                     VYRVSLPRTDLAVTLDGVSIKPALALGSWLAFRKAGENQVMVMGDLVLTEDEVNPVMT
                     RLVEGGVEITALHNHLLRASPNPLYMHVSGHGEPETLAATLMGALGASRTPFGAETAT
                     GTPPAGHPGPASAGASPAPARATASDQAQPLDTAAIEAALGRKGKLNGGVYAVSVPRA
                     ETPRDHGMDVPEAMGSAIAINFQPTGGGKAAITGDFVLTADEVNPVIKTLRQNGIEVT
                     ALHNHMLGDEPRLFFMHFWANDDTAKLAKGLGAALKHVKVASGG"
     sig_peptide     complement(217117..217185)
                     /locus_tag="Mnod_7991"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 23"
     misc_feature    complement(216736..217104)
                     /locus_tag="Mnod_7991"
                     /note="Domain of Unknown Function (DUF1259); Region:
                     DUF1529; pfam07485"
                     /db_xref="CDD:254226"
     misc_feature    complement(216250..216609)
                     /locus_tag="Mnod_7991"
                     /note="Domain of Unknown Function (DUF1259); Region:
                     DUF1529; pfam07485"
                     /db_xref="CDD:254226"
     gene            complement(217226..217594)
                     /locus_tag="Mnod_7992"
                     /db_xref="GeneID:7295641"
     CDS             complement(217226..217594)
                     /locus_tag="Mnod_7992"
                     /inference="similar to AA sequence:KEGG:M446_6161"
                     /note="KEGG: met:M446_6161 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490158.1"
                     /db_xref="GI:220914850"
                     /db_xref="GeneID:7295641"
                     /translation="MRPWHRGLWQGGAVLLFSLGLAHPAPAAETFRQLTGPQIRARLT
                     GKEVTDEVHWAYRFEPGGRLQTVSMGRARTGIWRLQGDALCLNADPCLQVWMAGTHVE
                     FRRDGALPEEGVLQAPARRP"
     sig_peptide     complement(217508..217594)
                     /locus_tag="Mnod_7992"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.834) with cleavage site probability 0.501 at
                     residue 29"
     gene            complement(217594..218181)
                     /locus_tag="Mnod_7993"
                     /pseudo
                     /db_xref="GeneID:7295553"
     gene            complement(218175..218582)
                     /locus_tag="Mnod_7994"
                     /pseudo
                     /db_xref="GeneID:7295556"
     gene            complement(218737..219528)
                     /locus_tag="Mnod_7995"
                     /db_xref="GeneID:7295557"
     CDS             complement(218737..219528)
                     /locus_tag="Mnod_7995"
                     /inference="protein motif:PFAM:PF03649"
                     /note="PFAM: conserved hypothetical protein;
                     KEGG: met:M446_0072 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490159.1"
                     /db_xref="GI:220914851"
                     /db_xref="InterPro:IPR005226"
                     /db_xref="GeneID:7295557"
                     /translation="MTPITLSATDLALAASLVVLDAGLSLALRLNLHRQLVLAAARMV
                     VQLIGVGYLLRFVFALNDPVATLLLVLVMSLVAAREVAARPERRFRGFVTLAISLGSV
                     LVATLATAGLALSTAIRPTPWYDPRYAVPLAGIVLGSVLNAASLTLDSLLGGVRRERS
                     AIEAQLGLGVPFRQAAAGLFRTAVRRGLLPIINQMSAAGIITLPGIMTGQILAGMDPV
                     EAVKYQILLLFLLTGASGLAALATAGLALRCLTDDRQRLRLDRLA"
     misc_feature    complement(218758..219528)
                     /locus_tag="Mnod_7995"
                     /note="ABC-type uncharacterized transport system, permease
                     component [General function prediction only]; Region:
                     COG0390"
                     /db_xref="CDD:223467"
     gene            complement(219525..220145)
                     /locus_tag="Mnod_7996"
                     /db_xref="GeneID:7295558"
     CDS             complement(219525..220145)
                     /locus_tag="Mnod_7996"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: met:M446_0073 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490160.1"
                     /db_xref="GI:220914852"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:7295558"
                     /translation="MRCDRDRGLHIEDLRSDLAGPFDLVVPKGQIVTIAGPSGSGKSL
                     FLRMIADLDVNTGRVRLDGRWRSEMPAPEWRRQVPYVAAEPGWWSDAIADHVAPEHRA
                     AAEALAARLGVGARPFAGLVANLSTGERQRLALVRALVRETPALLLDEPTGPLDPVST
                     TAVEALLRERAAAGAIILMVSHDPGQSERLSARALRMAARRLEAVP"
     misc_feature    complement(219573..220085)
                     /locus_tag="Mnod_7996"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    complement(219597..220079)
                     /locus_tag="Mnod_7996"
                     /note="cobalt transport protein ATP-binding subunit;
                     Region: cbiO; TIGR01166"
                     /db_xref="CDD:130234"
     misc_feature    complement(220017..220040)
                     /locus_tag="Mnod_7996"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(219600..219602,219696..219701,
                     219774..219776,220014..220022,220026..220031))
                     /locus_tag="Mnod_7996"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(219774..219785)
                     /locus_tag="Mnod_7996"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(219744..219773)
                     /locus_tag="Mnod_7996"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(219696..219713)
                     /locus_tag="Mnod_7996"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(219678..219689)
                     /locus_tag="Mnod_7996"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(219594..219614)
                     /locus_tag="Mnod_7996"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(220142..220588)
                     /locus_tag="Mnod_7997"
                     /pseudo
                     /db_xref="GeneID:7295554"
     gene            complement(221150..222100)
                     /locus_tag="Mnod_7998"
                     /db_xref="GeneID:7295555"
     CDS             complement(221150..222100)
                     /locus_tag="Mnod_7998"
                     /inference="protein motif:PFAM:PF07859"
                     /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
                     KEGG: acr:Acry_0942 alpha/beta hydrolase domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_002490161.1"
                     /db_xref="GI:220914853"
                     /db_xref="InterPro:IPR002168"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="GeneID:7295555"
                     /translation="MLAIHSDVLDLLRLIRESGNPPLEALPPEQSRRLYLAGRRSLQP
                     PPDQVSLVRDLHAPSQDGPVPLRLYRGMGTADDAVLPCLLYLHGGGWVVGSVESHDGV
                     CRQLANLTAGCVISVEYRLAPEHPFPAAVEDAAAALTYVVAQAESLMIDPARIAVGGD
                     SAGGNLAAVLALMGRDGVVPRTVFQALLYPAVDLTMTSDGYRRVTEGMPLTAATMRYF
                     VSHYVPHHPERLDWRASPLRTTSLAGAPPALVLTCGHDPLCEEGRLYAKRLEDEGVPV
                     TALHLSDQTHGILTMGKIIRATASTLTFMAHALCDAWTAL"
     misc_feature    complement(221192..222082)
                     /locus_tag="Mnod_7998"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    complement(221240..221854)
                     /locus_tag="Mnod_7998"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
                     pfam07859"
                     /db_xref="CDD:254474"
     gene            222889..223107
                     /locus_tag="Mnod_7999"
                     /db_xref="GeneID:7295552"
     CDS             222889..223107
                     /locus_tag="Mnod_7999"
                     /inference="similar to AA sequence:KEGG:M446_6888"
                     /note="KEGG: met:M446_6888 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490162.1"
                     /db_xref="GI:220914854"
                     /db_xref="GeneID:7295552"
                     /translation="MVQRFYFDLTDGLTTIRDNEGVEADDLADALEQAEAALEEMSAS
                     GELTDLEEGWRLVIRTGADTVLATIPIV"
     gene            complement(223464..223577)
                     /locus_tag="Mnod_8000"
                     /pseudo
                     /db_xref="GeneID:7295829"
     gene            complement(223635..223991)
                     /locus_tag="Mnod_8001"
                     /db_xref="GeneID:7295830"
     CDS             complement(223635..223991)
                     /locus_tag="Mnod_8001"
                     /inference="protein motif:PFAM:PF01381"
                     /note="PFAM: helix-turn-helix domain protein;
                     KEGG: met:M446_1273 XRE family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, XRE family"
                     /protein_id="YP_002490163.1"
                     /db_xref="GI:220914855"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:7295830"
                     /translation="MYAHHQRLDSEEVQGLRREGGRFLKDLREARGLSQRQLATLVGA
                     EYYTFISQLETGRGRIPPDRYRAWAEALGIEVRHFVQTLMRFYDPLTYEILFGAETDA
                     EHLQGDADRPQRTTGG"
     misc_feature    complement(<223707..223931)
                     /locus_tag="Mnod_8001"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(223755..223931)
                     /locus_tag="Mnod_8001"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(223827..223829,223905..223907,
                     223917..223919))
                     /locus_tag="Mnod_8001"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(223830..223832,223908..223910))
                     /locus_tag="Mnod_8001"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(223824..223829,223839..223841,
                     223848..223850,223884..223889))
                     /locus_tag="Mnod_8001"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            224358..226124
                     /locus_tag="Mnod_8002"
                     /db_xref="GeneID:7295831"
     CDS             224358..226124
                     /locus_tag="Mnod_8002"
                     /inference="protein motif:TFAM:TIGR01842"
                     /note="KEGG: met:M446_1274 type I secretion system ATPase;
                     TIGRFAM: type I secretion system ATPase;
                     PFAM: ABC transporter related;
                     SMART: AAA ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="type I secretion system ATPase"
                     /protein_id="YP_002490164.1"
                     /db_xref="GI:220914856"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010128"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:7295831"
                     /translation="MISSNASSALTNGIRSMRPMLVTAFIFSFFANILLFVSPLYMLQ
                     IYDRVLASRNEATLFGITLIAAFALAVYSILEMLRSRILVRGGMIFDQRIAGPIFDSV
                     HCSTLRKPGTGHETALRDVDTLREFLTGSGLLAFCDAPWTPIFLLACFILHPWFGWMA
                     LVGGSVILGLTLINEVATRRSLDAANQASNAAGQQARATFRNAEVLQSMGMLAALREL
                     WRSRHNEVLLLQARASDRAGIIVATTKFVRMFLQTMVLGLGAYLAIHREISAGSMIAA
                     SIIIGRALAPIELIVANWKGFTAARASYRRLADLVSLAGPEPHRMILPRPQGQVEADN
                     VSVAAPGTATPILRGVSFRLQPGSVVGVIGPSAAGKTTLARALTGVWPLLSGTVRIDG
                     SELGHWDPQALGRHVGYLPQDVELFDGTVAQNIARFAVEDEAAIIEVAQKAGCHTLIQ
                     GLPDGYNTRIGVGGHGLSGGQRQRIALARAMYGNPSLVVLDEPNASLDQAGEAALMQA
                     VSGLKCRGATVIIVTHKFSILIEADQVLVMDGGCVQAFGAAAQILSQVAGPKPAASLV
                     SATGPDGVVGRRLPDRQRASAG"
     misc_feature    224385..226049
                     /locus_tag="Mnod_8002"
                     /note="ABC-type protease/lipase transport system, ATPase
                     and permease components [General function prediction
                     only]; Region: ArpD; COG4618"
                     /db_xref="CDD:226969"
     misc_feature    225348..225986
                     /locus_tag="Mnod_8002"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    225447..225470
                     /locus_tag="Mnod_8002"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(225456..225461,225465..225473,225591..225593,
                     225828..225833,225927..225929)
                     /locus_tag="Mnod_8002"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    225582..225593
                     /locus_tag="Mnod_8002"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(225711..225722,225768..225785)
                     /locus_tag="Mnod_8002"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    225816..225833
                     /locus_tag="Mnod_8002"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    225840..225851
                     /locus_tag="Mnod_8002"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    225915..225935
                     /locus_tag="Mnod_8002"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            226128..227510
                     /locus_tag="Mnod_8003"
                     /db_xref="GeneID:7295832"
     CDS             226128..227510
                     /locus_tag="Mnod_8003"
                     /inference="protein motif:TFAM:TIGR01843"
                     /note="TIGRFAM: type I secretion membrane fusion protein,
                     HlyD family;
                     PFAM: secretion protein HlyD family protein;
                     KEGG: met:M446_1275 HlyD family type I secretion membrane
                     fusion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="HlyD family type I secretion membrane fusion
                     protein"
                     /protein_id="YP_002490165.1"
                     /db_xref="GI:220914857"
                     /db_xref="InterPro:IPR003997"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="InterPro:IPR010129"
                     /db_xref="GeneID:7295832"
                     /translation="MTIWSAETLPAARPSHSVGERPDAAGEQQSLIGLTSWRRYAIAG
                     YAVILATFGVMGSWAAVVRLDRAVISPGVIVAESSRKIVQHFEGGMILEVLVKDGQSV
                     QEGDVLLRIDPLQSRASADLFRTQLDAALILEARLRAEQNQASELELPPELIARRNEP
                     AIARMIKDQTIQLAERQRSLKSQLDLIDARVKQLKTEMVGLAVEKASVQAQVGFINQE
                     LEGLRSLREKSLIPLSRLLVMERERTRLEGVIGRSVAETAKAQNAIGEAGMQITQLKQ
                     KMQEVTTAQLLETRQKIAELREKLLVAQDVLRRHEIRASHSGVVQGLKVYTIGQVVRS
                     GEPLMEIVPTSDRLVISVQFSPNDLEAIHAGMRAEVKFPTFQTRRTPAIFGTLKTVSR
                     DRLIDDTTKQAYFSGIVEIDEHQVPNDIKHRLLAGLPAEVVVSAGERTALDYMVAPLF
                     DAMGHAFHER"
     misc_feature    226239..227507
                     /locus_tag="Mnod_8003"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     misc_feature    226392..226511
                     /locus_tag="Mnod_8003"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    227058..227339
                     /locus_tag="Mnod_8003"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            227606..232369
                     /locus_tag="Mnod_8004"
                     /db_xref="GeneID:7295833"
     CDS             227606..232369
                     /locus_tag="Mnod_8004"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_1276 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490166.1"
                     /db_xref="GI:220914858"
                     /db_xref="GeneID:7295833"
                     /translation="MGAVISFFRPAPTTQGDWSQQELAEFYRVEAALIRAGMRITSEQ
                     GLSDEAEPWFVFCRPDGDAIMHFARIDGSYVVASEALDHPMRGADFRALLNQIAAQYP
                     ALLPIPQAAAGTKLVVHPAALLAAIVAAAALTLSHEDAFASELQDIESSGSVPSAPMA
                     ASGPSDQVVPVVDPLPSKSRSSGEAHDQGDHRRQIEAIVFSAMMFAAKAVADDGFEMR
                     SDPELLLTEQTSNTTDQLAQCDVSLPSIPAAGGRHAEELTIQRASALAPDIEGQRRKD
                     AAPLGAEQIGAIHQSRPDVGLDGSEPLKLVTAVKLAILEPEGHGYLRSVEAGNPRTTA
                     GLSSTDRHPKDGSSAADGGVEAKQAGGSTVSTADSGSQNHHQGATQDGSSAADGGVEA
                     KQASASTVSTADSGSQSHYQGATQTALQGTSDPNASLISAPRSDRGLSSSVQPGAATL
                     PPASTLTAGVQDNQPSLVAKTKAPPATSGGVSPEVKAADVSHPQADATKAVISPTTPG
                     GVSPEVTAADVSHPQADITRSNADHSGAAAATLGHPAASSQPSDATGSSSPVQPSGVP
                     LPPASTLIAGVQDNQPSLVAKTKAPPATSGGVGPEVKAADVSHPQADAAKAVTSPATP
                     GGVSSEVTAADVSHPQADAAKAVTSPATPGGVSSEITAADVSHPQADAAKAVTSPATP
                     GGVSSEVTAATASHPQADAAKAVTSPATPGGVSSEVTAATASHPQVDAAKAVTSPATP
                     GGVSSEITAADVSHPQVDGTKAVTSPATPKADAPPATPGGVSSEITAADVSHPQADIT
                     RSNADHSGAAAATLGHPAASSQPSDATGSSSPVQPSGVPLPPASTLIAGVQDNQPSLV
                     AKTKAPPATSGGVGPEVKAADVSHPQADAAKAVTSPATPGGVSSEITAADVSHPQADA
                     AKAVTSPATPGGVSSEVTAADVSHPQADAAKAVTSPATPGGVSSEITAATASHPQADA
                     AKAVTSPATPGGVSSEVTAATASHPQVDAAKAVTSPATPGGVSSEITAADVSHPQVDA
                     AKAVTSPATPGGVSSEITAADVSHPQADAAKAVTSPATPGGVSSEVTAADVSHPQADA
                     AKAVTSPATPGGVSSEVTAATASHPQADAAKAVTSPATPGGVSSEVTAATASHPQADA
                     AKAVTSPATPGGVSSEVTAATASHPQADAAKAVTSPATPGGVSSEVTAATASHPQVDA
                     AKAVTSPATPGGVSSEITAADVSHPQVDAAKAVTSPATPGGVSSEITAADVSHPQVDG
                     TKAVTSPATPKADAPPATPGGVSSEITAADVSHPQVDGTKAVTSPATPKADAPPATPG
                     GVSSEITAADVSHPQADAAKAVTSPATPGGVSSEVTAATASHPQADAAKAVTSPATPG
                     GVSSEVTAATASHPQVDAAKAVTSPATPGGVSSEITAADVSHPQVDGTKAVTSPATPK
                     ADAPPATPGGVSSEITAADVSHPQADITRSNADHSGAAAATLGHPAASSQPSDATGSS
                     SPVQPSGVTLPPASTLIAGVQDNQPSLVAKTKAQTDLVNAEVDGDGNLVFAPGNVHQS
                     HPAPSHAPPESVMHTDVGLVGLVHHHTLFHNPDFH"
     misc_feature    <228899..230326
                     /locus_tag="Mnod_8004"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07764"
                     /db_xref="CDD:236090"
     misc_feature    <230003..231370
                     /locus_tag="Mnod_8004"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK07764"
                     /db_xref="CDD:236090"
     gene            232404..232541
                     /locus_tag="Mnod_8005"
                     /db_xref="GeneID:7295834"
     CDS             232404..232541
                     /locus_tag="Mnod_8005"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490167.1"
                     /db_xref="GI:220914859"
                     /db_xref="GeneID:7295834"
                     /translation="MLTYRAIDLRQNVDIEPEAWQKFENRTNRHYLAAASYEDDLAVA
                     T"
     gene            complement(233386..234546)
                     /locus_tag="Mnod_8006"
                     /db_xref="GeneID:7295835"
     CDS             complement(233386..234546)
                     /locus_tag="Mnod_8006"
                     /inference="protein motif:PFAM:PF02746"
                     /note="PFAM: Mandelate racemase/muconate lactonizing
                     protein;
                     KEGG: pol:Bpro_4358 mandelate racemase/muconate
                     lactonizing enzyme"
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase/muconate lactonizing protein"
                     /protein_id="YP_002490168.1"
                     /db_xref="GI:220914860"
                     /db_xref="InterPro:IPR013341"
                     /db_xref="InterPro:IPR013342"
                     /db_xref="GeneID:7295835"
                     /translation="MRVKQVRIYVVESGGIRPVILEMTTDDGTVGLGEAAVAYGLGGT
                     AAAAMIRELCERCVIGRDPFRVEAIWTEMYDCSFWAKGGGPIVFGAMSAIEQALVDIK
                     ARALRVPAYELLGGRVHDALRTYANGWYFGCADLADLPRFAEATVADGYDALKLYPFA
                     TILETGRLRHPSRRGTSDGDVRRRAVAAVASVRAALGPGPKIMLDLSGGLTPDETIRF
                     CREVEEFDITYVEEPADPFDPHALSKIASGISQPIAVGERIYTRYGFRDLLAGRAVDI
                     LQPDLGNTGGILEGRKIAAMAEAYGVKVQPHVCASALSTVIAMHFSAATPNFYMQEHF
                     PYWDRIPGYTQVLEDPIEPQVKAGTIPVLDAIGYGVTLRNRSLLDCLWTECR"
     misc_feature    complement(233416..234546)
                     /locus_tag="Mnod_8006"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    complement(233434..234498)
                     /locus_tag="Mnod_8006"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily. Enzymes of this subgroup share three
                     conserved carboxylate ligands for the essential divalent
                     metal ion (usually Mg2+), two aspartates and a glutamate,
                     and conserved catalytic residues; Region: MR_like;
                     cd03316"
                     /db_xref="CDD:239432"
     misc_feature    complement(order(233551..233553,233626..233628,
                     233707..233709,233776..233778,233854..233856,
                     233932..233934,234076..234078,234082..234084))
                     /locus_tag="Mnod_8006"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239432"
     gene            complement(234551..236611)
                     /locus_tag="Mnod_8007"
                     /db_xref="GeneID:7295836"
     CDS             complement(234551..236611)
                     /locus_tag="Mnod_8007"
                     /inference="protein motif:PFAM:PF00724"
                     /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
                     FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     KEGG: met:M446_5525 NADH:flavin oxidoreductase/NADH
                     oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH:flavin oxidoreductase"
                     /protein_id="YP_002490169.1"
                     /db_xref="GI:220914861"
                     /db_xref="InterPro:IPR000759"
                     /db_xref="InterPro:IPR001155"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:7295836"
                     /translation="MPLVEAITGPAAIARDPLLQPLRIKNLVLRNRVMSTSHASGLEE
                     GGMPKERYQLYHLEKAKGGIGLSMFGGSSNVAPDSPNIFRQLNVGTDEIIPWLQQFSA
                     RMHAEGAALMVQITHLGRRGEPYADKWLPTIGPSAMRETLHRSFPKEMDEHDIRRVVK
                     AYAAAVRRCREGGLDGVETLAGGHLIGQFLSPSTNRRTDRYGGSLENRCRFGLMVFEE
                     IRKEVGDDYIVGMRYVIEEGETGLTMGDAIKVAHIFERTGMLDFFNAIVGRMDTERAL
                     AVDNMPGMASPIAPWLRQVGAFKREVGLPVFHAARISDIATARHAIREGLLDMVAMTR
                     AHIADPHIVRKIEAGQEDRIRPCVGATHCQSPYRPHCIHNPSTGRESQLPHEIARSER
                     AGRKVVVVGGGPAGLEAARVSALRGHEVVLFEAAAKLGGQLLLSQRASWRRDVIGIVD
                     WRVEEIRRLGVRVELNRYAEVDDVLAENPDAVVVATGGVPDIDWIAGAEHCDSVWDVI
                     GGTTPLAAEVIVYDGTGRHPGPQAAELAAQDGRKVQFVSIDAQIAQELTYAERIIWKK
                     RIYELGVPMTFDHEIVKVERRGNRIVATFRNLASEQLTERMADQILVEHGTRPADDLY
                     QALRPHSANDGVTDIDALLAGEAQPLTWRPELRMELHRVGDAVASRNVHAAVLDALRL
                     CKDL"
     misc_feature    complement(234554..236560)
                     /locus_tag="Mnod_8007"
                     /note="mycofactocin system FadH/OYE family oxidoreductase
                     2; Region: mycofact_OYE_2; TIGR03997"
                     /db_xref="CDD:234436"
     misc_feature    complement(235532..236560)
                     /locus_tag="Mnod_8007"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 3. Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_3_FMN; cd04734"
                     /db_xref="CDD:240085"
     misc_feature    complement(order(235610..235615,235916..235918,
                     236060..236062,236270..236272,236399..236401,
                     236495..236497,236501..236503))
                     /locus_tag="Mnod_8007"
                     /note="putative active site [active]"
                     /db_xref="CDD:240085"
     misc_feature    complement(order(235610..235615,235916..235918,
                     236270..236272,236399..236401,236495..236497,
                     236501..236503))
                     /locus_tag="Mnod_8007"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240085"
     misc_feature    complement(236060..236062)
                     /locus_tag="Mnod_8007"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240085"
     misc_feature    complement(236060..236062)
                     /locus_tag="Mnod_8007"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240085"
     gene            complement(236602..237513)
                     /locus_tag="Mnod_8008"
                     /db_xref="GeneID:7295837"
     CDS             complement(236602..237513)
                     /locus_tag="Mnod_8008"
                     /inference="protein motif:PFAM:PF03807"
                     /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
                     KEGG: met:M446_5524 NADP oxidoreductase coenzyme
                     F420-dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420-dependent NADP oxidoreductase"
                     /protein_id="YP_002490170.1"
                     /db_xref="GI:220914862"
                     /db_xref="InterPro:IPR004455"
                     /db_xref="GeneID:7295837"
                     /translation="MKPSARPLDPAPTVGLIGLGRIGMVLLAALRRFAPETRVIAAGR
                     DPARVAAATAAWPGVEVMDSERLAVHANVVVPCLPPEAYRDGVSAVAPHMRADAVLMS
                     VTNAVPLPDLGCRCARPIVKVILSPAHAAGRGVCLVTPSPGAGPEQVERICALLQRFC
                     RPVLADPADGRIASNLAGSAPAILAAFCSAFLEANAARARAFGPTELRAMMTESVAAL
                     AAILDEGLSFEDVVARTATPGGTTEAAIAALNAEAPALCGRLVDATFQREAQLLAIPP
                     RTRDRPHAGSACKADPSDIPSGELPCR"
     misc_feature    complement(236674..237477)
                     /locus_tag="Mnod_8008"
                     /note="pyrroline-5-carboxylate reductase; Reviewed;
                     Region: PRK06928"
                     /db_xref="CDD:235888"
     misc_feature    complement(237199..237477)
                     /locus_tag="Mnod_8008"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; cl19126"
                     /db_xref="CDD:267479"
     misc_feature    complement(<236785..237000)
                     /locus_tag="Mnod_8008"
                     /note="Pyrroline-5-carboxylate reductase dimerization;
                     Region: P5CR_dimer; pfam14748"
                     /db_xref="CDD:258885"
     gene            complement(237804..238586)
                     /locus_tag="Mnod_8009"
                     /db_xref="GeneID:7295838"
     CDS             complement(237804..238586)
                     /locus_tag="Mnod_8009"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: met:M446_5523 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490171.1"
                     /db_xref="GI:220914863"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:7295838"
                     /translation="MSLADRSAAEESQTCLGHRAIVSLRNVHKSYGAFEVLKGISLDV
                     RKGEVVCIIGPSGSGKSTLIRCINGLSAIQSGSITVDGQEVNDPKLDKLALRKKVGIV
                     FQQYNLFPHKTALENVMMAPLKVLREPRAQVEERARALIAKVRLTGKENAYPGQLSGG
                     QQQRVAIARSLAMRPDVMLFDEVTAALDPETVKEVLVTIKELAAEGMTCILVTHEMGF
                     AREVANHVYFTDGGIIVEHGKPDQLFKNAKDPRTRQFLSQVL"
     misc_feature    complement(237807..238529)
                     /locus_tag="Mnod_8009"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(237885..238523)
                     /locus_tag="Mnod_8009"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(238404..238427)
                     /locus_tag="Mnod_8009"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(237945..237947,238041..238046,
                     238275..238277,238401..238409,238413..238418))
                     /locus_tag="Mnod_8009"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(238275..238286)
                     /locus_tag="Mnod_8009"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(238089..238118)
                     /locus_tag="Mnod_8009"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(238041..238058)
                     /locus_tag="Mnod_8009"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(238023..238034)
                     /locus_tag="Mnod_8009"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(237939..237959)
                     /locus_tag="Mnod_8009"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(238573..239409)
                     /locus_tag="Mnod_8010"
                     /db_xref="GeneID:7295839"
     CDS             complement(238573..239409)
                     /locus_tag="Mnod_8010"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: met:M446_5522 polar amino acid ABC transporter,
                     inner membrane subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_002490172.1"
                     /db_xref="GI:220914864"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:7295839"
                     /translation="MRQPAFQLNMARLREGQFLRGLRAGHVILLLLALGVSLAFAVSR
                     SFVLGSGPTALTTLLEWSPFILQGFALNLAMSFLAMAMATILGTGLGLLQISTISAVR
                     LPARFVTHLLRNSPWLVILFLVTYFMPVEIRLPHGLRVPVPDWSKATLAFALPVMGNI
                     SEILRGAVRSIPSGQWESAEGLAFTRAQTLRYIILPQCVRRCIPPWMNWYAMLTLSTP
                     MASIFSVHEAVANAQAGMEAAGSRPELLLPFYLFLLCLFFLYIYPIALWTRRLERRYV
                     VG"
     sig_peptide     complement(239284..239409)
                     /locus_tag="Mnod_8010"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.698) with cleavage site probability 0.550 at
                     residue 42"
     misc_feature    complement(<238786..239205)
                     /locus_tag="Mnod_8010"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(238786..238788,238795..238800,
                     238840..238842,238891..238893,238900..238905,
                     238915..238917,238921..238926,238933..238935,
                     238939..238941,238945..238950,239035..239037,
                     239041..239046,239053..239082,239086..239097,
                     239125..239127,239140..239145,239152..239157))
                     /locus_tag="Mnod_8010"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(239035..239079)
                     /locus_tag="Mnod_8010"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(238819..238821,238831..238836,
                     238852..238890))
                     /locus_tag="Mnod_8010"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(239406..240152)
                     /locus_tag="Mnod_8011"
                     /db_xref="GeneID:7295840"
     CDS             complement(239406..240152)
                     /locus_tag="Mnod_8011"
                     /inference="protein motif:TFAM:TIGR01726"
                     /note="TIGRFAM: polar amino acid ABC transporter, inner
                     membrane subunit;
                     PFAM: binding-protein-dependent transport systems inner
                     membrane component;
                     KEGG: met:M446_5521 polar amino acid ABC transporter,
                     inner membrane subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="polar amino acid ABC transporter inner membrane
                     subunit"
                     /protein_id="YP_002490173.1"
                     /db_xref="GI:220914865"
                     /db_xref="InterPro:IPR000515"
                     /db_xref="InterPro:IPR010065"
                     /db_xref="GeneID:7295840"
                     /translation="MLEIIGPFFRGMYERTGMNFNIFYDPYEYGRFVSGASTTLQLIF
                     WSLSLSLVIGVLGAWAQGAKSPALRVGVGAYIQAFRNTPPMIQLLFFYFGLGAFTPAI
                     DMGGYSQPVVSSFAWAVISLGIFGGAFNVEIFRAGIEAVPDSTLEAAESLCFSRLQTY
                     LYITLPLAFRISLPALTNNLVSLAKTTSLAYIITVPEMTYVLNQVWSDNLNVPEMMLV
                     LFGFYIVVVTLLAAGLHAIERKLVLPGYGQ"
     misc_feature    complement(239430..240101)
                     /locus_tag="Mnod_8011"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(239463..240038)
                     /locus_tag="Mnod_8011"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(239469..239474,239481..239486,
                     239490..239495,239502..239507,239535..239540,
                     239577..239582,239589..239600,239619..239621,
                     239628..239633,239673..239675,239724..239726,
                     239733..239738,239748..239750,239754..239759,
                     239766..239768,239772..239774,239778..239783,
                     239877..239879,239883..239888,239895..239924,
                     239928..239939,239967..239969,239982..239987,
                     239994..239999))
                     /locus_tag="Mnod_8011"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(239583..239600,239877..239921))
                     /locus_tag="Mnod_8011"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(239505..239507,239535..239537,
                     239544..239546,239580..239582,239796..239798,
                     239877..239879))
                     /locus_tag="Mnod_8011"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(239652..239654,239664..239669,
                     239685..239723))
                     /locus_tag="Mnod_8011"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(240197..241042)
                     /locus_tag="Mnod_8012"
                     /db_xref="GeneID:7295841"
     CDS             complement(240197..241042)
                     /locus_tag="Mnod_8012"
                     /inference="protein motif:PFAM:PF00497"
                     /note="PFAM: extracellular solute-binding protein family
                     3;
                     KEGG: met:M446_5520 extracellular solute-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 3 extracellular solute-binding protein"
                     /protein_id="YP_002490174.1"
                     /db_xref="GI:220914866"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:7295841"
                     /translation="MMKGKLMKMAAVAAAVLGVALGAAPVRAADGRLKDILDRGVVRV
                     GVQGAFKPWAFPAPDGTLQGIELDLAKSVADTLGVKLEPVIITSANRIQFLQQGKIDL
                     IIGGMYDATDRRKVVGIIEPAYWSSGPTLLAKKGAIKDWKDIANKPVCGKQGNYYNKQ
                     VQTELHANLIAFAGNTEGKEGLRAGKCIAWLYDDVSIMADLALPEWEGYEMPVPVLYN
                     NPWAAAVPLDELNRGWGAFMAGMAYRWQAEGKLIELGKKWGVNTSDWFVQQQQKLHWD
                     TSYLK"
     sig_peptide     complement(240956..241042)
                     /locus_tag="Mnod_8012"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 29"
     misc_feature    complement(240266..240919)
                     /locus_tag="Mnod_8012"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(240266..240919)
                     /locus_tag="Mnod_8012"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(240464..240466,240575..240577,
                     240701..240703,240779..240781,240893..240895))
                     /locus_tag="Mnod_8012"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(240485..240487,240503..240505,
                     240515..240517))
                     /locus_tag="Mnod_8012"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(240371..240388)
                     /locus_tag="Mnod_8012"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(241084..242604)
                     /locus_tag="Mnod_8013"
                     /db_xref="GeneID:7295842"
     CDS             complement(241084..242604)
                     /locus_tag="Mnod_8013"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: FAD dependent oxidoreductase;
                     KEGG: met:M446_5519 FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_002490175.1"
                     /db_xref="GI:220914867"
                     /db_xref="InterPro:IPR000447"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:7295842"
                     /translation="MDTHSRRDAKGDSRYDVVIIGGGINGTSAARELAAGGYKVLLTE
                     MSDLANGASSRSSRILHCGLRYFETAHPVRTFLSSPRRLAGAMTMARAAMQARAELSD
                     LKPDNCKPFTMCFPLYSDGDVKGWHLDLGFGLLKRLGPARPPLDYRRITRDFDQLVPF
                     AGDLRDRESLRSIATYREYIIDSPDRLCVEAALEAERNGAELRLFTKAGFAGRSADGH
                     WLLQLSSDGGTDLVEAPVVLNLAGTWSDGVIAGIVDEPRSPLVTGTKGSHIVVRLPQR
                     YAGHGIACLHRGGMPFYCLPLDGDLFYFGPTETKYDGDAGDAVATDDDISFLLEEANF
                     LLPGLGLRKSHVEFTWAGVRPLGFDARQPMGRRIREIHDLADRGMPGVFAMTAGPVMS
                     HLSAGRELRDVVARALKPSGQPRARRPGTPSSRPRPDPAQGSAALLRHAVIAEHARDL
                     KGILYTRTGMGWGRHLDRDTVQSAAEAVSDLLGWSQSDVSAQVESFLRYQNSRFAR"
     misc_feature    complement(241096..242562)
                     /locus_tag="Mnod_8013"
                     /note="Glycerol-3-phosphate dehydrogenase [Energy
                     production and conversion]; Region: GlpA; COG0578"
                     /db_xref="CDD:223651"
     misc_feature    complement(<241537..242562)
                     /locus_tag="Mnod_8013"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(242707..243609)
                     /locus_tag="Mnod_8014"
                     /db_xref="GeneID:7295843"
     CDS             complement(242707..243609)
                     /locus_tag="Mnod_8014"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: regulatory protein LysR; LysR
                     substrate-binding;
                     KEGG: met:M446_5518 LysR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="YP_002490176.1"
                     /db_xref="GI:220914868"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:7295843"
                     /translation="MKLLYLAAFRAVMLTGTVSAAAEVLGRSQPAVSRLLDKLEAELG
                     AKLFERRRGLVVPTRTAQLLLDEVERAYVSLESLKTFASRVAEGESSRISAAVLPALG
                     LNFIPATLAAFAREWPKTRVLLNVQMSVQVEEWAAAQQVDFGLAEMPFKRSGFRTEIF
                     SDQPYLLAVPRDHPLAQRSQVGPSDVRGVPFIVGSSFTAMGQLLAQAFRTCGVPLEAQ
                     YEAPLSMTVYELVKQGVGIGLVDPYTALKQLDSRVQLVRFVPTIPFNVALLRPESRPA
                     NPAADALLDFLASERDRLMSGFPG"
     sig_peptide     complement(243547..243609)
                     /locus_tag="Mnod_8014"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.390 at
                     residue 21"
     misc_feature    complement(243424..243594)
                     /locus_tag="Mnod_8014"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(242740..243585)
                     /locus_tag="Mnod_8014"
                     /note="DNA-binding transcriptional regulator LysR;
                     Provisional; Region: PRK11013"
                     /db_xref="CDD:236819"
     misc_feature    complement(242749..243324)
                     /locus_tag="Mnod_8014"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(242911..242916,242920..242925,
                     242941..242958,243232..243252,243256..243258,
                     243268..243270,243277..243282,243286..243291))
                     /locus_tag="Mnod_8014"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(244012..244332)
                     /locus_tag="Mnod_8015"
                     /db_xref="GeneID:7295844"
     CDS             complement(244012..244332)
                     /locus_tag="Mnod_8015"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490177.1"
                     /db_xref="GI:220914869"
                     /db_xref="GeneID:7295844"
                     /translation="MLAHGRRHPTRFPRQDRWGERQEPAPLIEVLRPVGEVDGIGVFL
                     ARHPNRKDDLFEVVIGPASCSECEVVATLPTTRAGKTEAIRISMAILRTLDLISSIND
                     RPPV"
     gene            complement(244393..245070)
                     /locus_tag="Mnod_8016"
                     /db_xref="GeneID:7295845"
     CDS             complement(244393..245070)
                     /locus_tag="Mnod_8016"
                     /inference="protein motif:PFAM:PF02308"
                     /note="PFAM: MgtC/SapB transporter;
                     KEGG: mex:Mext_2886 MgtC/SapB transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="MgtC/SapB transporter"
                     /protein_id="YP_002490178.1"
                     /db_xref="GI:220914870"
                     /db_xref="InterPro:IPR003416"
                     /db_xref="GeneID:7295845"
                     /translation="MLSNIEIIARLALSALLGSLVGLERERLLWAAGLRTHMLVAVGA
                     CLIMIVSAFGFSDVLSENHVVLDPSRVAAQVVSGIGFLGAGTILLRGEVVRGLTTAAS
                     LWAVAAVGLAVGGGLYVAAVATTLIVLIILAGVKPIEEHYQARMQTRPLRLVARTGEM
                     SIDVLQEVTGERSSRIKQFVVRQSGSEGLDEVTVTFVRLSQRSIEAIAERLRQHPGVI
                     SVETDVS"
     misc_feature    complement(244402..245070)
                     /locus_tag="Mnod_8016"
                     /note="Uncharacterized membrane protein [Function
                     unknown]; Region: SapB; COG1285"
                     /db_xref="CDD:224204"
     misc_feature    complement(244654..245010)
                     /locus_tag="Mnod_8016"
                     /note="MgtC family; Region: MgtC; pfam02308"
                     /db_xref="CDD:111223"
     gene            245228..245872
                     /locus_tag="Mnod_8017"
                     /db_xref="GeneID:7295846"
     CDS             245228..245872
                     /locus_tag="Mnod_8017"
                     /inference="protein motif:PFAM:PF01865"
                     /note="PFAM: protein of unknown function DUF47;
                     KEGG: met:M446_5971 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490179.1"
                     /db_xref="GI:220914871"
                     /db_xref="InterPro:IPR002727"
                     /db_xref="GeneID:7295846"
                     /translation="MLGWFRALMPKEDRFFDLFERHARTLVAGAEALQELLKGGEAVP
                     RYCQIIAEREHEADDISREVLLAVRRSFITPFDRGDIKDLIQSMDDAIDQMHRTAKAI
                     ALFELREFDPVMREMGGTILEAAKLTAEAVPLLHKVGTHAARLAALTEQVVRVEGRSD
                     ALHEQGLKSLYLTHGRTDPMAYIVGSEILGHLEDAVDRFEDVANEISGIVIENV"
     misc_feature    245228..245866
                     /locus_tag="Mnod_8017"
                     /note="Phosphate transport regulator (distant homolog of
                     PhoU) [Inorganic ion transport and metabolism]; Region:
                     COG1392"
                     /db_xref="CDD:224310"
     misc_feature    <245237..245386
                     /locus_tag="Mnod_8017"
                     /note="Protein of unknown function, DUF488; Region:
                     DUF488; cl01246"
                     /db_xref="CDD:260852"
     misc_feature    <245375..245845
                     /locus_tag="Mnod_8017"
                     /note="TIGR00153 family protein; Region: TIGR00153"
                     /db_xref="CDD:232846"
     gene            245881..246888
                     /locus_tag="Mnod_8018"
                     /db_xref="GeneID:7295847"
     CDS             245881..246888
                     /locus_tag="Mnod_8018"
                     /inference="protein motif:PFAM:PF01384"
                     /note="PFAM: phosphate transporter;
                     KEGG: met:M446_5972 phosphate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate transporter"
                     /protein_id="YP_002490180.1"
                     /db_xref="GI:220914872"
                     /db_xref="InterPro:IPR001204"
                     /db_xref="GeneID:7295847"
                     /translation="MSDAALAFPILAGLIAVALLFDFLNGLHDAANSIATIVSTRVLR
                     PHYAVFWAAFFNFIAFLFFGLHVAQTLGTGIIDASLVDARVIFGALSGAIVWNVLTWI
                     LGIPSSSSHALIGGLVGAGVAKAGWQAVVWGGLGKTAAAIVLSPLLGFLLALLLVLIV
                     SWLFVRSTPFAVDRAFRLLQFVSASLYSLGHGGNDAQKTMGIIAVLLYSQGHLGREFH
                     VPLWVVLSCQAAMAAGTLFGGWRIVHTMGSRITRLTPMQGFCAETGGALTLFAATWLG
                     VPVSTTHTITGAIIGVGAARRTSAVRWGVASNIVVAWVLTLPAAAAIGAGAYVLTALL
                     P"
     misc_feature    245953..246834
                     /locus_tag="Mnod_8018"
                     /note="Phosphate transporter family; Region: PHO4;
                     pfam01384"
                     /db_xref="CDD:250576"
     gene            246908..247648
                     /locus_tag="Mnod_8019"
                     /db_xref="GeneID:7295848"
     CDS             246908..247648
                     /locus_tag="Mnod_8019"
                     /inference="protein motif:PFAM:PF00293"
                     /note="PFAM: NUDIX hydrolase;
                     KEGG: mrd:Mrad2831_4258 NUDIX hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="NUDIX hydrolase"
                     /protein_id="YP_002490181.1"
                     /db_xref="GI:220914873"
                     /db_xref="InterPro:IPR000086"
                     /db_xref="GeneID:7295848"
                     /translation="MPKSKKPQVKLKKKPQAKAAVKKALFPKLLKQVAALPIRLTQDI
                     GLEVLLVTSRETKRWVVPKGWPMKGMKGHEAAAIEAREEAGVIGRISKKPAGYYTYDK
                     RQPDGRTDPCRVAVYVLTVTEQLETWREKGQREMQWVGSEAATVLLQEPELASLIRDL
                     ARPATWPGTAPSLARKARAGPVVENKIVDARVEISVVKSGKTLSSEVVISPSKTDMAT
                     AVARLCLKVQETQSGPLWPFQVVVREAD"
     misc_feature    246998..247369
                     /locus_tag="Mnod_8019"
                     /note="Members of the Nudix hydrolase superfamily catalyze
                     the hydrolysis of NUcleoside DIphosphates linked to other
                     moieties, X. Enzymes belonging to this superfamily require
                     a divalent cation, such as Mg2+ or Mn2+, for their
                     activity and contain a highly...; Region:
                     Nudix_Hydrolase_9; cd04666"
                     /db_xref="CDD:240024"
     misc_feature    247097..247165
                     /locus_tag="Mnod_8019"
                     /note="nudix motif; other site"
                     /db_xref="CDD:240024"
     gene            247792..247947
                     /locus_tag="Mnod_8020"
                     /db_xref="GeneID:7295849"
     CDS             247792..247947
                     /locus_tag="Mnod_8020"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: rru:Rru_A2891 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490182.1"
                     /db_xref="GI:220914874"
                     /db_xref="GeneID:7295849"
                     /translation="MILNALALKLKRQARGTCIVAFHPNAVQDVSPRAKWKITWAESP
                     IWTATPV"
     gene            248055..248639
                     /locus_tag="Mnod_8021"
                     /db_xref="GeneID:7295850"
     CDS             248055..248639
                     /locus_tag="Mnod_8021"
                     /inference="similar to AA sequence:KEGG:GbCGDNIH1_1141"
                     /note="KEGG: gbe:GbCGDNIH1_1141 glycosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase"
                     /protein_id="YP_002490183.1"
                     /db_xref="GI:220914875"
                     /db_xref="GeneID:7295850"
                     /translation="MQQASRAFAPGDAERGLEGEPRHGRLDSGRGDRRARLFKPEALR
                     KAGFGPGRHAAEPQGDLLLPARDAVVLWHYKHLGFERNATREAAQAARLGRADVAQGL
                     GQHYLWGRERLCAFWDEMERESVDLGRVVPDTACIWPLWREERGLPRVDPAPLPPLAA
                     ALPAVAPAVSVLVKACNHAPYVRQIHAGPESLGG"
     misc_feature    <248271..248495
                     /locus_tag="Mnod_8021"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_5; cl17496"
                     /db_xref="CDD:266729"
     gene            248913..251390
                     /locus_tag="Mnod_8022"
                     /db_xref="GeneID:7295851"
     CDS             248913..251390
                     /locus_tag="Mnod_8022"
                     /inference="protein motif:PFAM:PF00593"
                     /note="PFAM: TonB-dependent receptor; TonB-dependent
                     receptor plug;
                     KEGG: met:M446_0654 TonB-dependent receptor"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="YP_002490184.1"
                     /db_xref="GI:220914876"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:7295851"
                     /translation="MVALRRGLLVTTILVPCGAVGLAGRAAAQGDTIALEQIDVVPVT
                     PVGGAGGAARAETGAAGGALPLSKVPFTAETVTARQFEQDRATLDPTFTLARTTPGVS
                     LSDGQGNSFRQTLTYRGFDASPLQGAPQGLAVYQNGTRINEAFGDVVNWDLIPQVAIN
                     RIDLVTGNPIFGLNALGGAVNIAMKNGFTWQGQEVSVMGGSDGRILGTLQYGEVVGPW
                     SFYFAGEGLKDDGWRFRSPSEIGRVYADIGHRTPDSEFHLIASGAKTFFGATSAAPVD
                     LQRLTERAIFTNPQTIDTEAGQIQVTGKVNLSPTWDLAGNAYVRRFSQFVVDGNDGNF
                     ENCSTRSSFRGFLCFEDDGFSPAPGQTQAQFRNQFLILGPNGQPIPFRAGIPYGTHDT
                     VRTEATGYGGTLQATNRDRVFDHANTFILGGSIDAASYTFKSASTLGVINPDLSVTTD
                     PNNPTYGLIPGLGTGPIRTAAALGVAPSQVIGSNLYMGLYALDTFDVTDQLSLTAGAR
                     LNFARISTQDLTGFSPDVTGTHFFTRLNPVAGLTYRFFPWLTLYGGYSESNRAPTPLE
                     LACANPNRPCLLPNSLVADPPLQQVEAHTYEAGIRGTVPDVAEGGLLTYKLGFFRTDL
                     TNDILQIAVPGNAARGYFVNVPATQRQGIEVAAEYVGERLRLYANYALIDATFQFRGD
                     LSSPNNPLADDGLITVRPGNKLPLVPEHQIKAGFEYAITPQWKFGLNVAAFSSSYFRG
                     DESNLNRKLPAYAIANLNTSVQLTRNMEVFALVTNLFNTRVPNFGTFLERTEPGELFA
                     NRYALNDPRTTALIQPLSVYGGMRVTW"
     misc_feature    248913..251345
                     /locus_tag="Mnod_8022"
                     /note="Outer membrane receptor proteins, mostly Fe
                     transport [Inorganic ion transport and metabolism];
                     Region: CirA; COG1629"
                     /db_xref="CDD:224544"
     sig_peptide     248913..248999
                     /locus_tag="Mnod_8022"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.995) with cleavage site probability 0.919 at
                     residue 29"
     misc_feature    249192..251252
                     /locus_tag="Mnod_8022"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     gene            251419..252072
                     /locus_tag="Mnod_8023"
                     /db_xref="GeneID:7295852"
     CDS             251419..252072
                     /locus_tag="Mnod_8023"
                     /inference="protein motif:PFAM:PF00072"
                     /note="PFAM: regulatory protein LuxR; response regulator
                     receiver;
                     KEGG: met:M446_0653 two component LuxR family
                     transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, LuxR
                     family"
                     /protein_id="YP_002490185.1"
                     /db_xref="GI:220914877"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:7295852"
                     /translation="MTGVLIIDDRPIVLDTLRRLLAPTGITVHTTTSPAEGERLAREF
                     ALTLVVTDLAFPGTPLGGLALIRRLRSRPPAPRVLVFSMYDEAPVARQALQAGALGYV
                     CKTAGLEEFAQAYRYVLSGKGYLNPDLAFALAVPPPPPADPLDRLTGRQLRILQLLAG
                     GQTYRRIADLLLLSVKTIANEVATIGRQVQVPDKAGMVRFAIRYRDAIVARQAADLP"
     misc_feature    251428..252033
                     /locus_tag="Mnod_8023"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    251431..251775
                     /locus_tag="Mnod_8023"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(251440..251445,251572..251574,251602..251604,
                     251662..251664,251719..251721,251728..251733)
                     /locus_tag="Mnod_8023"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    251572..251574
                     /locus_tag="Mnod_8023"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(251581..251586,251596..251604)
                     /locus_tag="Mnod_8023"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    251728..251736
                     /locus_tag="Mnod_8023"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    251854..252021
                     /locus_tag="Mnod_8023"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cl17315"
                     /db_xref="CDD:266624"
     misc_feature    order(251860..251868,251905..251913,251935..251940,
                     251944..251949,251953..251967,251998..252000)
                     /locus_tag="Mnod_8023"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(251893..251895,251899..251901,251905..251907,
                     251998..252006,252013..252015,252022..252027)
                     /locus_tag="Mnod_8023"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            252268..252672
                     /locus_tag="Mnod_8024"
                     /db_xref="GeneID:7295853"
     CDS             252268..252672
                     /locus_tag="Mnod_8024"
                     /inference="protein motif:SMART:SM00054"
                     /note="SMART: Calcium-binding EF-hand-containing protein;
                     KEGG: rpe:RPE_4188 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-binding domain-containing protein"
                     /protein_id="YP_002490186.1"
                     /db_xref="GI:220914878"
                     /db_xref="InterPro:IPR002048"
                     /db_xref="GeneID:7295853"
                     /translation="MTSALRTAAVLTAMLGLMPAAPVLAASPAAAIKAMDPDNDGTLD
                     LAEVKAAATALFAALDPDKDGTLDAKELKGRVSAKQLKALDPDKDGTLDQAEYLALVE
                     AAFQAANPDGDGTVDAKELSTSKGKALLKLIQ"
     sig_peptide     252268..252345
                     /locus_tag="Mnod_8024"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.995 at
                     residue 26"
     misc_feature    252445..252630
                     /locus_tag="Mnod_8024"
                     /note="EF-hand, calcium binding motif; A diverse
                     superfamily of calcium sensors and calcium signal
                     modulators; most examples in this alignment model have 2
                     active canonical EF hands. Ca2+ binding induces a
                     conformational change in the EF-hand motif, leading to...;
                     Region: EFh; cd00051"
                     /db_xref="CDD:238008"
     misc_feature    order(252445..252447,252451..252453,252457..252459,
                     252478..252480,252592..252594,252598..252600,
                     252604..252606,252625..252627)
                     /locus_tag="Mnod_8024"
                     /note="Ca2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238008"
     gene            253243..253703
                     /locus_tag="Mnod_8025"
                     /pseudo
                     /db_xref="GeneID:7295854"
     gene            complement(253707..253973)
                     /locus_tag="Mnod_8026"
                     /db_xref="GeneID:7295855"
     CDS             complement(253707..253973)
                     /locus_tag="Mnod_8026"
                     /inference="similar to AA sequence:KEGG:Mpop_0501"
                     /note="KEGG: mpo:Mpop_0501 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490187.1"
                     /db_xref="GI:220914879"
                     /db_xref="GeneID:7295855"
                     /translation="MSDAAIKLSGLVRFVAEDCPDDKPDYDRFRQVMMSLGIDLEALS
                     SGAYVIKSMRYTEKYKENRQINCKLAHEKFGKEGNVIPGLLIPK"
     gene            complement(254131..254766)
                     /locus_tag="Mnod_8027"
                     /db_xref="GeneID:7295856"
     CDS             complement(254131..254766)
                     /locus_tag="Mnod_8027"
                     /inference="protein motif:PFAM:PF00072"
                     /note="PFAM: regulatory protein LuxR; response regulator
                     receiver;
                     KEGG: met:M446_4923 two component LuxR family
                     transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator, LuxR
                     family"
                     /protein_id="YP_002490188.1"
                     /db_xref="GI:220914880"
                     /db_xref="InterPro:IPR000792"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:7295856"
                     /translation="MSGSVLIIDDHPVVLQGCRVVLEDAGLATIHVATGVEEGYQSFY
                     RNRPGLVVADLTFQDSGLTGLSLIRRIRALEPATRILVFSMHDDPVIVARALEGGAIG
                     YLLKDTPSVDFATAVARVQAGEPYIDHRLAMKVAILQSSQRVSPLLALTGRELQIFLL
                     LSRGKSYEMIAKYLSLSYKTVANTCSSMRRKLGAESLSELIRLAIRHHSQS"
     misc_feature    complement(254146..254754)
                     /locus_tag="Mnod_8027"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(254407..254751)
                     /locus_tag="Mnod_8027"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(254446..254451,254458..254460,
                     254515..254517,254575..254577,254605..254607,
                     254737..254742))
                     /locus_tag="Mnod_8027"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(254605..254607)
                     /locus_tag="Mnod_8027"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(254575..254583,254587..254589,
                     254596..254598))
                     /locus_tag="Mnod_8027"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(254443..254451)
                     /locus_tag="Mnod_8027"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(254149..254319)
                     /locus_tag="Mnod_8027"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(254176..254178,254209..254223,
                     254227..254232,254236..254241,254263..254271,
                     254308..254316))
                     /locus_tag="Mnod_8027"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(254149..254154,254161..254163,
                     254170..254178,254269..254271,254275..254277,
                     254281..254283))
                     /locus_tag="Mnod_8027"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(254829..255335)
                     /locus_tag="Mnod_8028"
                     /db_xref="GeneID:7295857"
     CDS             complement(254829..255335)
                     /locus_tag="Mnod_8028"
                     /inference="similar to AA sequence:KEGG:Mrad2831_4198"
                     /note="KEGG: mrd:Mrad2831_4198 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490189.1"
                     /db_xref="GI:220914881"
                     /db_xref="GeneID:7295857"
                     /translation="MRRGAQLAAACLLLSACGEAGEGGSQPATVVARHDAGAMPAWLA
                     PDDRTDPALWLAARAAGRLVPAKDPAVARLRAALARAAPRFIKDPRMIANRTAQVLDM
                     LHAAGLPGEAEPILDGLMGIAAAAGARQLYGSLGQHYVNTRIAGAAHRDAVDRLSTKY
                     APQSLKQP"
     sig_peptide     complement(255273..255335)
                     /locus_tag="Mnod_8028"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.987) with cleavage site probability 0.800 at
                     residue 21"
     gene            complement(255332..256276)
                     /locus_tag="Mnod_8029"
                     /db_xref="GeneID:7295858"
     CDS             complement(255332..256276)
                     /locus_tag="Mnod_8029"
                     /inference="protein motif:TFAM:TIGR02276"
                     /note="TIGRFAM: 40-residue YVTN family beta-propeller
                     repeat protein;
                     PFAM: NHL repeat containing protein;
                     SMP-30/Gluconolaconase/LRE domain protein;
                     KEGG: mrd:Mrad2831_4199 YVTN beta-propeller
                     repeat-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490190.1"
                     /db_xref="GI:220914882"
                     /db_xref="InterPro:IPR001258"
                     /db_xref="InterPro:IPR011964"
                     /db_xref="InterPro:IPR013658"
                     /db_xref="GeneID:7295858"
                     /translation="MGRRFAAPVVALLAGTPAAAPAQAGDAYVVSQEGGVVTRIDVAA
                     GRVAAMIPVGPGPAGIAPGPDGRLYVTHPDHRLISVIDAAAGRVVARLPHAGTPFGIA
                     VAPAGDVLFVGDWVRHEVARLDARTGAPVGAPVPVQDPAGLVLDRAGGRLYVAEREQR
                     RVVVIDARALRVLGAVPTGEGPFALALSPDETRLYVANVRSRDLTVIDTGTLRPLATV
                     AVGPMPYGVAPTPDGRFVVVSNQQAGTVSIVDAATLAVAGEVAVGRYPEGVLAVAADR
                     VAVANWFSGDLSLVDPAARREVARLGLAEGPRSLAGAP"
     sig_peptide     complement(256202..256276)
                     /locus_tag="Mnod_8029"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.991 at
                     residue 25"
     misc_feature    complement(<255473..256195)
                     /locus_tag="Mnod_8029"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3391"
                     /db_xref="CDD:225926"
     misc_feature    complement(<255884..256084)
                     /locus_tag="Mnod_8029"
                     /note="PQQ-dependent dehydrogenases and related proteins;
                     Region: PQQ_DH_like; cl11493"
                     /db_xref="CDD:264401"
     misc_feature    complement(255713..255835)
                     /locus_tag="Mnod_8029"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     misc_feature    complement(255593..255712)
                     /locus_tag="Mnod_8029"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     misc_feature    complement(255473..255586)
                     /locus_tag="Mnod_8029"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     gene            complement(256276..256809)
                     /locus_tag="Mnod_8030"
                     /db_xref="GeneID:7295859"
     CDS             complement(256276..256809)
                     /locus_tag="Mnod_8030"
                     /inference="similar to AA sequence:KEGG:Mrad2831_4200"
                     /note="KEGG: mrd:Mrad2831_4200 MxaD protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MxaD protein"
                     /protein_id="YP_002490191.1"
                     /db_xref="GI:220914883"
                     /db_xref="GeneID:7295859"
                     /translation="MSMRLFGAALILGLLATLAPAHGPTPQKIEASTAIAAPPQKVWA
                     VLGDFGGIGGWHPAVVTSEGSGGTANGATRAVTLKRGGVLRESLDEYDAGRMTYSYRL
                     SEPDLAALPVSSYSATIAVTPDGAGSRVAWFGRFYRGDTGNEPPEELNDAAGRAAMKA
                     YFETGLAGLKAKVEGGS"
     sig_peptide     complement(256753..256809)
                     /locus_tag="Mnod_8030"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.884) with cleavage site probability 0.385 at
                     residue 19"
     misc_feature    complement(256288..256731)
                     /locus_tag="Mnod_8030"
                     /note="Pyrabactin resistance 1 (PYR1), PYR1-like (PYL),
                     regulatory component of abscisic acid receptors (RCARs),
                     and related proteins; Region: PYR_PYL_RCAR_like; cd07821"
                     /db_xref="CDD:176863"
     misc_feature    complement(order(256303..256305,256312..256320,
                     256324..256332,256336..256350,256402..256404,
                     256408..256410,256414..256416,256420..256422,
                     256447..256449,256453..256455,256459..256467,
                     256474..256476,256504..256506,256510..256512,
                     256516..256518,256537..256539,256546..256548,
                     256552..256554,256558..256560,256576..256578,
                     256582..256584,256588..256590,256594..256596,
                     256624..256626,256636..256638,256642..256644,
                     256669..256674,256678..256686,256711..256713,
                     256717..256719,256723..256725))
                     /locus_tag="Mnod_8030"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176863"
     misc_feature    complement(order(256318..256320,256330..256332,
                     256339..256344,256348..256353,256474..256479,
                     256570..256575,256630..256632,256636..256641))
                     /locus_tag="Mnod_8030"
                     /note="protein interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176863"
     misc_feature    complement(order(256564..256566,256570..256575))
                     /locus_tag="Mnod_8030"
                     /note="gate; other site"
                     /db_xref="CDD:176863"
     gene            complement(256806..257810)
                     /locus_tag="Mnod_8031"
                     /db_xref="GeneID:7295860"
     CDS             complement(256806..257810)
                     /locus_tag="Mnod_8031"
                     /inference="protein motif:SMART:SM00327"
                     /note="SMART: von Willebrand factor type A;
                     KEGG: mpo:Mpop_4623 von Willebrand factor type A"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="YP_002490192.1"
                     /db_xref="GI:220914884"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="GeneID:7295860"
                     /translation="MTGRLAAILRAGLRRLRSDPHGRLLAGAALLTGLALAMPPVALT
                     RSRVEALVVVDITGSMNTRDYARDGRPASRLEITKAALRWMAADLPCGSRLGLALFSE
                     RRVFLLFEPVEVCADFAPLDGAIAGLDWRMAWDGDSRIAAGLHRAIALAGELGSDLAF
                     VTDGHEAPPLPAGGPPPFEGRAGAVRGVILGTGGYGLSPIPRYDDRGRETGFYGPGDV
                     PHENRFGPPPPDAETREGYNPRNAPYGALPAEGSEHLSSVREAYLRRLAGETGLAYAH
                     LAGPDGLAEPVTAAATPRPVRAVVDLRPIPGALALACLVALYGLLPWRDRRRLQYGKV
                     "
     sig_peptide     complement(257697..257810)
                     /locus_tag="Mnod_8031"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.953) with cleavage site probability 0.691 at
                     residue 38"
     misc_feature    complement(257172..257660)
                     /locus_tag="Mnod_8031"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(257322..257324,257397..257399,
                     257646..257648))
                     /locus_tag="Mnod_8031"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(257807..258412)
                     /locus_tag="Mnod_8032"
                     /db_xref="GeneID:7295861"
     CDS             complement(257807..258412)
                     /locus_tag="Mnod_8032"
                     /inference="similar to AA sequence:KEGG:Mrad2831_4202"
                     /note="KEGG: mrd:Mrad2831_4202 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490193.1"
                     /db_xref="GI:220914885"
                     /db_xref="GeneID:7295861"
                     /translation="MIASGFPAARRPGLRPIWLRLRSPLLLVLPGLLAAAALGAVALA
                     WRDIAANRTIAALEAGKDAAVASGALPEVLLARIRFLARRERFEEAEPLTDALDRRGP
                     ARLRGEARRVLGDARLRQAFGRLEAGDLEKAGPLVVLAREAYRRALTLRPDDWDAKYN
                     LDVASRLVRDFPERGRTEGEEMPADPRKIWTDIPGQPRGLP"
     sig_peptide     complement(258293..258412)
                     /locus_tag="Mnod_8032"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.987) with cleavage site probability 0.417 at
                     residue 40"
     misc_feature    complement(<257930..258040)
                     /locus_tag="Mnod_8032"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cl02429"
                     /db_xref="CDD:243034"
     gene            complement(258409..259470)
                     /locus_tag="Mnod_8033"
                     /db_xref="GeneID:7295862"
     CDS             complement(258409..259470)
                     /locus_tag="Mnod_8033"
                     /inference="protein motif:SMART:SM00327"
                     /note="SMART: von Willebrand factor type A;
                     KEGG: mrd:Mrad2831_4203 von Willebrand factor type A"
                     /codon_start=1
                     /transl_table=11
                     /product="von Willebrand factor A"
                     /protein_id="YP_002490194.1"
                     /db_xref="GI:220914886"
                     /db_xref="InterPro:IPR002035"
                     /db_xref="GeneID:7295862"
                     /translation="MSLLARLAATTPDLLWLLPLALLPLLGPALRRHPLPAAAMVPAD
                     GLSRAIGLGLTLAGIGAIGFTLVAVAGPFLRGERIHRTGTGAQVSLLIDRSGSMNESF
                     AGRQPSGAEESKAAASRRLLAEFVGRRPHDQVAVSVFSTAPIAVLPMTDRSEAVRAAI
                     RAIDRPGLDATNVARGLGLALSQFGAGASTGRVLLLVSDGAAVIDRRTQDTLRAAFAQ
                     LRPTLYWLFLRTAGSPGLADRPSGEDTPQAAPERHLDLFFRGLGVPYRAFEAESPQAV
                     EEAIREIDRLERHPIALVEERPRRDLTGLAYGLAGLCIGILLLAKLIEADLAAPCRAS
                     DAADVVRAGSAPADARRVA"
     misc_feature    complement(258775..259215)
                     /locus_tag="Mnod_8033"
                     /note="Von Willebrand factor type A (vWA) domain was
                     originally found in the blood coagulation protein von
                     Willebrand factor (vWF). Typically, the vWA domain is made
                     up of approximately 200 amino acid residues folded into a
                     classic a/b para-rossmann type of...; Region: vWFA;
                     cd00198"
                     /db_xref="CDD:238119"
     misc_feature    complement(order(258874..258876,258958..258960,
                     259192..259194))
                     /locus_tag="Mnod_8033"
                     /note="metal ion-dependent adhesion site (MIDAS); other
                     site"
                     /db_xref="CDD:238119"
     gene            complement(259467..260414)
                     /locus_tag="Mnod_8034"
                     /db_xref="GeneID:7295863"
     CDS             complement(259467..260414)
                     /locus_tag="Mnod_8034"
                     /inference="similar to AA sequence:KEGG:Mrad2831_4204"
                     /note="KEGG: mrd:Mrad2831_4204 MxaA protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MxaA protein"
                     /protein_id="YP_002490195.1"
                     /db_xref="GI:220914887"
                     /db_xref="GeneID:7295863"
                     /translation="MRGRAIPALLVLLAILTAAPAAAQVGDVVVRSPRPFGLFAGDLF
                     TAEVEIAVADGLSLEPASLPKPGPLTRWLDLRAVAVTAGPVKDGERRWRLTLTYQTFY
                     VALDARKLEVPGFPVTFAAQTAAALTTASAEVPGWPVGVSPLREVQPAPVDDPADHMR
                     PQAPAPRRDPGPATVAALGLSALALAALGLLAHDRAWWLFRRRPARAFAAALRQLRRL
                     ARSPDPDAAYRGALLALHRGLDRTAGRRVLADDLGAFLDRHPVYRPLAQPLARFFQAS
                     RETFFGRDPAGARAAWPLAEAETVARRLAAVERIAERPA"
     sig_peptide     complement(260343..260414)
                     /locus_tag="Mnod_8034"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.979 at
                     residue 24"
     gene            complement(260411..261262)
                     /locus_tag="Mnod_8035"
                     /db_xref="GeneID:7295864"
     CDS             complement(260411..261262)
                     /locus_tag="Mnod_8035"
                     /inference="similar to AA sequence:KEGG:Mext_4145"
                     /note="KEGG: mex:Mext_4145 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490196.1"
                     /db_xref="GI:220914888"
                     /db_xref="GeneID:7295864"
                     /translation="MSAPDILYRLRDPAAGPGPGAHRARDTGGPGIFRDQVPFWRHPD
                     ARRIDLRATLRDPFGTTMVRRFEQPRAVEVWVLLDLSASMRFCGRSEPWRLACDLCVA
                     LAHSATRIGDAFGLIGCDAGPREDVTLPATRRRCAAARVTAMLDAVVPHGRGAAGLVA
                     AAGRLAGRRRLVLVVSDFRMPEAQVAALFDRLAPHDLVPVLVDDDALGADLPDFGLLA
                     LDDLEGGGRRLVLMRPALKARWLAREAAFRTALHRLALARGRPPYRLAGRLDADELSR
                     HLLGTAA"
     misc_feature    complement(260501..>261259)
                     /locus_tag="Mnod_8035"
                     /note="Uncharacterized conserved protein (some members
                     contain a von Willebrand factor type A (vWA) domain)
                     [General function prediction only]; Region: COG1721"
                     /db_xref="CDD:224635"
     misc_feature    complement(260915..261133)
                     /locus_tag="Mnod_8035"
                     /note="Protein of unknown function DUF58; Region: DUF58;
                     pfam01882"
                     /db_xref="CDD:250938"
     gene            complement(261259..262290)
                     /locus_tag="Mnod_8036"
                     /db_xref="GeneID:7295865"
     CDS             complement(261259..262290)
                     /locus_tag="Mnod_8036"
                     /inference="protein motif:PFAM:PF07726"
                     /note="PFAM: ATPase associated with various cellular
                     activities AAA_3; ATPase associated with various cellular
                     activities AAA_5;
                     SMART: AAA ATPase;
                     KEGG: mpo:Mpop_4628 ATPase associated with various
                     cellular activities AAA_3"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="YP_002490197.1"
                     /db_xref="GI:220914889"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011703"
                     /db_xref="InterPro:IPR011704"
                     /db_xref="GeneID:7295865"
                     /translation="MNQIRPADAMLTDWREAALRFEREVGKAVIGQERAIRLVTIAIF
                     VRGHVLLEGDVGVGKTTLLRAVARALGGSYERIEGTVDLMPADLIYHTFLADDGRPRV
                     EPGPVLRRAEDLSVFFFNEINRARPQVHALLLRLMAERSVQAFEREYRFPHLLVFADR
                     NRVEREETFELPAAARDRFLMEIGLEAPRDPELRRRLAFDPRFHDTDRLIGEVAPGIL
                     DHAAIGGIAAAIQHGIHASPDLEAYVVALWAALLDPAAAGIRLPDIAMEALVQGGASP
                     RGIAFLIRAARVRAWLEGRDMLVPEDVREVFLETMAHRVFLEPVYEMRRERLVPELCR
                     AVLAAVPVP"
     misc_feature    complement(261262..262272)
                     /locus_tag="Mnod_8036"
                     /note="MoxR-like ATPases [General function prediction
                     only]; Region: COG0714"
                     /db_xref="CDD:223786"
     misc_feature    complement(261733..262203)
                     /locus_tag="Mnod_8036"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(262111..262134)
                     /locus_tag="Mnod_8036"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(261808..261810,261931..261933,
                     262108..262131))
                     /locus_tag="Mnod_8036"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(261928..261945)
                     /locus_tag="Mnod_8036"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(261757..261759)
                     /locus_tag="Mnod_8036"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     gene            complement(262424..262723)
                     /locus_tag="Mnod_8037"
                     /db_xref="GeneID:7295866"
     CDS             complement(262424..262723)
                     /locus_tag="Mnod_8037"
                     /inference="protein motif:PFAM:PF02315"
                     /note="PFAM: methanol dehydrogenase beta subunit;
                     KEGG: mex:Mext_4147 methanol dehydrogenase beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="methanol dehydrogenase beta subunit"
                     /protein_id="YP_002490198.1"
                     /db_xref="GI:220914890"
                     /db_xref="InterPro:IPR003420"
                     /db_xref="GeneID:7295866"
                     /translation="MRMTLAAAAIAAGTLVAGTALPALAYDGTKCKAAGDCWEPKPGF
                     PDKIAGTKYDPKHDPKELNKQADSIKAMEERNRKRVEAFKRTGRFEYDVTKLASQ"
     sig_peptide     complement(262646..262723)
                     /locus_tag="Mnod_8037"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 26"
     misc_feature    complement(262436..262681)
                     /locus_tag="Mnod_8037"
                     /note="Methanol dehydrogenase beta subunit; Region: MDH;
                     pfam02315"
                     /db_xref="CDD:111229"
     gene            complement(262817..263425)
                     /locus_tag="Mnod_8038"
                     /db_xref="GeneID:7295867"
     CDS             complement(262817..263425)
                     /locus_tag="Mnod_8038"
                     /inference="protein motif:PFAM:PF00034"
                     /note="PFAM: cytochrome c class I;
                     KEGG: mpo:Mpop_4630 cytochrome c class I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="YP_002490199.1"
                     /db_xref="GI:220914891"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:7295867"
                     /translation="MMKRWTALSASLGLVVTITALGPLAGALSPRATAQSSSVDLRSV
                     VTGEKLDLNEALPEGRDTEGVKRFLASGRNPYLFDASCLKKGEQTFLAACSGCHGHVG
                     EGKIGPGLNDNYWTYPQGTTDAGLFSIVFGGAQAQMGPQSLSLTLDDILQAMAWVRHL
                     YTGPAQDAEWLSEDQKKSYTPYKLGETFPDDPPGMCRGSGKS"
     sig_peptide     complement(263321..263425)
                     /locus_tag="Mnod_8038"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.723 at
                     residue 35"
     misc_feature    complement(262910..263305)
                     /locus_tag="Mnod_8038"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            complement(263488..264333)
                     /locus_tag="Mnod_8039"
                     /db_xref="GeneID:7295868"
     CDS             complement(263488..264333)
                     /locus_tag="Mnod_8039"
                     /inference="protein motif:SMART:SM00062"
                     /note="SMART: extracellular solute-binding protein family
                     3;
                     KEGG: mrd:Mrad2831_4209 extracellular solute-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="family 3 extracellular solute-binding protein"
                     /protein_id="YP_002490200.1"
                     /db_xref="GI:220914892"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:7295868"
                     /translation="MLRSLVGGLAGLTALAAAAGAAPATAPATGQPALRVCAAASQPP
                     LSLRDGSGLENKVAAAVAAAMDRKVEFVWSDKPAIYLVRDFLDKKLCDVIAGLDTGDA
                     RVLTTRPYYRSGYVFISRQQDGLDVASWTDPRLKQVGHVAVPFGSPSEAMLKRIGRYE
                     EDMAYLYSLVNFRSPRNQYTQIEPARLVEEVATGKAAIAAPFAPEVARFVKASPVPLR
                     MTLIADDASRDGQKITMQFDQSMGVRRGDETLLKELEAGLAKAKPAIEAILKEEGVPT
                     LPTGS"
     sig_peptide     complement(264268..264333)
                     /locus_tag="Mnod_8039"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.805 at
                     residue 22"
     misc_feature    complement(263503..264237)
                     /locus_tag="Mnod_8039"
                     /note="methanol oxidation system protein MoxJ; Region:
                     ABC_MoxJ; TIGR03870"
                     /db_xref="CDD:163582"
     misc_feature    complement(263533..264234)
                     /locus_tag="Mnod_8039"
                     /note="Bacterial periplasmic substrate-binding proteins;
                     Region: PBPb; smart00062"
                     /db_xref="CDD:214497"
     gene            complement(264401..266290)
                     /locus_tag="Mnod_8040"
                     /db_xref="GeneID:7295869"
     CDS             complement(264401..266290)
                     /locus_tag="Mnod_8040"
                     /inference="protein motif:TFAM:TIGR03075"
                     /note="TIGRFAM: PQQ-dependent dehydrogenase,
                     methanol/ethanol family;
                     PFAM: Pyrrolo-quinoline quinone;
                     KEGG: mrd:Mrad2831_4210 methanol/ethanol family
                     PQQ-dependent dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ-dependent dehydrogenase"
                     /protein_id="YP_002490201.1"
                     /db_xref="GI:220914893"
                     /db_xref="InterPro:IPR001479"
                     /db_xref="InterPro:IPR002372"
                     /db_xref="InterPro:IPR017512"
                     /db_xref="GeneID:7295869"
                     /translation="MLGKIVVRCRTGVSVAALAALLPLAGPSALANDKLVELSKSDGN
                     WVMPGKNYDSDNYSKLKQINAENVKNLKVSWQFSTGLLNGHEGAPLVVDGTMYVHTSF
                     PNNTFALGLDDPGKILWQDKPKQNPAARSVACCDLVNRGLAYWPGDGKTPSLILKTLL
                     DGHVVALNAQTGETVWKIENSDIRVGSTLTIAPYVVKDKVIIGSSGAELGVRGYLTAY
                     DVRTGEQKWRAYATGPDSDLLLAKDFNIHNAHYGQKGLGTSTWEGDAWKIGGGTNWGW
                     YAYDPGTNLIYFGTGNPAPWNETMRPGDNKWTMTIFARDVDTGEAKFGYQKTPHDEWD
                     YAGVNVMMLSTQKDRSGKERKLLTHPDRNGIVYTLDRTNGDLISAHKIDDTVNVFKTV
                     DLKSGLPVRDPEYGTRMDHLAKDICPSAMGYHNQGHDSYDPERKLFYMGINHICMDWE
                     PFMLPYRAGQFFVGATLNMYPGPKGDRQNAEGLGQIKAYDAITGKFKWEKMERFAVWG
                     GTLATAGNVVFYGTLDGFIKARHSDTGELLWKAKLPSGAIGYPVTYTHKGTQYVAIYY
                     GVGGWPGVGLVFDLQDPTAGLGAVGAFKKLANYTQMGGGVTVFSLDGKGPYDDPNTGE
                     YVAAN"
     sig_peptide     complement(266195..266290)
                     /locus_tag="Mnod_8040"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.995 at
                     residue 32"
     misc_feature    complement(264584..266209)
                     /locus_tag="Mnod_8040"
                     /note="PQQ-dependent dehydrogenase, methanol/ethanol
                     family; Region: PQQ_enz_alc_DH; TIGR03075"
                     /db_xref="CDD:234102"
     misc_feature    complement(264458..266158)
                     /locus_tag="Mnod_8040"
                     /note="Large subunit of methanol dehydrogenase (moxF);
                     Region: PQQ_MDH; cd10278"
                     /db_xref="CDD:199836"
     misc_feature    complement(order(264461..264463,264467..264469,
                     264674..264676,264683..264691,264698..264700,
                     264704..264706,264797..264799,264806..264814,
                     264821..264823,264827..264829,265157..265159,
                     265166..265174,265181..265183,265187..265189,
                     265322..265324,265331..265339,265346..265348,
                     265352..265354,265610..265612,265619..265627,
                     265634..265636,265640..265642,265763..265765,
                     265772..265780,265787..265789,265793..265795,
                     265934..265936,265943..265951,265961..265963,
                     265967..265969,266066..266068,266075..266083))
                     /locus_tag="Mnod_8040"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199836"
     misc_feature    complement(order(264482..264490,264593..264595,
                     264659..264670,264713..264715,265925..265927,
                     265931..265933,265940..265948,265970..265972,
                     266045..266047,266051..266074))
                     /locus_tag="Mnod_8040"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199836"
     misc_feature    complement(order(264578..264580,264770..264772,
                     265016..265018,265205..265207,265289..265291,
                     265403..265405,265415..265417,265469..265471,
                     265475..265477,265667..265669,265673..265678,
                     265721..265723,265871..265873,265877..265879,
                     265886..265891,266033..266035))
                     /locus_tag="Mnod_8040"
                     /note="active site"
                     /db_xref="CDD:199836"
     misc_feature    complement(order(264920..264925,264932..264934,
                     265295..265297,265301..265303,265373..265375,
                     265379..265387,265391..265399,265487..265492,
                     265505..265507,265511..265516,265607..265609,
                     265625..265627,265655..265663,265745..265768))
                     /locus_tag="Mnod_8040"
                     /note="small subunit binding site [polypeptide binding];
                     other site"
                     /db_xref="CDD:199836"
     gene            266785..267006
                     /locus_tag="Mnod_8041"
                     /pseudo
                     /db_xref="GeneID:7295870"
     gene            complement(267121..268188)
                     /locus_tag="Mnod_8042"
                     /db_xref="GeneID:7295871"
     CDS             complement(267121..268188)
                     /locus_tag="Mnod_8042"
                     /inference="similar to AA sequence:KEGG:M446_5605"
                     /note="KEGG: met:M446_5605 dihydrodipicolinate synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="YP_002490202.1"
                     /db_xref="GI:220914894"
                     /db_xref="GeneID:7295871"
                     /translation="MPADHNFPTDRTKLARLLFPAGVPMLWSPTLVFYDEAGRIDRDR
                     QLAHLAFMAPHVKGYLVPGSTGDAWEMDDAEALTALEVAIPFAVQHGLDLLVGVLRPT
                     TDAMHALIDKVLHYLCRRAGTHSVADAFAASHVRGLTIAAPTTDTPLSQDAIGAALAP
                     VFELGLPIALYQLPQVTGNTMTPELVAGLAERFPNLLLFKDSSGRDEVALSGRMPAGV
                     TLLRGAEGDYAQWSKAHGGVYDGFLLSSANAFPAQLATVLEHLQHGRIAEAERCSAAI
                     SAAVADAFAAVVEVRQGNAFTNANKALAHIMAYGRDALEAPPPRLYAGGHLPHSTLKT
                     VMESLTRNGLLPGRGYLENRG"
     misc_feature    complement(267376..268113)
                     /locus_tag="Mnod_8042"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(267589..267591,267676..267678,
                     267994..268002,268009..268011,268102..268104))
                     /locus_tag="Mnod_8042"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(267460..267462,267589..267591,
                     267676..267678,267994..268002,268009..268011))
                     /locus_tag="Mnod_8042"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    complement(order(267718..267720,267730..267732,
                     267751..267756,267880..267885,267979..267984,
                     267997..267999))
                     /locus_tag="Mnod_8042"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    complement(267589..267591)
                     /locus_tag="Mnod_8042"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(268259..268627)
                     /locus_tag="Mnod_8043"
                     /pseudo
                     /db_xref="GeneID:7295872"
     gene            268948..270168
                     /locus_tag="Mnod_8044"
                     /db_xref="GeneID:7295873"
     CDS             268948..270168
                     /locus_tag="Mnod_8044"
                     /inference="protein motif:PFAM:PF01094"
                     /note="PFAM: Extracellular ligand-binding receptor;
                     KEGG: met:M446_5573 branched chain amino acid ABC
                     transporter periplasmic ligand-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular ligand-binding receptor"
                     /protein_id="YP_002490203.1"
                     /db_xref="GI:220914895"
                     /db_xref="InterPro:IPR001828"
                     /db_xref="GeneID:7295873"
                     /translation="MTRRHLCATLALLGLSLPLAGTAEAQISDDTVKIGLITDMSGMY
                     ADADGPGGAEAIRMAIADFGGTVAGKKIEFVVADHQNKADIGSAKVREWIDRDGVDMV
                     LAGPNSSVGLAVAKIAADRKKPFIAIGSTSSRLTNEECSPFTIHYAYDTVSLSKGTGS
                     AIVAAGGKNWYFLTADYVFGLSIEKDTRDVITAKGATVAGSIKHPLGSSDFSSFLLQA
                     QGSGADTLALANAGADTINSIKAAHEFGISDTMKIVAMNMYLTDVHSLGLPVAKNLFM
                     TDGWYWDLNDESRAWAKKYFAKLGRMPTLLHAADYSAVTTYLDAVKATGTDAGEAVMK
                     QIKATPINDFFAKGGHVRPDGRMIHDMYLVQVKTPEESKYPWDYYKLVKVIPGEEAAT
                     SKAESRCALWTAEN"
     sig_peptide     268948..269025
                     /locus_tag="Mnod_8044"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.871 at
                     residue 26"
     misc_feature    269044..270039
                     /locus_tag="Mnod_8044"
                     /note="Periplasmic solute-binding domain of active
                     transport proteins that belong to the type I periplasmic
                     binding fold protein family; Region: PBP1_SBP_like_1;
                     cd06327"
                     /db_xref="CDD:107322"
     misc_feature    269104..270051
                     /locus_tag="Mnod_8044"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    order(269263..269271,269332..269340,269482..269484,
                     269638..269640,269716..269718)
                     /locus_tag="Mnod_8044"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107322"
     gene            270205..271356
                     /locus_tag="Mnod_8045"
                     /db_xref="GeneID:7295874"
     CDS             270205..271356
                     /locus_tag="Mnod_8045"
                     /inference="protein motif:PFAM:PF00441"
                     /note="PFAM: acyl-CoA dehydrogenase domain protein;
                     Acyl-CoA dehydrogenase type 2 domain;
                     KEGG: azo:azo0394 probable acyl-CoA dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="acyl-CoA dehydrogenase"
                     /protein_id="YP_002490204.1"
                     /db_xref="GI:220914896"
                     /db_xref="InterPro:IPR006089"
                     /db_xref="InterPro:IPR006090"
                     /db_xref="InterPro:IPR006091"
                     /db_xref="InterPro:IPR006092"
                     /db_xref="InterPro:IPR013107"
                     /db_xref="GeneID:7295874"
                     /translation="MFNDLTDDESALKRAVEAFAQGQLKARIAPFVEQHEFPSDLVRA
                     FAGLGFMGTAYDPDYEGGGLGTRGAAIVAETLAEVEPGFAAIYLCNSAPMSVIARFGS
                     DALKREWLAPLCRGDCIASFGVSEPHGGSDVASTRTRAVRDGDDWILTGSKVFSTNAG
                     TDLHGLSAVVAVTDPDKGAKGLSTFVVPVGTPGFRVGKAGRKVGWRIAPSVELFFDEC
                     RIPGRLMVGAQGEGLRQILTTLSLGRILVAAAALGLSRKALGLAARYGRDRRVGGRPI
                     FENQGLTFPLADAMTQIHAAELMVRNAACLADAGRPFRLETSMTKLFASEMAGEIVDL
                     AVQVHGGYGIFEDYEVSGLMGEAKVLQIVEGTSEVQRLVIARELLQHVG"
     misc_feature    270205..271341
                     /locus_tag="Mnod_8045"
                     /note="Acyl-CoA dehydrogenases [Lipid metabolism]; Region:
                     CaiA; COG1960"
                     /db_xref="CDD:224871"
     misc_feature    270223..271341
                     /locus_tag="Mnod_8045"
                     /note="Acyl-CoA dehydrogenase; Region: ACAD; cl09933"
                     /db_xref="CDD:263927"
     misc_feature    order(270478..270480,270568..270570,270574..270576,
                     270667..270669,270673..270675,271288..271296,
                     271300..271302,271306..271308)
                     /locus_tag="Mnod_8045"
                     /note="active site"
                     /db_xref="CDD:173838"
     gene            complement(271385..272059)
                     /locus_tag="Mnod_8046"
                     /db_xref="GeneID:7295875"
     CDS             complement(271385..272059)
                     /locus_tag="Mnod_8046"
                     /inference="protein motif:PFAM:PF07729"
                     /note="PFAM: regulatory protein GntR HTH; GntR domain
                     protein;
                     KEGG: mrd:Mrad2831_2118 GntR family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002490205.1"
                     /db_xref="GI:220914897"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="GeneID:7295875"
                     /translation="MLNKTPSISQADAAYCRIEEMIVTRELAPGQMISEKRLSEQLGC
                     GRTPLREALQRLKLEGYVEIHASRGILVAPIDVMRQLDLLEVRRSLEDLMVRLGAERA
                     SAPEREHLRALARDLQDAAAANDRTAFLRLNRAVHHALSRVSHNEMLASTIAVVHGQS
                     RRFWYSQFEGQGLFEQAARFHGATLEAVAGGNADEASRHAAAFLDFLETLTRNAIERR
                     AAYARS"
     misc_feature    complement(271391..272059)
                     /locus_tag="Mnod_8046"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(271841..272011)
                     /locus_tag="Mnod_8046"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(271850..271861,271865..271870,
                     271898..271900,271907..271912,271916..271930,
                     271952..271957))
                     /locus_tag="Mnod_8046"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(271445..271816)
                     /locus_tag="Mnod_8046"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            272205..273530
                     /locus_tag="Mnod_8047"
                     /db_xref="GeneID:7295876"
     CDS             272205..273530
                     /locus_tag="Mnod_8047"
                     /inference="protein motif:PFAM:PF01266"
                     /note="PFAM: fumarate reductase/succinate dehydrogenase
                     flavoprotein domain protein; FAD dependent oxidoreductase;
                     KEGG: met:M446_1335 FAD dependent oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_002490206.1"
                     /db_xref="GI:220914898"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR003953"
                     /db_xref="InterPro:IPR006076"
                     /db_xref="GeneID:7295876"
                     /translation="MDRRDRMRLQSDVLIVGGGAAGVAAAVTAARQGLKVTLVERYGF
                     CGGGAVAGLSGTVCGLYAATDDRQAPPEQVVFGFADEFCRRLDGLGGLSAPMPYGKTY
                     TRVHDPLIWRETADSFLREAGIEVIFHAVAVGALCEGDRVEGLEIWTKEGPIDARASV
                     VVDASGDADVVALAGLPSFIGDNGTVQNPTMIFRLMGVDVDRFKAEYGEDTIMPERIS
                     ELIRRKDNLGEYHLPRAKIWLFPTTRPGELLCNCTRVLGPDGRELNTLRWLDFTDAEF
                     EGRRQMREYARFFRDNLVGCESAFVNDTGVQVGVRQTRQMSGRSRLMNADVVSGAKSP
                     EGIARSPWPIELHAGQKPRVEWLLNDYYEVPFGCFVPERGEGLLAAGRCLSAEHEAVA
                     SARVTAQCFAYGHAVGHAAAIAVKDKVSTRSISGADLRALLNRDGAALD"
     sig_peptide     272205..272294
                     /locus_tag="Mnod_8047"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.788) with cleavage site probability 0.466 at
                     residue 30"
     misc_feature    272295..273503
                     /locus_tag="Mnod_8047"
                     /note="FAD dependent oxidoreductase; Region: FAD_oxidored;
                     pfam12831"
                     /db_xref="CDD:257333"
     gene            273606..274349
                     /locus_tag="Mnod_8048"
                     /db_xref="GeneID:7295877"
     CDS             273606..274349
                     /locus_tag="Mnod_8048"
                     /inference="protein motif:PFAM:PF00378"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: met:M446_1338 enoyl-CoA hydratase/isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/isomerase"
                     /protein_id="YP_002490207.1"
                     /db_xref="GI:220914899"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="GeneID:7295877"
                     /translation="MVRSETRGSVAIVTLDRAARRNALGTESMRALSAALRAADADES
                     VRAIVLTGAPPAFCAGSDLKELGGLSIPAMCDHEAETATVARSIGFLTKPVVAAVEGY
                     ALGGGFILAVSCDVVVSAENARWHLAEVTNGWLPVWGLQALLARVGPVRARLLTWGVE
                     SIDGREALRLGVADYTAEAGGALDRALAVAQGLAKLPPEAVTSTKRFFEPFVMADAER
                     LDNVASRMFARDCESASAQATLARFTVRS"
     misc_feature    273606..274343
                     /locus_tag="Mnod_8048"
                     /note="Enoyl-CoA hydratase/carnithine racemase [Lipid
                     metabolism]; Region: CaiD; COG1024"
                     /db_xref="CDD:223955"
     misc_feature    273609..274184
                     /locus_tag="Mnod_8048"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(273666..273668,273672..273674,273768..273770,
                     273780..273794,273909..273911,273915..273923,
                     273987..273992,273999..274001)
                     /locus_tag="Mnod_8048"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(273786..273788,273921..273923)
                     /locus_tag="Mnod_8048"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(273861..273863,273885..273887,273948..273959,
                     273993..274004,274017..274019,274023..274031,
                     274035..274040,274053..274058,274062..274067,
                     274071..274076,274083..274085,274116..274118,
                     274125..274127,274170..274172,274179..274184)
                     /locus_tag="Mnod_8048"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
     gene            274346..275938
                     /locus_tag="Mnod_8049"
                     /db_xref="GeneID:7295878"
     CDS             274346..275938
                     /locus_tag="Mnod_8049"
                     /inference="protein motif:PFAM:PF01144"
                     /note="PFAM: coenzyme A transferase;
                     KEGG: reu:Reut_C6427 propionate CoA-transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme A transferase"
                     /protein_id="YP_002490208.1"
                     /db_xref="GI:220914900"
                     /db_xref="InterPro:IPR004165"
                     /db_xref="GeneID:7295878"
                     /translation="MTKIVDAARFVETIRDGSTVASVGVIGWITPDRILKALGDRFRE
                     TGSPRDLTFYFPCGTGDAQGIKGMDHVAQEGLMKRIVSGSFINPVDPVTGKRPELMRL
                     VRENRIEAYSWPIGASMHWLREVARKSPGYITRVGLGTYIDPDLGGGKFTAKAAEDLV
                     RAIELDGERLLYYPTWPIDTAIVRASSADEEGNLSFEDEPLTSSSLALVLACKACGGR
                     VVAQVRRIVPHGERPASAVRVPGMFVDAVVVDEDMMMTTGVPYDPSYFSGTRIPLSQL
                     PRPEMGPDKVIAARAAKEVRRHELSIFGFGAAADIPLVMNEQGLFKDGAIKDWWFTTE
                     HGSYGGVVMSGWQFSANVNPDAILDGVTQFDVIDGGLCRFAALAFAQFDEKGRVNVSR
                     FGAANPGAGGFIDIAERAERLVFTGTMTTGGLSIAYEDGRTRVLKEGKVKKFARCVES
                     ITYDVGAGVRERGQTALIVTERAVFEMTPEGLVLTEIAPGIDVERDVLGQMEFAPARI
                     SESLREMDAALFHQRMQLALAG"
     misc_feature    274346..275932
                     /locus_tag="Mnod_8049"
                     /note="Acyl CoA:acetate/3-ketoacid CoA transferase [Lipid
                     metabolism]; Region: COG4670"
                     /db_xref="CDD:227016"
     misc_feature    274364..275089
                     /locus_tag="Mnod_8049"
                     /note="Coenzyme A transferase; Region: CoA_trans;
                     smart00882"
                     /db_xref="CDD:214882"
     misc_feature    275201..275827
                     /locus_tag="Mnod_8049"
                     /note="Coenzyme A transferase; Region: CoA_trans; cl17247"
                     /db_xref="CDD:247801"
     gene            276037..276822
                     /locus_tag="Mnod_8050"
                     /db_xref="GeneID:7295879"
     CDS             276037..276822
                     /locus_tag="Mnod_8050"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: met:M446_3246 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490209.1"
                     /db_xref="GI:220914901"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="GeneID:7295879"
                     /translation="MQPARAAAPDDRDIVLATEGLTMEFKGFRAVNGVALRVERGTIH
                     ALIGPNGAGKTTCFNLLTKFLTPTAGAIRYNGRDITRMKPADVARLGLVRSFQISAVF
                     PHLTVKENVRIALQRRQRGDSFDFWRSERVLRALNDEALSLIEAVGLADFAEVPAVEL
                     SYGRKRALEIATTLALNPAMLLLDEPMAGMGHEDVDRTAALIRRVSANRTILMVEHNL
                     SVVASLSDRITVLARGQVLAEGDYATVSKDPRVVEAYIGAGHG"
     misc_feature    276073..276807
                     /locus_tag="Mnod_8050"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    276082..276789
                     /locus_tag="Mnod_8050"
                     /note="ATP-binding cassette component of branched chain
                     amino acids transport system; Region:
                     ABC_Mj1267_LivG_branched; cd03219"
                     /db_xref="CDD:213186"
     misc_feature    276178..276201
                     /locus_tag="Mnod_8050"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    order(276187..276192,276196..276204,276325..276327,
                     276586..276591,276682..276684)
                     /locus_tag="Mnod_8050"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213186"
     misc_feature    276316..276327
                     /locus_tag="Mnod_8050"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213186"
     misc_feature    276514..276543
                     /locus_tag="Mnod_8050"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213186"
     misc_feature    276574..276591
                     /locus_tag="Mnod_8050"
                     /note="Walker B; other site"
                     /db_xref="CDD:213186"
     misc_feature    276598..276609
                     /locus_tag="Mnod_8050"
                     /note="D-loop; other site"
                     /db_xref="CDD:213186"
     misc_feature    276670..276690
                     /locus_tag="Mnod_8050"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213186"
     gene            276815..277549
                     /locus_tag="Mnod_8051"
                     /db_xref="GeneID:7295880"
     CDS             276815..277549
                     /locus_tag="Mnod_8051"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: met:M446_3245 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490210.1"
                     /db_xref="GI:220914902"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:7295880"
                     /translation="MAEAALTTSAAAAPLLAVQGLEGWYGESHVLHGVSFDVRPGEVV
                     TLLGRNGAGKTTTLRAIIGILGKRKGSIRYAGTETIGMASRSIAKLGLGYVPEERGIF
                     SSLSVYENLMLPPRVKPGGMSVEQIYTLFPNLQERAGSQGTKLSGGEQQMLAIGRILR
                     TGAKLILLDEPTEGLAPVIVQQIGRTLARLKSEGYTIVLVEQNFRFAQTVADRHFVVE
                     QGRVIDMIPNAELDANIDKLHAYLGV"
     sig_peptide     276815..276868
                     /locus_tag="Mnod_8051"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.773) with cleavage site probability 0.479 at
                     residue 18"
     misc_feature    276854..277546
                     /locus_tag="Mnod_8051"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivF; COG0410"
                     /db_xref="CDD:223487"
     misc_feature    276860..277516
                     /locus_tag="Mnod_8051"
                     /note="ATP-binding cassette domain of branched-chain amino
                     acid transporter; Region: ABC_TM1139_LivF_branched;
                     cd03224"
                     /db_xref="CDD:213191"
     misc_feature    276956..276979
                     /locus_tag="Mnod_8051"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    order(276965..276970,276974..276982,277103..277105,
                     277319..277324,277418..277420)
                     /locus_tag="Mnod_8051"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213191"
     misc_feature    277094..277105
                     /locus_tag="Mnod_8051"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213191"
     misc_feature    277247..277276
                     /locus_tag="Mnod_8051"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213191"
     misc_feature    277307..277324
                     /locus_tag="Mnod_8051"
                     /note="Walker B; other site"
                     /db_xref="CDD:213191"
     misc_feature    277331..277342
                     /locus_tag="Mnod_8051"
                     /note="D-loop; other site"
                     /db_xref="CDD:213191"
     misc_feature    277406..277426
                     /locus_tag="Mnod_8051"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213191"
     gene            277559..278440
                     /locus_tag="Mnod_8052"
                     /db_xref="GeneID:7295881"
     CDS             277559..278440
                     /locus_tag="Mnod_8052"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: met:M446_3243 inner-membrane translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_002490211.1"
                     /db_xref="GI:220914903"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:7295881"
                     /translation="MIFGVPLQALFGQLLLGLINGSFYAILSLGLAIIFGLLNIINFT
                     HGAQYMMGAFVAWMLLNYAGIGYWWALLLAPLAVGLFGVILERLLIARLYKLDHLYGL
                     LLTFGLALIIQGLFRNQYGVSGLPYAIPAELSGGQRLPFMFLPNYRGWVVVASLVVCL
                     ATWLVIEKTKLGAYLRAATENPTLVQAFGVNVPLLLTLTYGFGVALAAFAGVLAAPVY
                     SVNPNMGADIIIVVFAVVVIGGMGSILGSIVTGFTLGLVEGLTKVFYPEASSTVIFVI
                     MVLVLLVKPAGLFGRTA"
     misc_feature    277607..278425
                     /locus_tag="Mnod_8052"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivH
                     and related proteins. LivH is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivH_like;
                     cd06582"
                     /db_xref="CDD:119324"
     misc_feature    278105..278161
                     /locus_tag="Mnod_8052"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119324"
     gene            278483..279478
                     /locus_tag="Mnod_8053"
                     /db_xref="GeneID:7295882"
     CDS             278483..279478
                     /locus_tag="Mnod_8053"
                     /inference="protein motif:PFAM:PF02653"
                     /note="PFAM: inner-membrane translocator;
                     KEGG: met:M446_3242 inner-membrane translocator"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_002490212.1"
                     /db_xref="GI:220914904"
                     /db_xref="InterPro:IPR001851"
                     /db_xref="GeneID:7295882"
                     /translation="MAHSAATAPDDATPIASALPEGRDTKALHRLVFIGIAVALAVLP
                     LILYPVFLMKVLCFALFALAFNLLLGYGGLLSFGHAAYFGMASYIAAYGAKVWGLSPE
                     LAILAGTLTAALLGLVFGALAIRRQGIYFSMITLALAQMVFFFSLQAAFTGGEDGIQA
                     VPRGQLFGVISLADDRVLYALVALIFFLGLLLIYRIIHSPFGQVLKAIRDNEPRAVSL
                     GYRASQYKLAVFVLSTTLAGLAGATKAIVFQLASLTDVHWSMSGEVVLMTLVGGMGTV
                     FGPIIGAFVIVAMENYLAQFGAWVTIIQGVVFVICVILFREGIVGLCARMLKKPL"
     misc_feature    278708..279445
                     /locus_tag="Mnod_8053"
                     /note="Transmembrane subunit (TM) of Escherichia coli LivM
                     and related proteins. LivM is one of two TMs of the E.
                     coli LIV-1/LS transporter, a Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette (ABC) transporter
                     involved in the uptake of...; Region: TM_PBP1_LivM_like;
                     cd06581"
                     /db_xref="CDD:119323"
     misc_feature    279119..279175
                     /locus_tag="Mnod_8053"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119323"
     gene            complement(279566..279798)
                     /locus_tag="Mnod_8054"
                     /pseudo
                     /db_xref="GeneID:7295883"
     gene            complement(279974..280726)
                     /locus_tag="Mnod_8055"
                     /db_xref="GeneID:7295884"
     CDS             complement(279974..280726)
                     /locus_tag="Mnod_8055"
                     /inference="protein motif:PFAM:PF07729"
                     /note="PFAM: regulatory protein GntR HTH; GntR domain
                     protein;
                     KEGG: har:HEAR0087 GntR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002490213.1"
                     /db_xref="GI:220914905"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="GeneID:7295884"
                     /translation="MNYIAGKPPAVRPARRSKKPNHKGASAAPLDPVEQGEIQDLSLA
                     EQAYHQLEELITTLALPPGTVLAEQGLAQRLQIGRTPIREALQRLARDGLVVVIPRRG
                     ILVSEINLRTQLRLLETRRVLEHLIARLAAERATAEERRAFAEIAANMRAAADAADDI
                     AFMRLDRQFNELAAAASRNEFAVRSLNSMAALSRRFWYQHYKEAADLPLAANLHAEVC
                     EAIAKRDVKAAGEASDRLMDYIDSFARKTLDT"
     misc_feature    complement(279980..280636)
                     /locus_tag="Mnod_8055"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    complement(280409..280603)
                     /locus_tag="Mnod_8055"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(280418..280429,280433..280438,
                     280466..280468,280475..280480,280484..280498,
                     280520..280525,280595..280597,280601..280603))
                     /locus_tag="Mnod_8055"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(280013..280381)
                     /locus_tag="Mnod_8055"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            280950..282305
                     /locus_tag="Mnod_8056"
                     /db_xref="GeneID:7295885"
     CDS             280950..282305
                     /locus_tag="Mnod_8056"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: General substrate transporter; major
                     facilitator superfamily MFS_1;
                     KEGG: cti:RALTA_B1865  transporter, major facilitator
                     superfamily (MFS_1)"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_002490214.1"
                     /db_xref="GI:220914906"
                     /db_xref="InterPro:IPR005828"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:7295885"
                     /translation="MAGQGSAAMVAARLERLPMTGFQRTIFIIIATAWFFDSIDLGSL
                     TFLLGSIRTEFGLSTAQAGLLSSMSFVGMFLGAGISGMLADRFGRKLVFQVSMIFWGL
                     GSVWCAYAPDSTALGYARLLLGFGMGMEFPVALAIVSEFLPSAKRGRYLAVLEGFWPL
                     GFIAAGLLSLVLLSTFGWRAVFLAQAVPALFLFVVRMFVPESPRWLADRGRFDEANRV
                     LADIEAKVRARLDGRPLPEPQPLPAQAQGERRFSFLELWSSGYASRTVMIWLTWFFAL
                     LGFYGLTTWLGALLQEAGHSVTKSVSYTILISLAGVPGFISSALLVEGWGRKPTAVLM
                     LLGSAIAAYLYGHSPSFGWLIAFGLVMQFFLFGMWSVLYAYTPELYPTRARATGAGCA
                     SAIGRVGSLLGPYAIGVILPVLGQGGVFALGGGSFVIAAAAVAILGVETKGKSLEAIS
                     H"
     misc_feature    280974..282182
                     /locus_tag="Mnod_8056"
                     /note="benzoate transport; Region: 2A0115; TIGR00895"
                     /db_xref="CDD:233175"
     misc_feature    281028..282224
                     /locus_tag="Mnod_8056"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(281070..281072,281079..281087,281091..281096,
                     281145..281147,281154..281159,281166..281168,
                     281178..281183,281187..281192,281328..281333,
                     281340..281345,281352..281357,281364..281366,
                     281400..281405,281412..281417,281433..281435,
                     281775..281777,281784..281789,281796..281801,
                     281808..281810,281850..281852,281859..281861,
                     281871..281873,281880..281882,281892..281894,
                     282033..282035,282042..282047,282054..282056,
                     282066..282071,282078..282080,282111..282116,
                     282123..282128,282135..282140,282147..282149)
                     /locus_tag="Mnod_8056"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            282595..283386
                     /locus_tag="Mnod_8057"
                     /db_xref="GeneID:7295886"
     CDS             282595..283386
                     /locus_tag="Mnod_8057"
                     /inference="similar to AA sequence:KEGG:HEAR0086"
                     /note="KEGG: har:HEAR0086  membrane protein with
                     short-chain dehydrogenase/reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein with short-chain
                     dehydrogenase/reductase"
                     /protein_id="YP_002490215.1"
                     /db_xref="GI:220914907"
                     /db_xref="GeneID:7295886"
                     /translation="MELAVTNMSERQRNYRANYRQRVAGWYNGFLHIAIIYTIGLTAL
                     YIYISNLHSVTWLEWLTVPVVFLFCNFFEWWLHRYVMHRPSNNPIARAVYNRHTLQHH
                     QFFTDHEMRFADHRDYRVTFFPPYALATFTLMSVPGAIVLGNLFTPNVGWLFITTTTS
                     IYLIYEFMHFCCHVDENWFVRNMPLINTNRRHHTAHHDQSIMMERNMNLTFPIMDWLF
                     GTSDLDRGLLGTLFNGYDTRFVKKDMRKTSRTPGAPAQGCMQPAE"
     misc_feature    <282769..283254
                     /locus_tag="Mnod_8057"
                     /note="Sterol desaturase [Lipid metabolism]; Region: ERG3;
                     COG3000"
                     /db_xref="CDD:225546"
     gene            283612..283998
                     /locus_tag="Mnod_8058"
                     /db_xref="GeneID:7295887"
     CDS             283612..283998
                     /locus_tag="Mnod_8058"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: pto:PTO1267 transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490216.1"
                     /db_xref="GI:220914908"
                     /db_xref="GeneID:7295887"
                     /translation="MDMVEPNVVALLWFTIFAGVTCLGFYVLTGAFPLETRPDLKRPL
                     GLALLSINLLLLVALGAGSVAYGVEHLRWTSLVIVGGFAFLFAPGLFNVWPTKWRDGQ
                     AGLAIVLAGFGATLGALQAVGNVFSL"
     gene            284024..284245
                     /locus_tag="Mnod_8059"
                     /db_xref="GeneID:7295888"
     CDS             284024..284245
                     /locus_tag="Mnod_8059"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490217.1"
                     /db_xref="GI:220914909"
                     /db_xref="GeneID:7295888"
                     /translation="MPFRIKFGLSIAVALAAVAGWFYMGYLGQIGPQRAVAFLGPFMV
                     FSLWIFPEVMRNRSDGRTPRHQLSGARRS"
     sig_peptide     284024..284083
                     /locus_tag="Mnod_8059"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.782 at
                     residue 20"
     gene            284242..284532
                     /locus_tag="Mnod_8060"
                     /db_xref="GeneID:7295889"
     CDS             284242..284532
                     /locus_tag="Mnod_8060"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hsl:OE6255R hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490218.1"
                     /db_xref="GI:220914910"
                     /db_xref="GeneID:7295889"
                     /translation="MKVYTGDRTIDGIVVTVDGEPLDDQTSTKCYSRNGFEWSYEGPE
                     PSQLAYAILVDHLGDPAEAARLQDGFMRTVVANFQNEWEMTSADIDRVLRTL"
     gene            284591..285502
                     /locus_tag="Mnod_8061"
                     /db_xref="GeneID:7295890"
     CDS             284591..285502
                     /locus_tag="Mnod_8061"
                     /EC_number="2.1.2.11"
                     /inference="protein motif:TFAM:TIGR00222"
                     /note="TIGRFAM: 3-methyl-2-oxobutanoate
                     hydroxymethyltransferase;
                     PFAM: Ketopantoate hydroxymethyltransferase;
                     KEGG: mpt:Mpe_A0783 3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyl-2-oxobutanoate
                     hydroxymethyltransferase"
                     /protein_id="YP_002490219.1"
                     /db_xref="GI:220914911"
                     /db_xref="InterPro:IPR003700"
                     /db_xref="GeneID:7295890"
                     /translation="MGATTTASVKALAADGAGRREKRTITDIRNSKRTGEKMVYMSVP
                     DYTSARWAEMAGVDVAVVGDSLAMVAHGHPSTIPATMDMMVLHAQAVRRGTPNTFVLG
                     CMPYQSYNTVERALTNATRFMQDALCDAVKPQGGRSQAHILKALVDAGIPTASHIGLT
                     PHTIATFGGFKIQGRTAEAAMKILEDALAIEDAGCFMLEFEAVPAPIAKLISEQLSIP
                     TIGIGAGAGCDGQILLAYDLLGVFIDFKPKFTKRYANLTEVAVTGIRSYVEEVKTGAF
                     PDDDHSYKVDPAEYERFASLVEKRRHI"
     misc_feature    284663..285421
                     /locus_tag="Mnod_8061"
                     /note="Ketopantoate hydroxymethyltransferase (KPHMT) is
                     the first enzyme in the pantothenate biosynthesis pathway.
                     Ketopantoate hydroxymethyltransferase (KPHMT) catalyzes
                     the first committed step in the biosynthesis of
                     pantothenate (vitamin B5), which is a...; Region:
                     KPHMT-like; cd06557"
                     /db_xref="CDD:119342"
     misc_feature    order(284663..284668,284723..284734,284741..284743,
                     284786..284788,284792..284809,284819..284824,
                     284837..284839,284846..284851,284858..284860,
                     284867..284869,284906..284911,284936..284938,
                     284948..284950,284957..284962,284975..284977,
                     285029..285046,285074..285079,285083..285094,
                     285176..285178,285296..285298,285305..285310,
                     285350..285352,285359..285373)
                     /locus_tag="Mnod_8061"
                     /note="oligomerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:119342"
     misc_feature    order(284714..284716,284771..284773,284777..284785,
                     284897..284899,284984..284986,285056..285058,
                     285071..285073,285191..285193,285284..285286,
                     285290..285292)
                     /locus_tag="Mnod_8061"
                     /note="active site"
                     /db_xref="CDD:119342"
     misc_feature    order(284780..284782,284897..284899,284984..284986)
                     /locus_tag="Mnod_8061"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119342"
     gene            285586..285717
                     /locus_tag="Mnod_8062"
                     /pseudo
                     /db_xref="GeneID:7295891"
     gene            complement(285905..286096)
                     /locus_tag="Mnod_8063"
                     /db_xref="GeneID:7295892"
     CDS             complement(285905..286096)
                     /locus_tag="Mnod_8063"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490220.1"
                     /db_xref="GI:220914912"
                     /db_xref="GeneID:7295892"
                     /translation="MRQERIQFGPDLSKPLSLVPDLYLGLLKGLAEPCCFGHDRVRAL
                     DQGGVLDAHGDTYPPDYHP"
     gene            complement(286128..286394)
                     /locus_tag="Mnod_8064"
                     /db_xref="GeneID:7295893"
     CDS             complement(286128..286394)
                     /locus_tag="Mnod_8064"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: reu:Reut_B5131 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490221.1"
                     /db_xref="GI:220914913"
                     /db_xref="GeneID:7295893"
                     /translation="MTDYLQQEQEDLIQADRHLAAGEKRVIEQIVLLQRMTEKGYDTA
                     TGKDLLRLLEETMVIWQDHRQLILDAIARHERAISHSPQADPGP"
     gene            complement(286622..287392)
                     /locus_tag="Mnod_8065"
                     /db_xref="GeneID:7295894"
     CDS             complement(286622..287392)
                     /locus_tag="Mnod_8065"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: Methyltransferase type 11; Methyltransferase
                     type 12;
                     KEGG: mrd:Mrad2831_5097 methyltransferase type 11"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_002490222.1"
                     /db_xref="GI:220914914"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:7295894"
                     /translation="MADIHRAASEGFSAGADAYAAGRPNYPAQIVPWLCAELRLGPGR
                     VALDLGSGTGKLLPSLRETGARLIAVEPVAAMRDRLVRDHPDVQALDGRAEAIPLPDA
                     CVDAVVCAQAFHWFATPEALAEIARVLRPGGALGLIWNIRDERVGWVAALSEIMSRHE
                     GDVPHFHSGAWRRLFPAAGFGPLRETRVPHRHVGPPEAVILDRTLSVSFIAALPDAAR
                     AAVAAEVRALIAATPALAGRDEVVVPYETAAFACTRLG"
     misc_feature    complement(286988..287254)
                     /locus_tag="Mnod_8065"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(287063..287065,287111..287119,
                     287177..287182,287228..287248))
                     /locus_tag="Mnod_8065"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            287912..288170
                     /locus_tag="Mnod_8066"
                     /pseudo
                     /db_xref="GeneID:7295895"
     gene            288302..288469
                     /locus_tag="Mnod_8067"
                     /db_xref="GeneID:7295896"
     CDS             288302..288469
                     /locus_tag="Mnod_8067"
                     /inference="similar to AA sequence:KEGG:M446_3973"
                     /note="KEGG: met:M446_3973 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490223.1"
                     /db_xref="GI:220914915"
                     /db_xref="GeneID:7295896"
                     /translation="MPNTPIIGELYKLKHVTDQQIDAAIRDYLNDPMPGMRPIRLSRL
                     IAVSSSAPFHS"
     gene            288837..289862
                     /locus_tag="Mnod_8068"
                     /db_xref="GeneID:7295897"
     CDS             288837..289862
                     /locus_tag="Mnod_8068"
                     /inference="similar to AA sequence:KEGG:M446_1191"
                     /note="KEGG: met:M446_1191 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490224.1"
                     /db_xref="GI:220914916"
                     /db_xref="GeneID:7295897"
                     /translation="MKQLARHQVGGILLAALGSLAAPAQAAEGGFSFYIEGLAVPDAG
                     VLPPPGVYFDSSTYFYNGKIGGNRSTQLGGNVVADVKANIVADFATGLWVTPAEILGG
                     NLAFAFVMPFGTPAVRAGALLNGPLVNQVVGRPVGVSVSDATFNAGDPIVGTSLGWHS
                     GNWHWKVAGLLSIPAGAYEPGQLSNIALNRYIGDISAAATYLDPALGIELSAAAGFTL
                     NGKNPATQYVTGHEFHVEVSASKNLTKELSIGVIASHYQQITGDSGSGARLGPFKGRV
                     TAVGGMAGLTVPVGQIPVTARMKVLREVEVENRFQGTLGFLEVSFPLWVAPPKAAPET
                     KPVVAKF"
     sig_peptide     288837..288917
                     /locus_tag="Mnod_8068"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 27"
     misc_feature    289053..289775
                     /locus_tag="Mnod_8068"
                     /note="Putative MetA-pathway of phenol degradation;
                     Region: Phenol_MetA_deg; pfam13557"
                     /db_xref="CDD:257874"
     gene            290113..291087
                     /locus_tag="Mnod_8069"
                     /db_xref="GeneID:7295898"
     CDS             290113..291087
                     /locus_tag="Mnod_8069"
                     /inference="protein motif:PFAM:PF03781"
                     /note="PFAM: protein of unknown function DUF323;
                     KEGG: met:M446_1197 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490225.1"
                     /db_xref="GI:220914917"
                     /db_xref="InterPro:IPR005532"
                     /db_xref="GeneID:7295898"
                     /translation="MAEAPVLDRPADSPDLLAGMVFVAGGTFRMGSDRHYPEEAPVHR
                     VSVDGFWIDRTPVTNAQFRAFVRATGHVTMAERKPKAEDYPGALPHMLQAGSLVFKPP
                     KGAVDLRDWSAWWRFRFGASWRRPLGPGSSIAGLDDHPVVHVAYADAEAYARWAGKEL
                     PTEAEWEYAARGGLDGAEFAWGDEFTPGGRHMANTWQGAFPHQNLAEDGFERTSPVTT
                     FPPNGYGLHDMIGNVWEWTTDFYAPKHPTDAPKACCIPQNPRGGQEKGSYDPAQPAIR
                     IPRRVVKGGSHLCAPNYCRRYRPAARHPHPVDTSTSHIGFRCVVRRGP"
     misc_feature    290140..291081
                     /locus_tag="Mnod_8069"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1262"
                     /db_xref="CDD:224182"
     misc_feature    290161..291069
                     /locus_tag="Mnod_8069"
                     /note="Sulfatase-modifying factor enzyme 1; Region:
                     FGE-sulfatase; pfam03781"
                     /db_xref="CDD:252159"
     gene            291084..292757
                     /locus_tag="Mnod_8070"
                     /db_xref="GeneID:7295899"
     CDS             291084..292757
                     /locus_tag="Mnod_8070"
                     /inference="protein motif:PFAM:PF00884"
                     /note="PFAM: sulfatase;
                     KEGG: met:M446_1195 sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_002490226.1"
                     /db_xref="GI:220914918"
                     /db_xref="InterPro:IPR000215"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:7295899"
                     /translation="MTDPLPSNAALDEEAAAKTISRRRMLLGGTALAASVAGTAPTIA
                     QAQQPAPAPQPAPVRTGATGRPVNILVMFGDDIGQSNISAYTFGLMGYRTPNIDRIAR
                     EGMMFTDYYAEQSCTAGRSSFITGQSTLRTGLSKVGLPGATVGLQKEDPTLAELLKPL
                     GYATGQFGKNHLGDRDEYLPTNHGFDEFFGNLYHLNAEEEPEQRTYPRDPEFRKRFGP
                     RGVIRSSADGKIEDTGPLTKKRMETIDDETSAAAMDFIERQVRANKPFFCWFNATRMH
                     LRTHVAENHRSPPGLTARTEYADGMVEHDGHIGQLLKKLDDLGIANDTIVLYTTDNGP
                     HMNSWPDSAMTPFRSEKDTNWEGAFRVPCMIRWPGHIQAGSVSNEIVSGLDWVPTLVA
                     AAGDPNIVDKLLKGHTAGAKSFKVHLDGYNQLPYLTGQQDRGARKGFFYFNDDGDLVG
                     MRYENWKIVFEEQRAPGTMRIWAEPFTPLRVPKLFDLRADPYERADITSNTYYDWLIS
                     NVYVLVPAQAEVAKFLDTFREFPPRQRAASFSVDQIVEKMKRATEVPSR"
     sig_peptide     291084..291224
                     /locus_tag="Mnod_8070"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.811) with cleavage site probability 0.766 at
                     residue 47"
     misc_feature    291267..292571
                     /locus_tag="Mnod_8070"
                     /note="Arylsulfatase A and related enzymes [Inorganic ion
                     transport and metabolism]; Region: AslA; COG3119"
                     /db_xref="CDD:225661"
     misc_feature    291285..292268
                     /locus_tag="Mnod_8070"
                     /note="Sulfatase; Region: Sulfatase; pfam00884"
                     /db_xref="CDD:250201"
     misc_feature    292398..>292679
                     /locus_tag="Mnod_8070"
                     /note="C-terminal region of aryl-sulfatase; Region:
                     Sulfatase_C; pfam14707"
                     /db_xref="CDD:258845"
     gene            292820..293860
                     /locus_tag="Mnod_8071"
                     /db_xref="GeneID:7295900"
     CDS             292820..293860
                     /locus_tag="Mnod_8071"
                     /inference="similar to AA sequence:KEGG:M446_1196"
                     /note="KEGG: met:M446_1196 NapD-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="NapD-like protein"
                     /protein_id="YP_002490227.1"
                     /db_xref="GI:220914919"
                     /db_xref="GeneID:7295900"
                     /translation="MPVQAGSVSRRAMLSGVATLVAAPGILRAGAAEGRADPLPSWNE
                     GGPKQAILDFVGRVTTSGGHDFVPPPERVAVFDNDGTLWAEQPVYFQVAFALDRVKAL
                     APAHPEWKDTQPFKGVIENDPKAVAAAGEKGLLQIVAATHAGMTTAEFDAVVKEWLRT
                     ARHPRFGRPYDSLVYQPMLELLGFLRASGFKTFIVSGGGVEFMRTFAERTYGIPPEQV
                     VGSSGVTKFEIRPDGQPVLVKEAKVEFVDDGAGKPSGINRFIGRRPILAFGNSDGDQQ
                     MLEWTAAGAGPRFLGLVHHTDGEREYAYDRQSHVGQLDKALDEAAERGWVVVDVARDW
                     KSVFSAEPRTNR"
     sig_peptide     292820..292915
                     /locus_tag="Mnod_8071"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.894) with cleavage site probability 0.450 at
                     residue 32"
     misc_feature    293033..293569
                     /locus_tag="Mnod_8071"
                     /note="haloacid dehalogenase-like hydrolase; Region:
                     Hydrolase; pfam00702"
                     /db_xref="CDD:250068"
     misc_feature    293036..>293485
                     /locus_tag="Mnod_8071"
                     /note="haloacid dehalogenase-like hydrolase; Region: HAD;
                     cl19137"
                     /db_xref="CDD:267490"
     misc_feature    293306..293677
                     /locus_tag="Mnod_8071"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    293405..293407
                     /locus_tag="Mnod_8071"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            293874..294482
                     /locus_tag="Mnod_8072"
                     /db_xref="GeneID:7295901"
     CDS             293874..294482
                     /locus_tag="Mnod_8072"
                     /inference="similar to AA sequence:KEGG:VFMJ11_A0416"
                     /note="KEGG: vfm:VFMJ11_A0416 fusaric acid resistance
                     protein FusE"
                     /codon_start=1
                     /transl_table=11
                     /product="fusaric acid resistance protein FusE"
                     /protein_id="YP_002490228.1"
                     /db_xref="GI:220914920"
                     /db_xref="GeneID:7295901"
                     /translation="MASQPEPVMLPEARQAGVKALLDSQIGGENATVAQLRAQLGDAE
                     WELARTSIRAPADRYVTLSALAVGDRVTPMRSMMSFLIADDIVLLGVFQQNGLKTVIP
                     GAKVRLVLANDPGRIHDAKVLRVGRGVGQGQLSATGTLARIGAVGLTAEFPVEIELPR
                     DLDRNLLRPGMSGAATAFSPDAGPIGVIASILLWVSAYMAYL"
     misc_feature    <293907..294389
                     /locus_tag="Mnod_8072"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     gene            complement(294807..296189)
                     /locus_tag="Mnod_8073"
                     /db_xref="GeneID:7295902"
     CDS             complement(294807..296189)
                     /locus_tag="Mnod_8073"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_0557 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490229.1"
                     /db_xref="GI:220914921"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295902"
                     /translation="MMGPRQVEQGALFYEFSLDTHVPADHLLRAIDRFVDLSGLRAHL
                     RPFYSTTGRPSVDPELMVRMLLVGYCFGIRSERRLCEEVHLNLAYRWFCRLGLDGAVP
                     DHSTFSKNRHGRFRDSDLLREVFETTVQRCIEEGLVGGEGFAVDASLIRADANKQRSA
                     DASEAVDWNDLARIRRSVREYLDTLDEAAWGAASEVQPKFVSRSDPAAQWTGALKGHA
                     FFAYATNYLIDLDHAVIVDVEASRAIRQAEVGAARTMIARAQDRFGLWPARLAADSAY
                     GSAEQLAWLVHERGIEPHIPVFDKSERRDGTFSRSAFTYDPAADAYTCPAGHPLRPRQ
                     KVYRTPFPLVDDDGMMRYRASKRDCDACALKPRCCPTTPARKIPRSIHEGARQMARDI
                     CASEEGRTSRRERKKVEMLFAHLKRILKLDRLRLRGPNGARDEFHLAAAAQNLRKLAQ
                     LIPLQQLSPA"
     misc_feature    complement(295713..296189)
                     /locus_tag="Mnod_8073"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    complement(294855..295595)
                     /locus_tag="Mnod_8073"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(294843..295223)
                     /locus_tag="Mnod_8073"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            296366..297136
                     /locus_tag="Mnod_8074"
                     /db_xref="GeneID:7295903"
     CDS             296366..297136
                     /locus_tag="Mnod_8074"
                     /inference="protein motif:TFAM:TIGR01458"
                     /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
                     like protein; HAD-superfamily hydrolase, subfamily IIA;
                     PFAM: Haloacid dehalogenase domain protein hydrolase;
                     KEGG: aeh:Mlg_2555 HAD family hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="HAD-superfamily hydrolase"
                     /protein_id="YP_002490230.1"
                     /db_xref="GI:220914922"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006355"
                     /db_xref="InterPro:IPR006357"
                     /db_xref="GeneID:7295903"
                     /translation="MVKITGVLLDLSGVVFSGDEAIGDAVASIKDLRTNGIPFRFVTN
                     TTSKPVRTLAEKLRRLGIDASEEDIFTPASAARKLVHERGLSPYLVVHPDLLEDLDVP
                     SGRNPDAVIVGDAGQTFSYDVLNTAFRLINGGAAFIALARNRTFRDADGQLSLDAGPF
                     VVALEFATRSEAFLVGKPSASFYAAAIADLGTPACETAMIGDDAESDVAGALELGMAG
                     LLVRTGKYKDGDEFRIDRKPTATVPDLRRAVNWVLDRM"
     misc_feature    296375..297127
                     /locus_tag="Mnod_8074"
                     /note="HAD-superfamily subfamily IIA hydrolase, TIGR01458;
                     Region: HAD-SF-IIA-hyp3"
                     /db_xref="CDD:162372"
     misc_feature    296384..296707
                     /locus_tag="Mnod_8074"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(296393..296401,296492..296497)
                     /locus_tag="Mnod_8074"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    296393..296410
                     /locus_tag="Mnod_8074"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    296492..296494
                     /locus_tag="Mnod_8074"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    296891..297109
                     /locus_tag="Mnod_8074"
                     /note="HAD-hyrolase-like; Region: Hydrolase_like;
                     pfam13242"
                     /db_xref="CDD:257599"
     gene            complement(297207..297503)
                     /locus_tag="Mnod_8075"
                     /pseudo
                     /db_xref="GeneID:7295904"
     gene            297970..299070
                     /locus_tag="Mnod_8076"
                     /db_xref="GeneID:7295905"
     CDS             297970..299070
                     /locus_tag="Mnod_8076"
                     /inference="similar to AA sequence:KEGG:M446_6102"
                     /note="KEGG: met:M446_6102 ABC-type multidrug transport
                     system ATPase and permease components-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug ABC transporter ATPase/permease-like
                     protein"
                     /protein_id="YP_002490231.1"
                     /db_xref="GI:220914923"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:7295905"
                     /translation="MSTIRNVRPADGPSEAGGAQEPPMSSDSDYGDAVCTPPDLLSFI
                     LRESAAAQLWLAILVIAVFLAGVAPLEIQRRAVSQAVKGADPHALLWLAALYALAACG
                     LGLLKLVLNITRGFVSERAVRRLRASIMEDFHRSAEGRRLAQTRGVEIALVLDEAEPV
                     GGFVGVCFSEPLLQTGVLLTTLGYLAFLNPLMALLTLAVFSPQLVFVPLMQRAINRRV
                     SARISLLRRISGGLVGERSGSGALTAAEADQLQGVFLLNMGIFRIKFSMNFLMNMSYH
                     LGVAGILGVGGYAVTTGDTEVSTVVAFVAGLSHMNDPWGDLVNWFRECSVTRTKYALI
                     ARATEAAAGRQEAGRTDYRSSLDTSGGHPCVG"
     misc_feature    298126..>298938
                     /locus_tag="Mnod_8076"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     gene            complement(299142..300722)
                     /locus_tag="Mnod_8077"
                     /db_xref="GeneID:7295906"
     CDS             complement(299142..300722)
                     /locus_tag="Mnod_8077"
                     /inference="protein motif:PFAM:PF01636"
                     /note="PFAM: aminoglycoside phosphotransferase;
                     KEGG: met:M446_6097 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoglycoside phosphotransferase"
                     /protein_id="YP_002490232.1"
                     /db_xref="GI:220914924"
                     /db_xref="InterPro:IPR002575"
                     /db_xref="GeneID:7295906"
                     /translation="MPDESQSETVDFLRRCLAGHGRLETIRTHISVVLLAEDRVYKLK
                     RAVRFPFVDFSAPEARLAACEAELALNRRTAPALYRGVHRITRTPDGGLALDGTGPLV
                     DAVVAMRRFPQGDLFDAMTREGRLTPALVAALAHRIAAFHAAAEISRAPGGAAAMAAL
                     VALNDRGLRACGLASAGEADALTARFEAALARHGDRLEARRAAGKVRRCHGDLTLRNI
                     CLYEGVPTPFDCLEFDEALATIDVLYDLAFVLMDLWHRGRRDLANLLFNRYLDESDEA
                     DGAGLLPFLMAIRAVIRAHVTATQAAEAPGETARALRDEARAYLDLAGTLLAEEPATL
                     VAVGGLSGSGKSTFAAALAPWLGAPPGARIVSSDRTRKRLHGVSAVTRLSDSAYAPSV
                     SERVYAAMRDEAARVLATGGAVILDAVFDRPEAREAVEALARRCGVPFRGVWLQAPAA
                     MLAARIRARRDDPSDATIEVLAAQASRDCGPMTWHCLDAQLPAETLRATILASCGTGE
                     AKAEASRGGTAGTEVLPA"
     misc_feature    complement(299739..300722)
                     /locus_tag="Mnod_8077"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     misc_feature    complement(299268..299729)
                     /locus_tag="Mnod_8077"
                     /note="Predicted kinase [General function prediction
                     only]; Region: COG0645"
                     /db_xref="CDD:223718"
     misc_feature    complement(299292..299723)
                     /locus_tag="Mnod_8077"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     gene            complement(300749..303328)
                     /locus_tag="Mnod_8078"
                     /db_xref="GeneID:7295907"
     CDS             complement(300749..303328)
                     /locus_tag="Mnod_8078"
                     /inference="protein motif:TFAM:TIGR01524"
                     /note="TIGRFAM: ATPase, P-type (transporting), HAD
                     superfamily, subfamily IC; magnesium-translocating P-type
                     ATPase;
                     PFAM: cation transporting ATPase domain protein; Haloacid
                     dehalogenase domain protein hydrolase; E1-E2
                     ATPase-associated domain protein;
                     KEGG: met:M446_6096 magnesium-translocating P-type ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-translocating P-type ATPase"
                     /protein_id="YP_002490233.1"
                     /db_xref="GI:220914925"
                     /db_xref="InterPro:IPR000695"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR006415"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="GeneID:7295907"
                     /translation="MRPNAIDGTPPGSGAVFWACTPEALAARLECRLDGLTSAEAARR
                     LQRYGPNSDGPARSGGTARAILRRLLEPLSLILLAAGCVSIGTGDWAGGGIIIAILVL
                     SIGLDTFQEGHAVRAAEALRRAVALKADAKRDGIFRTVPVDQIVPGDVIRVRAGDIVA
                     ADALVLESTVFAAVEAALTGEPYPVEKRPGPVAAESPAEAANALFRGAVAQSGEAVAL
                     VAATGRATVFGAAAAALAESAAPSPFQRDLREFGLVVARLTLVLVVAVLALRVALGRP
                     VLDSLLFAVALAVGLTPELLPMITTVTLARGALRMAKRRVIVKRLTGIHDLGAMTVLC
                     TDKTGTLTSAEIALARSLDPAGGADPLPARLGAIAAGLGGDRSALDAALIRSVPEAAE
                     GWRLAGRRPFDYARRTGAVVAEGPDGPLLIVKGAPEAVLALCTAQRSGRQAIPMDAAE
                     RDRALARQVRALAEEGLRSIAVASRPVPGAADAAEEGLVFEGFCAFADPPKPTAAAAV
                     ADLAAAGVRVKILSGDDPVVVRRLAGLVGLTSHRILTGPEIAALSDEALAVQVRGVDA
                     FGRLAPDQKARVVKALQADGQVVGFLGDGINDAPALRQADIGLSVEGATGVAQAAADM
                     ILLASDLEVVAAGVDEGRRTFANILKYIRMGASSNFGNMLSMAAASAALPFLPMLPTQ
                     ILLNNLLYDLSEVGIPFDRVDAEATARPQAWDMAALLRFAAVMGPLSSLFDLLTFGVL
                     LLSFGASPEVFRTAWFLESMATQILVIFVIRSRGRPWRDRPSAALAASSLAALTVALG
                     VPFSPLGPWFGFEAPQPMILAAIGIITVAYLAAAEAVKPWAIRARSRPPRRARAGAQA
                     NLV"
     misc_feature    complement(<303176..303280)
                     /locus_tag="Mnod_8078"
                     /note="Cation transporter/ATPase, N-terminus; Region:
                     Cation_ATPase_N; pfam00690"
                     /db_xref="CDD:250059"
     misc_feature    complement(300809..303274)
                     /locus_tag="Mnod_8078"
                     /note="magnesium-transporting ATPase MgtA; Provisional;
                     Region: PRK10517"
                     /db_xref="CDD:236705"
     misc_feature    complement(302357..303046)
                     /locus_tag="Mnod_8078"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    complement(302024..>302128)
                     /locus_tag="Mnod_8078"
                     /note="Putative hydrolase of sodium-potassium ATPase alpha
                     subunit; Region: Hydrolase_like2; pfam13246"
                     /db_xref="CDD:257602"
     misc_feature    complement(301451..>301783)
                     /locus_tag="Mnod_8078"
                     /note="Soluble P-type ATPase [General function prediction
                     only]; Region: COG4087"
                     /db_xref="CDD:226572"
     misc_feature    complement(300821..301306)
                     /locus_tag="Mnod_8078"
                     /note="Cation transporting ATPase, C-terminus; Region:
                     Cation_ATPase_C; pfam00689"
                     /db_xref="CDD:250058"
     gene            303804..306653
                     /locus_tag="Mnod_8079"
                     /db_xref="GeneID:7295908"
     CDS             303804..306653
                     /locus_tag="Mnod_8079"
                     /inference="protein motif:PFAM:PF00501"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     phospholipid/glycerol acyltransferase;
                     KEGG: met:M446_2875 AMP-dependent synthetase and ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase/ligase"
                     /protein_id="YP_002490234.1"
                     /db_xref="GI:220914926"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR001220"
                     /db_xref="InterPro:IPR002123"
                     /db_xref="InterPro:IPR006163"
                     /db_xref="GeneID:7295908"
                     /translation="MRDEALHPSSATEPGQQPGAASLLDVIRSLLRELHPERRRPLAV
                     DLDSDLERDLALDSLGRAELLLRLSRAFRVTLPDRLIGEAATPADLLAAVQAAGAARC
                     PGATFPRDEALSPAAEPHGAATLPEVLAFHVRRNPDRPHLRLWQGPDHETIVTYAALD
                     DAARRVAGGLLEAGLAAGGRVAIMLPTGPDFFPAFFGVLLAGGIPVPLYPPFRRAQIQ
                     DHLQRQARILSNAAPEILITDGEIKPFARLLPGLVESLRTLTTVEELATAAPLAATVP
                     ATGTTVALIQYTSGSTGDPKGVTLTHANLLANIRAIGEALGATSADVVVSWLPLYHDM
                     GLIGCWLGSLYFGAPAVIMPPLSFLADPGRWLRAIHRHRATISAAPNFAYELCLKTLR
                     DEDLAGLDLGSLRVLTNGAEPVSSDTLSRFAQRFTAFGLRPSALTPVYGLAECAVGLA
                     FPPPGRGPLIDWIDRTALSRQGEARPAAPGNAKSIAFAACGRPLRGHQIRIVDEAGRE
                     VPERVEGRLQFRGPSATAGYFRNPEKTQALFDGEWLESGDLAYEAGGDVFITGRLKDI
                     VIRAGRKIHPHELEEVAGSVPGVRKGCVAAFASPDPKTGTERLILVAETRLTDASARA
                     GLRRTLAEAAAGVLDQPPDDILLCPPHTVPKTSSGKIRRAAARALYESGGLDRPDSIR
                     AQVAGLALAGIGARLRRIARLAREAGYAAQWWAVLVGLGIVLWPVVIMLPRRAWRHAA
                     LRAGLRAFFRLTGTPVLVEGGTATPPAIIAANHASYLDAAVLAAVLPGTPVFLAKHEL
                     AGQAVAGPFLRRLGTVFVHRGEAAGVSDADVVLDRIRAGEQIVAFPEGTFTRTPGLLG
                     FHLGAFMTACRAGVPVAPIAITGTRSLLRADQWFPRHGAIRVHLGQKIAPEGADFHAA
                     VRLRDAVRAAILARCGEPDLADEPVSLPAAPSAPG"
     misc_feature    303876..304073
                     /locus_tag="Mnod_8079"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:249951"
     misc_feature    304197..305816
                     /locus_tag="Mnod_8079"
                     /note="Fatty acyl-AMP ligase (FAAL); Region: FAAL;
                     cd05931"
                     /db_xref="CDD:213297"
     misc_feature    304245..305819
                     /locus_tag="Mnod_8079"
                     /note="long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK07768"
                     /db_xref="CDD:236091"
     misc_feature    order(304656..304658,304665..304682,304686..304691)
                     /locus_tag="Mnod_8079"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213297"
     misc_feature    order(304737..304739,304797..304805,305025..305027,
                     305034..305045,305118..305132,305145..305147,
                     305271..305273,305445..305447,305478..305480,
                     305487..305489)
                     /locus_tag="Mnod_8079"
                     /note="active site"
                     /db_xref="CDD:213297"
     misc_feature    306036..306569
                     /locus_tag="Mnod_8079"
                     /note="Lysophospholipid Acyltransferases (LPLATs) of
                     Glycerophospholipid Biosynthesis: AGPAT-like; Region:
                     LPLAT_AGPAT-like; cd07989"
                     /db_xref="CDD:153251"
     misc_feature    order(306120..306122,306129..306131,306135..306137,
                     306183..306194,306339..306347)
                     /locus_tag="Mnod_8079"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153251"
     gene            306657..306959
                     /locus_tag="Mnod_8080"
                     /db_xref="GeneID:7295909"
     CDS             306657..306959
                     /locus_tag="Mnod_8080"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_2876 AMP-dependent synthetase and
                     ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490235.1"
                     /db_xref="GI:220914927"
                     /db_xref="GeneID:7295909"
                     /translation="MAARNETGLCPPEPAEADAGQSPPPAGADRAAAGRHGPDGTAYV
                     AHDPRTDTFTEHSWAEMAGRVAARRAALACEGLHIPTLHTRLLAGVEALNGLLQIG"
     gene            307169..308080
                     /locus_tag="Mnod_8081"
                     /db_xref="GeneID:7295560"
     CDS             307169..308080
                     /locus_tag="Mnod_8081"
                     /inference="protein motif:PFAM:PF00149"
                     /note="PFAM: metallophosphoesterase;
                     KEGG: mca:MCA0198 Ser/Thr protein phosphatase family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_002490236.1"
                     /db_xref="GI:220914928"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="GeneID:7295560"
                     /translation="MRQRLGLERDYEAHVFRRGTHFFHLENWYSIHGLIRGALRLAGL
                     YGRGRRNALAIELRRNEVALPDLPPEFEGFTLLQLSDLHLDINTAFTAALIERVQGLN
                     YDLCVITGDYRARTFGPIAAALEGLRRLRPHLKSPVYAILGNHDTIRLVPPMEELGYA
                     LLLNEWVRIERGGAAIYLVGIDDAHFYRMENFHRAAHDIPARAVSILLSHTPEAYRHA
                     AHAGFDLMLCGHTHGGQICLPGGIPVLTDADSPRALARGPWRYHDLLGYTSVGAGTCI
                     VDVRVNCPPEVTLHRLRKKVDVRAENA"
     misc_feature    307385..308044
                     /locus_tag="Mnod_8081"
                     /note="Bacillus subtilis YkuE and related proteins,
                     C-terminal metallophosphatase domain; Region: MPP_YkuE_C;
                     cd07385"
                     /db_xref="CDD:163628"
     misc_feature    307388..>307606
                     /locus_tag="Mnod_8081"
                     /note="Predicted phosphohydrolases [General function
                     prediction only]; Region: Icc; COG1409"
                     /db_xref="CDD:224327"
     misc_feature    order(307409..307411,307415..307417,307499..307501,
                     307598..307603,307796..307798,307856..307858,
                     307862..307864)
                     /locus_tag="Mnod_8081"
                     /note="putative active site [active]"
                     /db_xref="CDD:163628"
     misc_feature    order(307409..307411,307415..307417,307499..307501,
                     307598..307600,307796..307798,307856..307858,
                     307862..307864)
                     /locus_tag="Mnod_8081"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:163628"
     gene            complement(308093..308584)
                     /locus_tag="Mnod_8082"
                     /db_xref="GeneID:7295642"
     CDS             complement(308093..308584)
                     /locus_tag="Mnod_8082"
                     /inference="protein motif:PFAM:PF01864"
                     /note="PFAM: protein of unknown function DUF46;
                     KEGG: mca:MCA0197 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490237.1"
                     /db_xref="GI:220914929"
                     /db_xref="InterPro:IPR002726"
                     /db_xref="GeneID:7295642"
                     /translation="MSDPVALFRVLVLLAVANFAPIIATKLLGSRFSTPLDFHQKLRD
                     GNPVFGAGKTIRGLVVSLAATALVAPLLGFPPSAGISLASLSMAGDLTASFIKRRLGL
                     KAHAQAFGLDQIPEALLPLVFLRDRLGLDGIDIVTVVAAFIIGEVILSRILFRLGLRE
                     TPY"
     misc_feature    complement(308096..308485)
                     /locus_tag="Mnod_8082"
                     /note="Putative integral membrane protein DUF46; Region:
                     DUF46; cl17511"
                     /db_xref="CDD:266736"
     gene            complement(308591..308743)
                     /locus_tag="Mnod_8083"
                     /db_xref="GeneID:7295643"
     CDS             complement(308591..308743)
                     /locus_tag="Mnod_8083"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490238.1"
                     /db_xref="GI:220914930"
                     /db_xref="GeneID:7295643"
                     /translation="MSAASNVPSLLRSLSLTSSQQSGVKGLLLGYRIWSTAPIVVSGI
                     IPSELA"
     gene            complement(308969..309343)
                     /locus_tag="Mnod_8084"
                     /db_xref="GeneID:7295644"
     CDS             complement(308969..309343)
                     /locus_tag="Mnod_8084"
                     /inference="protein motif:PFAM:PF00072"
                     /note="PFAM: response regulator receiver;
                     KEGG: met:M446_2866 response regulator receiver protein"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_002490239.1"
                     /db_xref="GI:220914931"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="GeneID:7295644"
                     /translation="MPWNTALPIFIAEDDPALLNSLAFMLQGEGYRVVTFESGSELLS
                     AFPGAKPGCVLLDYVMPGMSGLEVYHQLRERGVDVPVLLLTGHPDPSIRRRAREAGLP
                     LIEKPLAQDLLSAIEAAASPLH"
     misc_feature    complement(308984..309316)
                     /locus_tag="Mnod_8084"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(309023..309028,309035..309037,
                     309089..309091,309149..309151,309173..309175,
                     309302..309307))
                     /locus_tag="Mnod_8084"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(309173..309175)
                     /locus_tag="Mnod_8084"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(309149..309157,309161..309166))
                     /locus_tag="Mnod_8084"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(309020..309028)
                     /locus_tag="Mnod_8084"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(309422..309580)
                     /locus_tag="Mnod_8085"
                     /pseudo
                     /db_xref="GeneID:7295645"
     gene            309807..310058
                     /locus_tag="Mnod_8086"
                     /db_xref="GeneID:7295646"
     CDS             309807..310058
                     /locus_tag="Mnod_8086"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490240.1"
                     /db_xref="GI:220914932"
                     /db_xref="GeneID:7295646"
                     /translation="MRSLILAGAALAAFATSANAWTQSILHPEQSYKSDFATAFPVTP
                     RYMAAGPQAVRGIPEFRLQPASSSPTVARDGYAGQRSHR"
     sig_peptide     309807..309869
                     /locus_tag="Mnod_8086"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.978 at
                     residue 21"
     gene            complement(310172..310663)
                     /locus_tag="Mnod_8087"
                     /db_xref="GeneID:7295647"
     CDS             complement(310172..310663)
                     /locus_tag="Mnod_8087"
                     /inference="protein motif:PFAM:PF03625"
                     /note="PFAM: protein of unknown function DUF302;
                     KEGG: tcx:Tcr_0949 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490241.1"
                     /db_xref="GI:220914933"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR005180"
                     /db_xref="GeneID:7295647"
                     /translation="MLKRSIPILGGMLTIGTLLPLAGNGAPQTSATSENGVVQVGSAY
                     PMAETLDRLQKDIAAKGIKLFSVVDQSGLAAEAGIALRPSTLLVFGNPALGAQFMTSN
                     PVAGLDWPVRLLVFQDEKGGVWAAYTDFRYIAQRHGIRDRDAAFAKASEVIASITSSV
                     AKR"
     sig_peptide     complement(310586..310663)
                     /locus_tag="Mnod_8087"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.994) with cleavage site probability 0.868 at
                     residue 26"
     misc_feature    complement(310277..310465)
                     /locus_tag="Mnod_8087"
                     /note="Domain of unknown function DUF302; Region: DUF302;
                     pfam03625"
                     /db_xref="CDD:252066"
     gene            complement(310729..311562)
                     /locus_tag="Mnod_8088"
                     /db_xref="GeneID:7295648"
     CDS             complement(310729..311562)
                     /locus_tag="Mnod_8088"
                     /inference="protein motif:TFAM:TIGR01963"
                     /note="TIGRFAM: 3-hydroxybutyrate dehydrogenase;
                     PFAM: short-chain dehydrogenase/reductase SDR; KR domain
                     protein;
                     KEGG: mmr:Mmar10_0826 3-hydroxybutyrate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxybutyrate dehydrogenase"
                     /protein_id="YP_002490242.1"
                     /db_xref="GI:220914934"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR011294"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:7295648"
                     /translation="MVRILQSAGLDRTGTARPLDGRVAIVTGSTSGIGLAIANTLAEQ
                     GALIVINGLGDEAEIERLCRELSDRHQTPVRYDDADLSQAGAVMDLVDRSARAFGPVE
                     ILVNNAGIQYVSPIEEFPPEKWDAILAINLSAVFHATRCVLPDMRRRGWGRIINVASA
                     HGLIGSPFKSAYVAAKHGVIGLTKVTALEMAEAGITCNAVCPGYVWTPLVEHQVRAQA
                     VAHGISEDEVVRKVLLAEQPNKRFATAEEIAGTVAFLCSPAAASITGASISVDGGWTA
                     H"
     misc_feature    complement(310732..311502)
                     /locus_tag="Mnod_8088"
                     /note="3-hydroxybutyrate dehydrogenase; Region: PHB_DH;
                     TIGR01963"
                     /db_xref="CDD:211705"
     misc_feature    complement(310735..311502)
                     /locus_tag="Mnod_8088"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(310948..310959,311035..311037,
                     311047..311049,311086..311094,311236..311244,
                     311401..311409,311464..311466,311470..311475,
                     311479..311481))
                     /locus_tag="Mnod_8088"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(311035..311037,311047..311049,
                     311086..311088,311170..311172))
                     /locus_tag="Mnod_8088"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            311721..312650
                     /locus_tag="Mnod_8089"
                     /db_xref="GeneID:7295649"
     CDS             311721..312650
                     /locus_tag="Mnod_8089"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: regulatory protein LysR; LysR
                     substrate-binding;
                     KEGG: mes:Meso_2462 transcriptional regulator, LysR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="YP_002490243.1"
                     /db_xref="GI:220914935"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:7295649"
                     /translation="MELHEIRYFLAVSRFGSFTKAAEHCNVTQPALTRAIQKLEDELG
                     GLLFSRERSHVHLTDLGRLLEPEFRQMIEHRERAKRAASRFLRLEGAQLTLGVMCTIG
                     PLRFVGFLNHFRVTHPGIELTLIEGVPARLSEMLLAGELDVAIMAHPDGFPEPLRASP
                     LYEERFMVACGQLHDFACRNAIRMRDMAGQIYLQRINCEYRDHLAELLRAQGTEILRS
                     HRSEREDWIQSMVVAGMGVCFLPEFSATLPGIALLPVLEPVVARQVCLVTVAGRRWSS
                     PLAALVAALGQYAWPPSRFDLSEEQTPEPAVSA"
     misc_feature    311721..312602
                     /locus_tag="Mnod_8089"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    311727..311906
                     /locus_tag="Mnod_8089"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    311997..312575
                     /locus_tag="Mnod_8089"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    order(312039..312044,312048..312053,312060..312062,
                     312072..312074,312078..312098,312372..312389,
                     312405..312410,312414..312419)
                     /locus_tag="Mnod_8089"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            312783..313286
                     /locus_tag="Mnod_8090"
                     /db_xref="GeneID:7295650"
     CDS             312783..313286
                     /locus_tag="Mnod_8090"
                     /inference="protein motif:PFAM:PF07883"
                     /note="PFAM: Cupin 2 conserved barrel domain protein;
                     KEGG: reh:H16_A1812 hypothetical membrane associated
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="YP_002490244.1"
                     /db_xref="GI:220914936"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="GeneID:7295650"
                     /translation="MTTIPMIRSAVHRTLCGAVMMTGAFALGAGAAQAGSCPADKVVA
                     SGKGQAESKAAAQGVTDTVIASTDLATERVGIADRQFRLRRLVIEPGGIVPWHSHGDR
                     PAIIYVVSGEVVEYASTCAVPITHKAGEATSETHATAHWWKNTGSTPAVLLSADLFHV
                     KDDPHQM"
     sig_peptide     312783..312887
                     /locus_tag="Mnod_8090"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.770 at
                     residue 35"
     misc_feature    <313020..313277
                     /locus_tag="Mnod_8090"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            313314..314540
                     /locus_tag="Mnod_8091"
                     /db_xref="GeneID:7295651"
     CDS             313314..314540
                     /locus_tag="Mnod_8091"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: bja:bll2771 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_002490245.1"
                     /db_xref="GI:220914937"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:7295651"
                     /translation="MPDPGTLGLSGPTPRESTQAGDLVRSLVIGLMAFLTVVDLFATQ
                     AILPSLARAYAVSPAAIGFAVNATTLGMALGGLGVALLGPRIDRRRGVVVSLLLLAIP
                     TALLGTLPDLWLFAALRVLQGICMAAAFTLTLAYLGEACSASAAAGAFAAYVTGNVAS
                     NFVGRLAAAALVDHLGLVSNFLAFALLNLAGAGLAALVLRAPKPEPKADIGRHGRASP
                     FAVWAEHLANPTLLAAFGIGFCILFAFLGTFTYVNFVLTGSPFLVGPMTLGFVYFVFL
                     PSLLTTPLAGRFSGRLGFRRALVMALLIAVLGLPLLTFPALPVVLIGLVLVGIGTFLA
                     QAIATGVVGRSAMGERASASGLYLLFYYLGGLAGTAVLGQVFERLGWGACVVGVTASL
                     ALAAALTTHLCEPSAT"
     misc_feature    313392..314462
                     /locus_tag="Mnod_8091"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    313398..314420
                     /locus_tag="Mnod_8091"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(313431..313433,313440..313448,313452..313457,
                     313506..313508,313515..313520,313527..313529,
                     313539..313544,313548..313553,313689..313694,
                     313701..313706,313713..313718,313725..313727,
                     313761..313766,313773..313778,313794..313796,
                     314037..314039,314046..314051,314058..314063,
                     314070..314072,314112..314114,314124..314126,
                     314136..314138,314145..314147,314157..314159,
                     314295..314297,314304..314309,314316..314318,
                     314328..314333,314340..314342,314370..314375,
                     314382..314387,314394..314399,314406..314408)
                     /locus_tag="Mnod_8091"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            314651..315799
                     /locus_tag="Mnod_8092"
                     /db_xref="GeneID:7295652"
     CDS             314651..315799
                     /locus_tag="Mnod_8092"
                     /inference="protein motif:PFAM:PF01734"
                     /note="PFAM: Patatin;
                     KEGG: met:M446_1354 patatin"
                     /codon_start=1
                     /transl_table=11
                     /product="patatin"
                     /protein_id="YP_002490246.1"
                     /db_xref="GI:220914938"
                     /db_xref="InterPro:IPR002641"
                     /db_xref="GeneID:7295652"
                     /translation="MAPEPEPLARSLRRRLGQIVLVLQGGGALGAYQVGVYQALHEAG
                     IEPDWIIGTSIGAINASLIAGNPVERRLERLHAFWNRVEHGPLHQAFAALPLVGTLAA
                     NWLTLAQGIGPFFAPNPFAFAGPHVPLGAEQAGYYSTRPLEATLRELVDLPTLNHGGC
                     RLTVGAANVRTGQMRYFDSREMDLDLRHVMASGALPPAFPAIRIDGELYWDGGILSNT
                     PVEAVFDDNPRRNSLVFAVHIWNPEGPEPGSLWEVMGRQKDLQYASRAHTHIARQKQL
                     HRLRHVIAELARRLPEAERRDAGVRELESYGCLTRMHVVRLLAQRVPGQDHTGDIDFS
                     REGICARREAGYENTRKVLDDAPWERPVDDVEGFILHESAPGLAIQTS"
     misc_feature    314705..315715
                     /locus_tag="Mnod_8092"
                     /note="Predicted esterase of the alpha-beta hydrolase
                     superfamily [General function prediction only]; Region:
                     RssA; COG1752"
                     /db_xref="CDD:224666"
     misc_feature    314711..315523
                     /locus_tag="Mnod_8092"
                     /note="Hypothetical patatin similar to Z1214 protein of
                     Escherichia coli; Region: Pat_hypo_Ecoli_Z1214_like;
                     cd07209"
                     /db_xref="CDD:132848"
     misc_feature    order(314726..314731,314735..314737,314810..314812,
                     315281..315283)
                     /locus_tag="Mnod_8092"
                     /note="active site"
                     /db_xref="CDD:132848"
     misc_feature    314804..314818
                     /locus_tag="Mnod_8092"
                     /note="nucleophile elbow; other site"
                     /db_xref="CDD:132848"
     misc_feature    315428..315751
                     /locus_tag="Mnod_8092"
                     /note="Patatin phospholipase; Region: DUF3734; pfam12536"
                     /db_xref="CDD:193067"
     gene            316001..316267
                     /locus_tag="Mnod_8093"
                     /db_xref="GeneID:7295653"
     CDS             316001..316267
                     /locus_tag="Mnod_8093"
                     /inference="similar to AA sequence:KEGG:Mpop_5444"
                     /note="KEGG: mpo:Mpop_5444 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490247.1"
                     /db_xref="GI:220914939"
                     /db_xref="GeneID:7295653"
                     /translation="MTKALLLAGTLVATASGYAWAQQTFTAWGHTFTVSEFAPQQMMV
                     AVATDTKTGRKFNVLKLKNGKMMAVAPINSMRGMPETSQEDMIQ"
     sig_peptide     316001..316066
                     /locus_tag="Mnod_8093"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.998 at
                     residue 22"
     gene            316806..318467
                     /locus_tag="Mnod_8094"
                     /db_xref="GeneID:7295654"
     CDS             316806..318467
                     /locus_tag="Mnod_8094"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: ana:alr7249 unknown protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490248.1"
                     /db_xref="GI:220914940"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295654"
                     /translation="MSLRPHHPLPPVPEDTARVAQTAFRRGNPYLLLRTRLGTIFADA
                     AFADLYPARGQPAYAPWRLALVTLLQFRESMSDRQAAEAVRARIDWKYLLGLDLADPG
                     FDYSVLCEFRGRLLQHEATGRLLARILDAARDQGVLKARGRQRTDSTHVLAAVRDLNR
                     VELLAETLRAALNAVAALAPDWLRRVAPPDWHERYDRRIEDARLPETGPKREAYVLQV
                     GADGYRLLDALDGASAPPLAVALPAVAVLRRVWARHFERAGDGSPPAGTSVRLRPVQG
                     RGPGDRVESPYDVEARFRAKSGTEWTGYMVHLTETCDPDLPRLVVHADTTPANVHEAM
                     RTGVIHAALAGLDLIPSEHLVDAAYISAEHLVAAHERHGIALIGPARSNQSWQTREEG
                     AFHVTDFAVDWERCRVCCPEGRESTSWGTYRDKVSGRAFIRAGFSPAVCRVCPAKPRC
                     TRAGSRRLSLHPRAEHEALAAARMRQESEEGRQLYGQRQGIEATIAQGVRSFGLRRAR
                     YRGLAKMTLQSVATAAALNLDRLAAWFSHRPLAPTRTSRFEALAA"
     misc_feature    316827..317306
                     /locus_tag="Mnod_8094"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    316965..317192
                     /locus_tag="Mnod_8094"
                     /note="Transposase domain (DUF772); Region: DUF772;
                     pfam05598"
                     /db_xref="CDD:253271"
     misc_feature    318033..318401
                     /locus_tag="Mnod_8094"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            complement(318714..319391)
                     /locus_tag="Mnod_8095"
                     /db_xref="GeneID:7295655"
     CDS             complement(318714..319391)
                     /locus_tag="Mnod_8095"
                     /inference="protein motif:PFAM:PF01810"
                     /note="PFAM: Lysine exporter protein (LYSE/YGGA);
                     KEGG: mlo:mlr6177 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lysine exporter protein LysE/YggA"
                     /protein_id="YP_002490249.1"
                     /db_xref="GI:220914941"
                     /db_xref="InterPro:IPR001123"
                     /db_xref="GeneID:7295655"
                     /translation="MNVVGVVTAMPDLSQLALYFAAAFVLAVTPGPGLFYVAARTLAG
                     GRAEGVASSFGTGLGGMVHVLAGSLGVSAIVLASAELFTALKLIGAAYLVWIGLRTFQ
                     SARREASTALNSVPATPPIGPLRAFREGVLVEALNPKTAAFFLAFVPQFVDPAGGHVA
                     LQFVVLGFVSVALNTLADIVVAFAASGIREGAAARPAFIRRLREASGTAMIALGIGLA
                     LAKRPAT"
     misc_feature    complement(318726..319358)
                     /locus_tag="Mnod_8095"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            complement(319388..320011)
                     /locus_tag="Mnod_8096"
                     /db_xref="GeneID:7295656"
     CDS             complement(319388..320011)
                     /locus_tag="Mnod_8096"
                     /inference="protein motif:PFAM:PF04299"
                     /note="PFAM: Negative transcriptional regulator;
                     KEGG: mlo:mlr6176 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding negative transcriptional regulator"
                     /protein_id="YP_002490250.1"
                     /db_xref="GI:220914942"
                     /db_xref="InterPro:IPR007396"
                     /db_xref="GeneID:7295656"
                     /translation="MYTPPAFRDDDPESLRATMRAARLANLVTATADGPLVTPLPLFL
                     DESEGEHGVIYGHLAKANPQWRVPPVGEGLAIFMGPDAYVTPAWYATKEETGKVVPTW
                     NYVTVHAHGPIEFFHDADRLLDAVTRLTNLHEGPRAKPWAVSEAPAEFIAAQLRGIVG
                     LRMPISRLEGKRKLSQNRNATDRAGVAAGLATSERASDREVAPLIPS"
     misc_feature    complement(319391..320011)
                     /locus_tag="Mnod_8096"
                     /note="Transcriptional regulator [Transcription]; Region:
                     PaiB; COG2808"
                     /db_xref="CDD:225366"
     gene            320100..321515
                     /locus_tag="Mnod_8097"
                     /db_xref="GeneID:7295657"
     CDS             320100..321515
                     /locus_tag="Mnod_8097"
                     /inference="protein motif:PFAM:PF00392"
                     /note="PFAM: regulatory protein GntR HTH; aminotransferase
                     class I and II;
                     KEGG: pde:Pden_4833  transcriptional regulator, GntR
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, GntR family with
                     aminotransferase domain-containing protein"
                     /protein_id="YP_002490251.1"
                     /db_xref="GI:220914943"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="GeneID:7295657"
                     /translation="MEEGVARRIIAAIKEQIHAGVYQPGDRLPSTRAFADEWGASRTT
                     VTAAYGQLIAEGYLTTRPGARATVAHGLGAAATPMPTPAAAPRRLSAFAQRLLALPSP
                     AVAQAARVADFRYGDLSAADFPVLAWRRALNRASLRRTARLRYGDPQGSVALRTALQG
                     YLWRARGIRCTPDQVVIVNGSQQGLDLCARLLLDPGDPFVIENPGYLLARHAFTAAGG
                     VAVPIPVDGDGLRTDALPSARLAYVTPSHQFPLGSVLSAARRRTLLAWAARAGACIIE
                     DDYDGEYRHDIAPIPPLQTLSPEAAIYVGTFSKTLSPTLRLGYLVVPTPMCRAFSEAK
                     RLTDRHTPQLEQDALAELLASGAYERHVRSIRRKNTERRAVLLQALADELGPAVTIAG
                     ADTGLHVVAWINGVAADRERALVAAARAAGVGLYPVSPLYDPTEPRPAAAGFILGYAG
                     LDADALRRGVAVLATVMAEHC"
     misc_feature    320112..320306
                     /locus_tag="Mnod_8097"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(320115..320117,320184..320186,320190..320195,
                     320217..320231,320235..320240,320247..320249,
                     320277..320282,320286..320297)
                     /locus_tag="Mnod_8097"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    320118..321509
                     /locus_tag="Mnod_8097"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    320448..321269
                     /locus_tag="Mnod_8097"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(320637..320645,320715..320717,320844..320846,
                     320937..320939,321015..321017,321021..321026,
                     321045..321047)
                     /locus_tag="Mnod_8097"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(320646..320648,320745..320747,320916..320918,
                     321039..321047,321132..321134,321141..321143)
                     /locus_tag="Mnod_8097"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    321024..321026
                     /locus_tag="Mnod_8097"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(321632..322120)
                     /locus_tag="Mnod_8098"
                     /pseudo
                     /db_xref="GeneID:7295658"
     gene            complement(322315..322485)
                     /locus_tag="Mnod_8099"
                     /pseudo
                     /db_xref="GeneID:7295659"
     gene            complement(322627..323283)
                     /locus_tag="Mnod_8100"
                     /db_xref="GeneID:7295660"
     CDS             complement(322627..323283)
                     /locus_tag="Mnod_8100"
                     /inference="protein motif:PFAM:PF00440"
                     /note="PFAM: regulatory protein TetR;
                     KEGG: dsh:Dshi_3038 TetR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, TetR family"
                     /protein_id="YP_002490252.1"
                     /db_xref="GI:220914944"
                     /db_xref="InterPro:IPR001647"
                     /db_xref="GeneID:7295660"
                     /translation="MISGAQTRRRRKEARPAEITAAALSVFAEKGFAASRLEDVAERA
                     GASKGTIYLYFDTKEALFEAVVHEAFAPLLDRVGKAKRDPRARSEDLLRLVIETIYRD
                     LVGTDRRQILRMMIAEGTRFPHLVEFYHREAVSRGKALLGEIISQGIARGEFVDGPAA
                     RCPEVVIGPAIMAGVWKLVFERIERLDLDRFIAAHLDLVLNGLRAGSPTRVTVPSQRE
                     "
     misc_feature    complement(322666..323271)
                     /locus_tag="Mnod_8100"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(323089..323229)
                     /locus_tag="Mnod_8100"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(323510..324616)
                     /locus_tag="Mnod_8101"
                     /db_xref="GeneID:7295661"
     CDS             complement(323510..324616)
                     /locus_tag="Mnod_8101"
                     /inference="protein motif:PFAM:PF01061"
                     /note="PFAM: ABC-2 type transporter;
                     KEGG: rpc:RPC_2367 ABC-2"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="YP_002490253.1"
                     /db_xref="GI:220914945"
                     /db_xref="InterPro:IPR000412"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="InterPro:IPR013526"
                     /db_xref="GeneID:7295661"
                     /translation="MRTRLLALIVKELLATFRDRKARAALTVPPFIQLFIFAFAATLE
                     VTNVPIGIINDDWGAASVRLISRFERASAFSEIRRYSTLSEAQAAIDSQQVMAVLRVG
                     QDFSRKLARRETPTVQVLLDGRKSNSAQLLNNYIGTIISQFSADERTGVPYAPQSEIV
                     DRSWYNPNRDYREAMVPILIATLPMTIVLMVVGMSVAREQELGTFEQLLVSPLQPIEI
                     IVGKAVPGLIIGLAQCTAMTLIVVFGFGIAVTGSVPVLFLGLTVFLIAIIGVGLFISS
                     LATNQQQAMMGIMVCMMPTMLLSGFSSPVQNMPSWLQLFAVVNPLTHMLVIVRGVFLR
                     DMPFWLVAERIWPMALTAIVTLSAAAWMFRRKVQ"
     misc_feature    complement(323522..324607)
                     /locus_tag="Mnod_8101"
                     /note="ABC-type Na+ efflux pump, permease component
                     [Energy production and conversion / Inorganic ion
                     transport and metabolism]; Region: NatB; COG1668"
                     /db_xref="CDD:224582"
     misc_feature    complement(323618..>324085)
                     /locus_tag="Mnod_8101"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     pfam01061"
                     /db_xref="CDD:250332"
     gene            complement(324621..325760)
                     /locus_tag="Mnod_8102"
                     /db_xref="GeneID:7295662"
     CDS             complement(324621..325760)
                     /locus_tag="Mnod_8102"
                     /inference="protein motif:PFAM:PF01061"
                     /note="PFAM: ABC-2 type transporter;
                     KEGG: rpc:RPC_2368 ABC-2"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-2 type transporter"
                     /protein_id="YP_002490254.1"
                     /db_xref="GI:220914946"
                     /db_xref="InterPro:IPR000412"
                     /db_xref="InterPro:IPR013525"
                     /db_xref="GeneID:7295662"
                     /translation="MTRPDGNRLSARRIAALIRKESLQVLRDPSSLVVAFVLPALLLF
                     LFGFGISFDANRIKIGLVAEESTPETSWFEVALSNTPYFDVRFASDRRAFTDDLSAGR
                     LNGIVVLAGDFSERLARGDTAGLQVITDGSDPNTAGLVAGYVQGAWSVWTAQRGLGRG
                     GAAPAQVNVESRFWFNPELESRRFLVPGSISLIQMMIGALLTALVVSREWERGTMEAL
                     LATPVSILEFIIGKLVPNFVLGLCAMAVCVLAALFVFDIPLRGSLATLVGFTAVFLLV
                     ALGLGLLISTVARTQFLASQVAMLLAFLPGLYLSGFLFEVASMPRLLRAVAVLIPAGY
                     YVRGLNTIFLAGDIAAVLVPATIVLLAMSAVLFALTAAKSRQTLD"
     misc_feature    complement(324645..325715)
                     /locus_tag="Mnod_8102"
                     /note="ABC-type Na+ efflux pump, permease component
                     [Energy production and conversion / Inorganic ion
                     transport and metabolism]; Region: NatB; COG1668"
                     /db_xref="CDD:224582"
     misc_feature    complement(324654..>325199)
                     /locus_tag="Mnod_8102"
                     /note="ABC-2 family transporter protein; Region:
                     ABC2_membrane_2; pfam12679"
                     /db_xref="CDD:257216"
     gene            complement(325757..327493)
                     /locus_tag="Mnod_8103"
                     /db_xref="GeneID:7295663"
     CDS             complement(325757..327493)
                     /locus_tag="Mnod_8103"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: rpc:RPC_2369 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490255.1"
                     /db_xref="GI:220914947"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:7295663"
                     /translation="MSEVLVALEGVTKRFAADAPAAIDRLTTNIVAGQVTGLVGPDGA
                     GKTTLIRMMAALLAPSQGSITVCGHDSVAEIGPIHEVIGYMPQRFGLYEDLSVMENLS
                     LYADLKGVVGPARRTAFDRLLAFTDLARFTDRLAGKLSGGMKQKLGLACAMLKSPRLL
                     LLDEPGVGVDPISRRELWRMVYALVQEGVGIVWSTAYLDEAENCASVLVLNGGKVLFE
                     GDPRAMTASMEGRVVLARGAGTTRRALLADALRSPDIIDGVLQGEAVRLVVAEGRPAP
                     DACALGGGPTVHVEPAHPRFEDSFVAMLSGQPKRTLGVSIHERPATPATAPVEAHHLT
                     RRFGSFTAADDISFTIRRGEIFGLLGPNGAGKSTTFKMMCGLLRPTSGTALVDGLDLY
                     KAPAVARGRLGYMAQKFSLYGDLSVKQNLEFFAGAYGLSGRARREAVTGVIEAFDLGP
                     YLAQNAGGLPLGYKQRLALAAAIMHEPPVLFLDEPTSGVDPLTRREFWGIINAMVGRG
                     VTVMVTTHFMDEAEYCDRVALINRGKCIAVDTPEALQASVRSHDLPNPTLEDAFIALI
                     EAQERESARSAA"
     misc_feature    complement(326576..327493)
                     /locus_tag="Mnod_8103"
                     /note="ABC-type multidrug transport system, ATPase
                     component [Defense mechanisms]; Region: CcmA; COG1131"
                     /db_xref="CDD:224054"
     misc_feature    complement(326849..327478)
                     /locus_tag="Mnod_8103"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    complement(327353..327376)
                     /locus_tag="Mnod_8103"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(326906..326908,327002..327007,
                     327233..327235,327350..327358,327362..327367))
                     /locus_tag="Mnod_8103"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(327233..327244)
                     /locus_tag="Mnod_8103"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(327050..327079)
                     /locus_tag="Mnod_8103"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(327002..327019)
                     /locus_tag="Mnod_8103"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(326984..326995)
                     /locus_tag="Mnod_8103"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(326900..326920)
                     /locus_tag="Mnod_8103"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(325784..326512)
                     /locus_tag="Mnod_8103"
                     /note="ABC-type Na+ transport system, ATPase component
                     [Energy production and conversion / Inorganic ion
                     transport and metabolism]; Region: NatA; COG4555"
                     /db_xref="CDD:226927"
     misc_feature    complement(325892..326512)
                     /locus_tag="Mnod_8103"
                     /note="ATP-binding cassette domain of the drug resistance
                     transporter and related proteins, subfamily A; Region:
                     ABC_DR_subfamily_A; cd03230"
                     /db_xref="CDD:213197"
     misc_feature    complement(326393..326416)
                     /locus_tag="Mnod_8103"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(325946..325948,326042..326047,
                     326273..326275,326390..326398,326402..326407))
                     /locus_tag="Mnod_8103"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(326273..326284)
                     /locus_tag="Mnod_8103"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(order(326090..326110,326198..326206))
                     /locus_tag="Mnod_8103"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(326042..326059)
                     /locus_tag="Mnod_8103"
                     /note="Walker B; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(326024..326035)
                     /locus_tag="Mnod_8103"
                     /note="D-loop; other site"
                     /db_xref="CDD:213197"
     misc_feature    complement(325940..325960)
                     /locus_tag="Mnod_8103"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213197"
     gene            complement(327490..328554)
                     /locus_tag="Mnod_8104"
                     /db_xref="GeneID:7295664"
     CDS             complement(327490..328554)
                     /locus_tag="Mnod_8104"
                     /inference="protein motif:PFAM:PF00529"
                     /note="PFAM: secretion protein HlyD family protein;
                     KEGG: rpc:RPC_2370 secretion protein HlyD"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD family protein"
                     /protein_id="YP_002490256.1"
                     /db_xref="GI:220914948"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:7295664"
                     /translation="MTFGLAGAAFWFWSPQVGELAGRYSWWSTLRSVPALSWLPGPRA
                     AAEGLVLQGNVEVRQVNLGFKVGGRIASLAVDEGATVREGQSLASLEKVYFEDAVAQA
                     RAQRDQARANLDKAQNGNRPEEIAQAQASVAEREATLANARLASDRAEQLLRSGAGTT
                     KAHDDALAALRQADAQLNSARQYLALMRAGARAEDIAAARAQLANSEAALAVAQRQLA
                     DAELVAPTDGTVLSRVRETGAIVNAGETVFVLSLTNPVWVRSYVSQVDLGRVRPGQMA
                     TIRIDTPGAPTFKGWVGFISTTAEFTPKTVETRELRTALVYRIRVVAEDPRGVLRQGM
                     PVTITLASTSTEPMVAGASE"
     misc_feature    complement(328240..328383)
                     /locus_tag="Mnod_8104"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    complement(327496..328380)
                     /locus_tag="Mnod_8104"
                     /note="HlyD family secretion protein; Region: HlyD;
                     pfam00529"
                     /db_xref="CDD:249933"
     misc_feature    complement(<327892..328302)
                     /locus_tag="Mnod_8104"
                     /note="Proteobacterial lipase chaperone protein; Region:
                     Lipase_chap; pfam03280"
                     /db_xref="CDD:251848"
     misc_feature    complement(327556..327894)
                     /locus_tag="Mnod_8104"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            328862..329321
                     /locus_tag="Mnod_8105"
                     /pseudo
                     /db_xref="GeneID:7295665"
     gene            complement(329659..330075)
                     /locus_tag="Mnod_8106"
                     /db_xref="GeneID:7295666"
     CDS             complement(329659..330075)
                     /locus_tag="Mnod_8106"
                     /inference="protein motif:PFAM:PF01850"
                     /note="PFAM: PilT protein domain protein;
                     KEGG: eba:ebD130 virulence associated protein VapC"
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="YP_002490257.1"
                     /db_xref="GI:220914949"
                     /db_xref="InterPro:IPR002716"
                     /db_xref="GeneID:7295666"
                     /translation="MASPRFMLDTNICIFLRRQKSASVTARFAALQPGEAAMSIITYG
                     EQLYGAEKSQDRAKAIALIQRIAGMIPVLPMAVGVADFYGKIRSDLEEKGLTIGNNDL
                     WIAAHALHENLILVTNNRREFDRVGMGLQVEDWTQP"
     misc_feature    complement(329674..330057)
                     /locus_tag="Mnod_8106"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(329707..329709,329764..329769,
                     329773..329778,329782..329784,329803..329805,
                     329812..329817,329824..329829,329833..329835,
                     329848..329856,329860..329862,329884..329886,
                     329893..329895,329929..329937,329941..329949,
                     329953..329958,329968..329970,329989..329991,
                     329998..330000,330022..330030,330034..330039,
                     330046..330054))
                     /locus_tag="Mnod_8106"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(329719..329721,329773..329775,
                     329941..329943,330049..330051))
                     /locus_tag="Mnod_8106"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(329770..329772,329776..329781,
                     329812..329817,329821..329829,329833..329838,
                     329851..329853,329878..329880,329887..329892,
                     329932..329937,329941..329946,329953..329958))
                     /locus_tag="Mnod_8106"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(330075..330302)
                     /locus_tag="Mnod_8107"
                     /db_xref="GeneID:7295667"
     CDS             complement(330075..330302)
                     /locus_tag="Mnod_8107"
                     /inference="similar to AA sequence:KEGG:Lferr_0637"
                     /note="KEGG: afe:Lferr_0637 SpoVT/AbrB domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SpoVT/AbrB domain-containing protein"
                     /protein_id="YP_002490258.1"
                     /db_xref="GI:220914950"
                     /db_xref="GeneID:7295667"
                     /translation="MATTRVFRSGNSMAVRLPRGFDLVGPDVEIEKRGDEIILREIKP
                     KNMLDALALFRELPDDMGDREDTPPQAREGL"
     misc_feature    complement(330078..330299)
                     /locus_tag="Mnod_8107"
                     /note="Virulence-associated protein and related proteins
                     [Function unknown]; Region: VagC; COG4456"
                     /db_xref="CDD:226863"
     gene            330544..330651
                     /locus_tag="Mnod_8108"
                     /pseudo
                     /db_xref="GeneID:7295668"
     gene            331567..332088
                     /locus_tag="Mnod_8109"
                     /db_xref="GeneID:7295669"
     CDS             331567..332088
                     /locus_tag="Mnod_8109"
                     /inference="protein motif:PFAM:PF05443"
                     /note="PFAM: ROSMUCR transcriptional regulator;
                     KEGG: met:M446_6164 MucR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="YP_002490259.1"
                     /db_xref="GI:220914951"
                     /db_xref="InterPro:IPR008807"
                     /db_xref="GeneID:7295669"
                     /translation="MADVQEATADAGGPAIELVADIISAYVAHNPVPVAQLPDLIATV
                     SQTLDSLGKPAASAAEETPKATPAQIRKSITPDALISFIDGKPYKTLKRHLTRHGMSP
                     DEYRSKFGLPPTYPMVAESYAVQRSELAKASGLGQSHRRTAPKQSAGDAKVTASAKSK
                     KGSGRARKPKAAE"
     misc_feature    331612..331977
                     /locus_tag="Mnod_8109"
                     /note="ROS/MUCR transcriptional regulator protein; Region:
                     ROS_MUCR; pfam05443"
                     /db_xref="CDD:253198"
     gene            332167..332439
                     /locus_tag="Mnod_8110"
                     /db_xref="GeneID:7295670"
     CDS             332167..332439
                     /locus_tag="Mnod_8110"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_0588 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490260.1"
                     /db_xref="GI:220914952"
                     /db_xref="GeneID:7295670"
                     /translation="MVSSAVTLLIVAVVFVLGFAVIDRLEKWADTVGLVLGLTVVGLL
                     SAFLLTLAARPTQAPREARAGQQARIGHSVPKPAKSDPDVTGSIRR"
     gene            complement(332523..332732)
                     /locus_tag="Mnod_8111"
                     /db_xref="GeneID:7295671"
     CDS             complement(332523..332732)
                     /locus_tag="Mnod_8111"
                     /inference="similar to AA sequence:KEGG:M446_1154"
                     /note="KEGG: met:M446_1154 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490261.1"
                     /db_xref="GI:220914953"
                     /db_xref="GeneID:7295671"
                     /translation="MLGMMRLAYAMPAAVAPPALAIGIDVISACQLTSLMRIACMQEA
                     EDILAEMQVEPRDLLWESAAFRKPD"
     sig_peptide     complement(332667..332732)
                     /locus_tag="Mnod_8111"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.793) with cleavage site probability 0.789 at
                     residue 22"
     gene            complement(333054..333743)
                     /locus_tag="Mnod_8112"
                     /db_xref="GeneID:7295672"
     CDS             complement(333054..333743)
                     /locus_tag="Mnod_8112"
                     /inference="protein motif:PFAM:PF00027"
                     /note="PFAM: cyclic nucleotide-binding; regulatory protein
                     Crp;
                     KEGG: rpb:RPB_3150 transcriptional regulator, Crp/Fnr
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="CarD family transcriptional regulator"
                     /protein_id="YP_002490262.1"
                     /db_xref="GI:220914954"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR001808"
                     /db_xref="InterPro:IPR012318"
                     /db_xref="GeneID:7295672"
                     /translation="MDQAPRWTRPTMGTLFAGLEREPADALLDAATHRQFAEGTTLFH
                     QGDAPSQLFQVSAGLVKLSRVNPEGEQTTLRFMGAGDLVGCVAVFQQSPFPATAIASK
                     PTSVLCWGAAQILDLTRRYPAISANALKTVGDRAREMIDRVAELTDKGVEARIASVLL
                     RLAGQVGRTCLAGVEIAYPVTRRDVAEMTGVTYFTVSRILGGWQRQGLVQLGRVRIIV
                     MEPQRLAQIAG"
     misc_feature    complement(333090..333704)
                     /locus_tag="Mnod_8112"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(333369..333701)
                     /locus_tag="Mnod_8112"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(333456..333464,333489..333494))
                     /locus_tag="Mnod_8112"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(333372..333380,333390..333398))
                     /locus_tag="Mnod_8112"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(333063..333287)
                     /locus_tag="Mnod_8112"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     misc_feature    complement(333279..333284)
                     /locus_tag="Mnod_8112"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(333168..333170,333195..333203,
                     333207..333209))
                     /locus_tag="Mnod_8112"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(333150..333170)
                     /locus_tag="Mnod_8112"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(333150..333152,333162..333167))
                     /locus_tag="Mnod_8112"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(333162..333167)
                     /locus_tag="Mnod_8112"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            334133..334840
                     /locus_tag="Mnod_8113"
                     /db_xref="GeneID:7295673"
     CDS             334133..334840
                     /locus_tag="Mnod_8113"
                     /inference="similar to AA sequence:KEGG:bll4483"
                     /note="KEGG: bja:bll4483  cytochrome c4"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c4"
                     /protein_id="YP_002490263.1"
                     /db_xref="GI:220914955"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:7295673"
                     /translation="MHLIRGVAVATALVVSVFGSAHAQSPESPPDTMAERVLACAPCH
                     GAQGEGTRDPYFPRLAGKPAGYLFNQLVAFRNGRRHYPPMNYLLEYLPEAYLKEMADH
                     FAGLNPPLPPPAIPTVGDEVLALGKTLVTQGDASRNIPACTSCHGPSLTGMEPGIPGL
                     LGLRPNYVSAQLGAWRYGTRTARAPDCMQVVAGHLTEADVMAVTAWLSSRPAPAERRS
                     VPQGTYALPFACGSQPQ"
     sig_peptide     334133..334204
                     /locus_tag="Mnod_8113"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.999 at
                     residue 24"
     misc_feature    334157..334450
                     /locus_tag="Mnod_8113"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     misc_feature    334499..334774
                     /locus_tag="Mnod_8113"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            334852..336111
                     /locus_tag="Mnod_8114"
                     /db_xref="GeneID:7295674"
     CDS             334852..336111
                     /locus_tag="Mnod_8114"
                     /EC_number="1.1.99.3"
                     /inference="protein motif:PFAM:PF00034"
                     /note="PFAM: cytochrome c class I;
                     KEGG: bja:bll4482  alcohol dehydrogenase cytochrome c
                     subunit precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="YP_002490264.1"
                     /db_xref="GI:220914956"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR008168"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:7295674"
                     /translation="MASLVRSVLPALLASLLCVSAAESQAAPAAQPDAEALAKGEYLA
                     RAGDCIACHTAPEGKPFAGGRPMATPFGTLFTSNITPDPETGIGTWTADQFYQMMHTG
                     RSPDGGLLYPAMPFGSYTKVTRADSDAIYAFLMSVPPVKQANRPHDLRFPYNNRQLVL
                     GWRTLFFREGEFKPDPKQSAEWNRGAYLVEGLGHCGMCHTPINALGGSSESQAFQGGL
                     IPMQNWYAPSLTSNREAGVGDWSIEEISDLLRTGISRRGAVYGPMAEVTYNSLQYLTP
                     EDTRAMAVYLKSLGQEVAPPVTSNVPTAESSLLLSLGKTVYDTNCASCHGAQGQGKPP
                     HYPPLAGNQSIQMSSAVNAIRMVLNGGYPPGTEGNSRPYGMPPFAQSLSDNEVAAVVT
                     YIRTTWGNHGAAVTAQEANQLRSAPLD"
     sig_peptide     334852..334932
                     /locus_tag="Mnod_8114"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.826 at
                     residue 27"
     misc_feature    335287..335718
                     /locus_tag="Mnod_8114"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    335674..336102
                     /locus_tag="Mnod_8114"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    335788..336045
                     /locus_tag="Mnod_8114"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            336116..336292
                     /locus_tag="Mnod_8115"
                     /db_xref="GeneID:7295675"
     CDS             336116..336292
                     /locus_tag="Mnod_8115"
                     /inference="similar to AA sequence:KEGG:Bcep18194_B1401"
                     /note="KEGG: bur:Bcep18194_B1401 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490265.1"
                     /db_xref="GI:220914957"
                     /db_xref="GeneID:7295675"
                     /translation="MLNSPPLQDRDEDTEHRDVAAIIRAGPSGALTLAAIATAIVVTC
                     WFAFYLFVFLPRGS"
     gene            336305..336868
                     /locus_tag="Mnod_8116"
                     /db_xref="GeneID:7295676"
     CDS             336305..336868
                     /locus_tag="Mnod_8116"
                     /inference="protein motif:PFAM:PF00116"
                     /note="PFAM: cytochrome c oxidase subunit II;
                     KEGG: ret:RHE_CH00983 probable cytochrome-c oxidase,
                     subunit II protein"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit II"
                     /protein_id="YP_002490266.1"
                     /db_xref="GI:220914958"
                     /db_xref="InterPro:IPR001505"
                     /db_xref="InterPro:IPR002429"
                     /db_xref="GeneID:7295676"
                     /translation="MPTQDHIDEGARVAERVERRWATLSVAIIIVLAGAAAFSGIHQA
                     TMPQARVETIQPQTLHLTGEFIKGNLGSAVEPDGSVTVRAVGQQYSFTPQCMVVPTNT
                     PVVFRATSPDVVHGFLIQNTNINTMLVPGYVSEIPAKFSRTGEYLMPCQEYCGVGHEG
                     MWAKVKVVDKSEFLSMISANRRVTCVE"
     misc_feature    <336350..336823
                     /locus_tag="Mnod_8116"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 2 [Energy production and conversion]; Region:
                     CyoA; COG1622"
                     /db_xref="CDD:224537"
     misc_feature    336533..336808
                     /locus_tag="Mnod_8116"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     gene            336858..338480
                     /locus_tag="Mnod_8117"
                     /db_xref="GeneID:7295677"
     CDS             336858..338480
                     /locus_tag="Mnod_8117"
                     /inference="protein motif:PFAM:PF00115"
                     /note="PFAM: cytochrome c oxidase subunit I;
                     KEGG: bja:bll4480 cytochrome c oxidase polypeptide I"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c oxidase subunit I"
                     /protein_id="YP_002490267.1"
                     /db_xref="GI:220914959"
                     /db_xref="InterPro:IPR000883"
                     /db_xref="GeneID:7295677"
                     /translation="MLNSRRLILAHFWLAFAVFGLALLLGAWQMFIRSPLHTWISNPE
                     WYYRSLTAHGTVMAYVFPTLVAMGFGYAISEVSLKQRLIGLRWAWAGFWLIVIGAVTA
                     MIPVSLGRASVLYTFYPPLIGSPFYYLGVVLVVVGSWIWVALMSVNLHAWKKANPGAP
                     VPLPMFANVAGSYLWAWTAVGAALELLLQILPVAFGLKSTIDAGLSRVFFSWTLHAIV
                     YFWLIPTYIAYYTIVPRAIGGKIYSDTMGRIAFILFLIVSMPIGMHHTFEDPQVGAGF
                     KFIHSAFTALVALPTLLTVFTICASVEIAARMRGGRGPFGWIKVLPWSNPIMLAVAFS
                     FVMLGFGGAGGLINMSYQLNTSIHNTQWITGHFHLIFGGAIVIMYFAIAYDLWPHLTG
                     RALTDLRLMRTQLWLWFIGMIVTTFPWHWVGILGMPRRMAYFDYGDPAVATQAFSVTL
                     SAIGGFILVASGALFILVLLRGQRAPREDAGVYRFAVALHPPVAVPALNSYALWIALM
                     VGLTATNYGFPIAQLALRQDTSVPAVYVGVNP"
     sig_peptide     336858..336974
                     /locus_tag="Mnod_8117"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.959) with cleavage site probability 0.652 at
                     residue 39"
     misc_feature    336867..338231
                     /locus_tag="Mnod_8117"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:249600"
     misc_feature    336870..338279
                     /locus_tag="Mnod_8117"
                     /note="ba3-like heme-copper oxidase subunit I.  The ba3
                     family of heme-copper oxidases are transmembrane protein
                     complexes in the respiratory chains of prokaryotes and
                     some archaea which catalyze the reduction of O2 and
                     simultaneously pump protons across the...; Region:
                     ba3-like_Oxidase_I; cd01660"
                     /db_xref="CDD:238830"
     misc_feature    order(336879..336881,337041..337046,337056..337058,
                     337071..337073,337128..337130,337266..337271,
                     337392..337394,337494..337496,337506..337508,
                     337983..337985)
                     /locus_tag="Mnod_8117"
                     /note="Putative D-pathway homolog; other site"
                     /db_xref="CDD:238830"
     misc_feature    order(336933..336935,336942..336944,336954..336956,
                     336993..336995,337014..337016,337026..337031,
                     337956..337961,337971..337973,338091..338093,
                     338142..338150,338229..338231)
                     /locus_tag="Mnod_8117"
                     /note="Low-spin heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238830"
     misc_feature    order(336996..336998,337197..337199,337212..337214,
                     337461..337463,337575..337577,337581..337583,
                     337593..337595,337659..337667,337731..337733,
                     337743..337748,337911..337913,337920..337922,
                     337929..337934,338133..338135,338139..338141,
                     338145..338147,338151..338153)
                     /locus_tag="Mnod_8117"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238830"
     misc_feature    order(337041..337043,337563..337565,337899..337901,
                     337917..337919,337953..337955,337962..337967,
                     337974..337979,337983..337985,337989..337991)
                     /locus_tag="Mnod_8117"
                     /note="Putative Q-pathway; other site"
                     /db_xref="CDD:238830"
     misc_feature    order(337209..337211,337380..337382,337650..337652)
                     /locus_tag="Mnod_8117"
                     /note="Putative alternate electron transfer pathway; other
                     site"
                     /db_xref="CDD:238830"
     misc_feature    order(337461..337463,337476..337481,337917..337919,
                     337929..337934,338142..338144)
                     /locus_tag="Mnod_8117"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238830"
     misc_feature    order(337500..337502,337647..337652,337953..337955)
                     /locus_tag="Mnod_8117"
                     /note="Binuclear center (active site) [active]"
                     /db_xref="CDD:238830"
     misc_feature    order(337512..337514,337533..337535,337545..337547,
                     337584..337586,337707..337709,337728..337730,
                     337737..337739)
                     /locus_tag="Mnod_8117"
                     /note="Putative K-pathway homolog; other site"
                     /db_xref="CDD:238830"
     misc_feature    order(337650..337652,337929..337934,338142..338147)
                     /locus_tag="Mnod_8117"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238830"
     misc_feature    order(337764..337766,337893..337895,337923..337925,
                     338127..338129,338133..338135)
                     /locus_tag="Mnod_8117"
                     /note="Subunit I/IIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238830"
     misc_feature    order(337956..337958,338142..338147)
                     /locus_tag="Mnod_8117"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238830"
     gene            338477..339289
                     /locus_tag="Mnod_8118"
                     /db_xref="GeneID:7295678"
     CDS             338477..339289
                     /locus_tag="Mnod_8118"
                     /inference="protein motif:PFAM:PF00034"
                     /note="PFAM: cytochrome c class I;
                     KEGG: bja:bll4479 cytochrome c4"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c class I"
                     /protein_id="YP_002490268.1"
                     /db_xref="GI:220914960"
                     /db_xref="InterPro:IPR003088"
                     /db_xref="InterPro:IPR009056"
                     /db_xref="GeneID:7295678"
                     /translation="MSDEDLLSPRNPWFARSVGITVALFVVTALGGFVLLPYAQPDLK
                     FTGVWDAICSAAGLPKTPSAAAPVQPDGKLTQVVVTSALPGAAAPEAVGRGATLAQQC
                     AICHGPTGVSRADSPNLAGQYAAAIYKQLMDFKTGARANAIMTPFAVNLSDRDMSDLA
                     AYYAYLPRLPGFHPDRDKPAPRIVINGAPLRNIAPCGSCHGALDNKTGSPWLEGQPAA
                     YVKAQLQAFASGARRNDISQQMRNIARRMTREEIDQAAQWYASQPPTTIHTQ"
     misc_feature    338708..339004
                     /locus_tag="Mnod_8118"
                     /note="Cytochrome c553 [Energy production and conversion];
                     Region: COG2863"
                     /db_xref="CDD:225418"
     misc_feature    <339062..339274
                     /locus_tag="Mnod_8118"
                     /note="Cytochrome c; Region: Cytochrom_C; cl11414"
                     /db_xref="CDD:264358"
     gene            complement(339474..339689)
                     /locus_tag="Mnod_8119"
                     /db_xref="GeneID:7295679"
     CDS             complement(339474..339689)
                     /locus_tag="Mnod_8119"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490269.1"
                     /db_xref="GI:220914961"
                     /db_xref="GeneID:7295679"
                     /translation="MHKAGHGYALLSERTGAPLARLTPTGEADTVQVPWWNGARWGAA
                     GPFGIATTPLDQALDYIASTPLFWIND"
     gene            complement(339656..340273)
                     /locus_tag="Mnod_8120"
                     /db_xref="GeneID:7295680"
     CDS             complement(339656..340273)
                     /locus_tag="Mnod_8120"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: sus:Acid_0639 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490270.1"
                     /db_xref="GI:220914962"
                     /db_xref="GeneID:7295680"
                     /translation="MARLAPSDAANPAAAVVPAVLSTWMAPLAACFPRPTFANLMVLV
                     AGAVLAPGRRTVTAALSRLGLREGVTVSTYHRVLSRRRWRAQATARGLLGLLIAAFAP
                     SGPVVVGIDETLERRWGARIKARGIDRDPVRSSPGHFVKASGLRWISRMLPHDGVVGA
                     LNPASRARASSCQPDPILCRRALRRSTRPAAGASPCTRRATATRC"
     gene            340332..340547
                     /locus_tag="Mnod_8121"
                     /db_xref="GeneID:7295681"
     CDS             340332..340547
                     /locus_tag="Mnod_8121"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490271.1"
                     /db_xref="GI:220914963"
                     /db_xref="GeneID:7295681"
                     /translation="MHKAGHGYALLSERTGAPLARLTPTGEADTVQVPWWNGARWGAA
                     GPFGIATTPLDQALDYIASTPLFWIND"
     gene            340921..341565
                     /locus_tag="Mnod_8122"
                     /db_xref="GeneID:7295682"
     CDS             340921..341565
                     /locus_tag="Mnod_8122"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: rso:RSc0893 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490272.1"
                     /db_xref="GI:220914964"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295682"
                     /translation="MAGWLSGVPFTPLHSAFARWTRLGLWRRLGQRLALDWRRARGDE
                     VVPSAVVADSRSLRSAPSAWARGIDGGKLVKGVKLVAVCDKHGSLLDLALGPATVDDR
                     AGTPPLLPQLAGLGFQGDLLGDSGLKGAPFAAAALVHDIHVSVSPGGTRDDQFLPCGI
                     RWVVERLFAWLSRYRRLNIVYDRQPDLFAAHVWIAMISIISRRLVAHTQAQQAV"
     misc_feature    341059..341517
                     /locus_tag="Mnod_8122"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <341395..341526
                     /locus_tag="Mnod_8122"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            341603..342679
                     /locus_tag="Mnod_8123"
                     /db_xref="GeneID:7295683"
     CDS             341603..342679
                     /locus_tag="Mnod_8123"
                     /EC_number="5.1.1.1"
                     /inference="protein motif:PFAM:PF00532"
                     /note="PFAM: regulatory protein LacI; periplasmic binding
                     protein/LacI transcriptional regulator;
                     KEGG: ret:RHE_CH01719 probable transcriptional regulator
                     protein, LacI family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LacI family"
                     /protein_id="YP_002490273.1"
                     /db_xref="GI:220914965"
                     /db_xref="InterPro:IPR000843"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:7295683"
                     /translation="MEIAGGPNEGRPQDARSTLADIARESGVSKATVSLVLRNHPSIP
                     ERTRQRVLHAAEQLGYVYNRGAASLRSAQTHLIGLAVNDLTNPYFAEITAAIEDVLTT
                     QNRIVIMSNTGESVERQSAFAASVREYNVDGLLLVPARGTDATFVDLLRSWRLPFVMV
                     SRSVPGAETDLVQADHRAGTLAATEHLVGLGHRRIGFIGLNTDISTGRERLEGYQLAL
                     ARSGIEYEPQLVLSGPATRDEGMAQLFALLDLPEPPTAAVCFNDVVAFGAMLGLRARN
                     LTPGADFSIFGFDDIAEATLWRPALTSVSVPRKLIGQTAAELLLRRIGQIDAPAKVVL
                     LPTELVVRDTTSRPALRGRRARRR"
     misc_feature    341654..342640
                     /locus_tag="Mnod_8123"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    341660..341815
                     /locus_tag="Mnod_8123"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(341660..341662,341684..341698,341702..341707,
                     341714..341716,341729..341734,341741..341743,
                     341780..341782,341789..341791,341798..341803,
                     341807..341812)
                     /locus_tag="Mnod_8123"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    341780..341809
                     /locus_tag="Mnod_8123"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    341828..342631
                     /locus_tag="Mnod_8123"
                     /note="Ligand-binding domain of MalI, a transcription
                     regulator of the maltose system of Escherichia coli and
                     its close homologs from other bacteria; Region:
                     PBP1_MalI_like; cd06289"
                     /db_xref="CDD:107284"
     misc_feature    order(341828..341830,341867..341875,341882..341887,
                     341891..341896,341915..341929,341933..341935,
                     341966..341968,341975..341977,341984..341992,
                     342314..342316,342398..342400,342410..342412,
                     342419..342424)
                     /locus_tag="Mnod_8123"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107284"
     misc_feature    order(341864..341869,341876..341878,342011..342013,
                     342083..342085,342122..342124,342230..342232,
                     342305..342307,342467..342469,342518..342520)
                     /locus_tag="Mnod_8123"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107284"
     gene            343024..343776
                     /locus_tag="Mnod_8124"
                     /db_xref="GeneID:7295684"
     CDS             343024..343776
                     /locus_tag="Mnod_8124"
                     /inference="protein motif:PFAM:PF07729"
                     /note="PFAM: regulatory protein GntR HTH; GntR domain
                     protein;
                     KEGG: mrd:Mrad2831_4644 GntR domain-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002490274.1"
                     /db_xref="GI:220914966"
                     /db_xref="InterPro:IPR000524"
                     /db_xref="InterPro:IPR011711"
                     /db_xref="GeneID:7295684"
                     /translation="MEAVARDMSDDEARPSSLARPSSLADGVYQSLVTEIASGTYAEN
                     QKLPSENDLAGRFKVSRPIVRAALERLRRENVIVSRQGAGSFVRARGKAPALGFAPVE
                     SIADIQRCYEFRLTIEPDAAFYAALRRNEAAIGRIASALDLLNAATRQQQHRDDADFA
                     FHLAIAEASNNHYYAASMQALQAHIAVGMKIHGLALLGPNSGLQGVFDEHHAIFAAVR
                     DGDPNTARVQMQRHICSSRDRLFECRLLDLSL"
     misc_feature    343081..343749
                     /locus_tag="Mnod_8124"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    343090..343287
                     /locus_tag="Mnod_8124"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(343090..343092,343096..343098,343165..343167,
                     343171..343176,343198..343212,343216..343221,
                     343228..343230,343258..343263,343267..343278)
                     /locus_tag="Mnod_8124"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    343354..343722
                     /locus_tag="Mnod_8124"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            344159..344443
                     /locus_tag="Mnod_8125"
                     /db_xref="GeneID:7295685"
     CDS             344159..344443
                     /locus_tag="Mnod_8125"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mpt:Mpe_A1420  oxidoreductase protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490275.1"
                     /db_xref="GI:220914967"
                     /db_xref="GeneID:7295685"
                     /translation="MGGTGVTMDWHIAPLRRRNSLLPDAQRSCDIDGHGRFREGTATV
                     RPGSGACAAQVVRLLYRSGIAIVPQGGNAGKNAGGTACLSAGTSAAAGRG"
     gene            344452..345558
                     /locus_tag="Mnod_8126"
                     /db_xref="GeneID:7295686"
     CDS             344452..345558
                     /locus_tag="Mnod_8126"
                     /inference="protein motif:PFAM:PF07005"
                     /note="PFAM: type III effector Hrp-dependent outers;
                     KEGG: mrd:Mrad2831_4643 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Hrp-dependent type III effector protein"
                     /protein_id="YP_002490276.1"
                     /db_xref="GI:220914968"
                     /db_xref="InterPro:IPR010737"
                     /db_xref="GeneID:7295686"
                     /translation="MPSLRLIADDLTGALDTAAGFTGLVGAVEVAWVGAPMGPCGGNL
                     ALDTGTRERSAEEAARIAGALAPRLQGAEIAFKKVDSLLRGPWAAELAACFGTGAWRH
                     AIVAPAFPYQGRRTVEGRQFARTESGWQAASGDIAESLHAAGLATRRAGVGDGLLDGV
                     AVYDATDDADLDRIASFAESAAGPVLWCGSGGLAGALAGRSPASCDTRLVGPVLGLFG
                     SDRPETAAQLAHCPEHRLILPAEGDHAGRVAARLRERGAALVSLGLPEGTGRQEAAAR
                     IAASFGLLARALPPPGTLLVAGGETLKALCLALGTETLVVTGQVAPGIPRSRMRGGLW
                     DGVAIVSKSGAFGSPAVWRDLLRRNGLLPERTCA"
     misc_feature    344470..345525
                     /locus_tag="Mnod_8126"
                     /note="Protein of unknown function, DUF1537; Region:
                     DUF1537; cl01345"
                     /db_xref="CDD:260891"
     gene            345555..346592
                     /locus_tag="Mnod_8127"
                     /db_xref="GeneID:7295687"
     CDS             345555..346592
                     /locus_tag="Mnod_8127"
                     /EC_number="1.1.1.262"
                     /inference="protein motif:TFAM:TIGR00557"
                     /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
                     dehydrogenase;
                     PFAM: Pyridoxal phosphate biosynthetic protein PdxA;
                     KEGG: mrd:Mrad2831_4642 4-hydroxythreonine-4-phosphate
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="YP_002490277.1"
                     /db_xref="GI:220914969"
                     /db_xref="InterPro:IPR005255"
                     /db_xref="GeneID:7295687"
                     /translation="MTRHLAITMGDPAGIGPEILVKAAHRLKHRIAAGDLKLLVIGSV
                     PALRRAEGALGAAPIPEIAQESDWPNLACLQADAEGAPIEPGQLSADGGRFAFKAIER
                     AVRLALDQRIGGIVTAPLNKEALNLAGYHYAGHTEMLADLTGVRGSVMMLAHGGMRVS
                     HVTTHVALEDVPKRLTPERLRRVIDLTHKALKGLGLAQPRIAVAALNPHAGEGGLFGR
                     QDIDVSAPVIATAVADGLDVVGPVPGDTVFVKLRAGQYDAVVAMYHDQGHIPVKLLGF
                     EVDPTTGQWMELSGVNITLGLPIIRTSVDHGTAFDIAGRGIANERSLIEAIEYAERLA
                     ASAAATQRSAA"
     misc_feature    345567..346553
                     /locus_tag="Mnod_8127"
                     /note="4-hydroxythreonine-4-phosphate dehydrogenase;
                     Region: pdxA; TIGR00557"
                     /db_xref="CDD:233023"
     gene            346589..347716
                     /locus_tag="Mnod_8128"
                     /db_xref="GeneID:7295688"
     CDS             346589..347716
                     /locus_tag="Mnod_8128"
                     /inference="protein motif:PFAM:PF00465"
                     /note="PFAM: iron-containing alcohol dehydrogenase;
                     KEGG: azc:AZC_0176 iron-containing alcohol dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-containing alcohol dehydrogenase"
                     /protein_id="YP_002490278.1"
                     /db_xref="GI:220914970"
                     /db_xref="InterPro:IPR001670"
                     /db_xref="GeneID:7295688"
                     /translation="MTDLTAPIAIVRPEIAFGSGTARTVGQRARARAARRILVVADAF
                     NAARVDLLALPGEVRVFGEVRPEPDIPNLERALALAEDFSPDLVVGFGGGSAMDLAKL
                     VAVLPGSGQTIHDVVGPERVAGRRAGLIQVPTTAGTGSEGGTRALVTDPATQTKLAVQ
                     SRHMLADAAVIDPDLTLTVPPAVTAATGVDALAHCVEAFTSRKAHPLIDLYALEGARL
                     VGRFLPRAVRDGSDVEARAGLALASLYGGFCLGPVNTTAGHAVAYPLGSRHHVAHGLA
                     CAVIFPHTLAFNAPAVPEKTRQVMAALGLPETAEEGAVAEAATRWCADLGLAMRLSAL
                     GVPEGDLPAMATEAHAIRRLLDNNPREISRDRILALYRAAA"
     misc_feature    346625..347704
                     /locus_tag="Mnod_8128"
                     /note="Dehydroquinate synthase-like (DHQ-like) and
                     iron-containing alcohol dehydrogenases (Fe-ADH); Region:
                     DHQ_Fe-ADH; cl02872"
                     /db_xref="CDD:261488"
     misc_feature    order(346712..346714,346865..346873,346880..346882,
                     346889..346891,346988..346993,346997..346999,
                     347054..347059,347111..347113,347135..347137,
                     347156..347158,347168..347170,347363..347365,
                     347375..347377,347405..347407)
                     /locus_tag="Mnod_8128"
                     /note="active site"
                     /db_xref="CDD:173927"
     misc_feature    order(346712..346714,346865..346873,346988..346993,
                     346997..346999,347111..347113,347405..347407)
                     /locus_tag="Mnod_8128"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173927"
     misc_feature    order(347156..347158,347363..347365,347405..347407)
                     /locus_tag="Mnod_8128"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173927"
     gene            347730..348650
                     /locus_tag="Mnod_8129"
                     /db_xref="GeneID:7295689"
     CDS             347730..348650
                     /locus_tag="Mnod_8129"
                     /inference="protein motif:PFAM:PF00701"
                     /note="PFAM: dihydrodipicolinate synthetase;
                     KEGG: bja:blr3884  dihydrodipicolinate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="YP_002490279.1"
                     /db_xref="GI:220914971"
                     /db_xref="InterPro:IPR002220"
                     /db_xref="GeneID:7295689"
                     /translation="MSETVFPRGVFCAALTPLDQDLNPNHAAFTAHCRHLLAEGCTGI
                     ALLGTTGEANSFSGDERKALLEAALRAGISPDQLLPGTGVAALTETVALTRHALSLGV
                     TTVVMLPPFYYKGVSEDGIVAAYAEIVERIGDERLRVVLYHIPQVAGVPLPHGAIARL
                     RERYPGTFVGIKDSAGDLAHMTALVERFPGFAVLAGADPLMLPLLKAGGAGAITATTN
                     LVARDLRFVFDHWADPAQAAAVGAAQGRVVAARERASRFAQMASLKALLAERTGDPGW
                     CRMRPPLVPLSETERAALLAPMPDEARRAS"
     misc_feature    347757..348617
                     /locus_tag="Mnod_8129"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(347766..347768,347862..347864,347871..347879,
                     348153..348155,348243..348245)
                     /locus_tag="Mnod_8129"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(347862..347864,347871..347879,348153..348155,
                     348243..348245,348366..348368)
                     /locus_tag="Mnod_8129"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(347874..347876,347889..347894,347985..347990,
                     348060..348065,348087..348089,348099..348101,
                     348570..348575)
                     /locus_tag="Mnod_8129"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    348243..348245
                     /locus_tag="Mnod_8129"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            348720..350144
                     /locus_tag="Mnod_8130"
                     /db_xref="GeneID:7295690"
     CDS             348720..350144
                     /locus_tag="Mnod_8130"
                     /inference="protein motif:PFAM:PF00474"
                     /note="PFAM: Na+/solute symporter;
                     KEGG: eca:ECA3764 sodium:solute symporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/solute symporter"
                     /protein_id="YP_002490280.1"
                     /db_xref="GI:220914972"
                     /db_xref="InterPro:IPR001734"
                     /db_xref="GeneID:7295690"
                     /translation="MHEFTQGESLTIAVMVVAYILLTGWLTLKLRSRTNAQFMTAARS
                     MPAVVVGVLLMSEFIGAKSTVGTAQEAFNSGIAAAWSVLGASIGFVLFGLFIVRKIYD
                     SGEYTISAAIAQKYGKSTMMTVSVIMIYALLLVNVGNYVSGAAAISTALRVNLPTAMC
                     IIAAVSTFYYVFGGLKGVAWVTILHSAIKVVGIGIILAVALSLTGGLAPMRESLPPVY
                     FTWDGKLGFATIFAWTFGTVGAIFSTQFIVQAISSTKNASAARASAFYAAAFCFPLGI
                     VLALIGLAAKHLYPDMNSLYALPVFMKGMHPLLAGLVTTSLVASIFVSVSTVALAIAS
                     LVVRDFYVPYWNPDPAQELRMTRIFSLVIAVVPLVFVFFIPEILKLSFFTRALRLSIA
                     IVAMVGFYLPWFGSNRGATLGLLGAAVATTVWYVLGNPYGIDNMYVAALAPLLVMVIE
                     RLFGWGKPQPAPAASEPTHTVTPV"
     misc_feature    348750..350066
                     /locus_tag="Mnod_8130"
                     /note="Solute carrier 5 family, sodium/glucose
                     transporters and related proteins; solute-binding domain;
                     Region: SLC5sbd; cd10322"
                     /db_xref="CDD:212032"
     misc_feature    order(348885..348887,348894..348896,349677..349679,
                     349686..349691)
                     /locus_tag="Mnod_8130"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212032"
     gene            350158..351354
                     /locus_tag="Mnod_8131"
                     /db_xref="GeneID:7295691"
     CDS             350158..351354
                     /locus_tag="Mnod_8131"
                     /inference="similar to AA sequence:KEGG:SACE_4557"
                     /note="KEGG: sen:SACE_4557 BNR repeat-containing glycosyl
                     hydrolase"
                     /codon_start=1
                     /transl_table=11
                     /product="BNR repeat-containing glycosyl hydrolase"
                     /protein_id="YP_002490281.1"
                     /db_xref="GI:220914973"
                     /db_xref="GeneID:7295691"
                     /translation="MLDIIAQPQARTGTLQPVAGDPVRLETFIPSLCVQNHAANLMPL
                     ANGDLACVWFGGTQEGMADISVYFSRLAKGSDAWSPAEKLSDDPARSEQNPILFPAPT
                     GDLWLIWTAQVSGNQDTAFVRRRLSRDHGRSWGPIETLFPRREGCGTFVRQPPVVLAN
                     GDWLLPIFHCPSVPGAKWVGDDDTSAVKISSDAGRTWHEVAVPDSTGCVHMSIMPLDD
                     GTLLALFRSRWADAIYESRSTDGGATWSAPVPTALPNNNSSIQATRLANGHLALVYNA
                     VNAEAATERRASLYDEIEDEAGESAAPLPAAPGKRTAFWGTPRAPLTLAISEDGGRTW
                     PHRRDVETGDGYCMTNNSRDRTNRELSYPSVAQTPDGALHVAFTYHRQAIKYVRLSEG
                     WVSAGG"
     misc_feature    350227..351348
                     /locus_tag="Mnod_8131"
                     /note="Predicted neuraminidase (sialidase) [Carbohydrate
                     transport and metabolism]; Region: COG4692"
                     /db_xref="CDD:227036"
     misc_feature    350296..351282
                     /locus_tag="Mnod_8131"
                     /note="BNR repeat-like domain; Region: BNR_2; pfam13088"
                     /db_xref="CDD:257491"
     gene            351347..352030
                     /locus_tag="Mnod_8132"
                     /db_xref="GeneID:7295692"
     CDS             351347..352030
                     /locus_tag="Mnod_8132"
                     /inference="protein motif:PFAM:PF00106"
                     /note="PFAM: NAD-dependent epimerase/dehydratase;
                     short-chain dehydrogenase/reductase SDR; KR domain
                     protein;
                     KEGG: bcm:Bcenmc03_6958 short-chain
                     dehydrogenase/reductase SDR"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_002490282.1"
                     /db_xref="GI:220914974"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR002198"
                     /db_xref="InterPro:IPR002347"
                     /db_xref="InterPro:IPR013968"
                     /db_xref="GeneID:7295692"
                     /translation="MAEAARHALVTGASSGIGAAIVARLLGDGWAVTGVSRSEGSEVH
                     PRYRHLALDLSDLDAIAPALEDLRVDALVHAAGLLRVGRLGAMAPEDGEAMWRLHVEA
                     AVRMAEILVPRMAAGGRVVLIGSRTAAGAAGRGAYAASKAALVALARSWAAELMPRGI
                     TVNVVAPAATETPMLTDPARGGLAPRLPPLGRFIRPDEVAAAVAFFLSRETDAVTGQQ
                     LMICGGSSL"
     misc_feature    351359..352018
                     /locus_tag="Mnod_8132"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK12825"
                     /db_xref="CDD:237218"
     misc_feature    351368..352003
                     /locus_tag="Mnod_8132"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(351380..351382,351386..351397,351452..351460,
                     351500..351508,351569..351577,351638..351640,
                     351713..351721,351767..351769,351845..351856,
                     351860..351865)
                     /locus_tag="Mnod_8132"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(351641..351643,351719..351721,351767..351769)
                     /locus_tag="Mnod_8132"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(352340..353284)
                     /locus_tag="Mnod_8133"
                     /db_xref="GeneID:7295693"
     CDS             complement(352340..353284)
                     /locus_tag="Mnod_8133"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: met:M446_3611 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490283.1"
                     /db_xref="GI:220914975"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:7295693"
                     /translation="MARITPAPSAPTQIHAHHAAKAYMLLTFTALIWAGNVIASKWAV
                     GQVSPLALTSVRWLVACAALVPLAARQVACEWRLLRPAWFRILLMGGCGFTAFNALFY
                     IAGTYTSATNIALFQGAIPVVVLACSFLVYRTRVSLIQVTGVLVTLLGVAVAATHGDW
                     EVLRTFAFNRGDLLMLVACVLYAGYTVGLRARPAISGLTFFAAMALAALLTSLPLLMV
                     EWATGRLIWPTGKGWAIIAFVGLGPSLISQLSFMRGVELIGPNRAGVFVNLVPVFGAG
                     LAVSLAGEPFRLDNAVALTLVLSGIFIAERLGRRSRSS"
     misc_feature    complement(352355..353233)
                     /locus_tag="Mnod_8133"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    complement(352817..353194)
                     /locus_tag="Mnod_8133"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(352376..>352603)
                     /locus_tag="Mnod_8133"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            353555..353749
                     /locus_tag="Mnod_8134"
                     /db_xref="GeneID:7295694"
     CDS             353555..353749
                     /locus_tag="Mnod_8134"
                     /inference="similar to AA sequence:KEGG:M446_7010"
                     /note="KEGG: met:M446_7010 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490284.1"
                     /db_xref="GI:220914976"
                     /db_xref="GeneID:7295694"
                     /translation="MSDSPTLDVPSPTVLEWSLGLASLSPGQVPCLSFRPEEWVKTLL
                     NCRWFVNDFGPEADRLGWAL"
     gene            353943..355277
                     /locus_tag="Mnod_8135"
                     /db_xref="GeneID:7295695"
     CDS             353943..355277
                     /locus_tag="Mnod_8135"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_4843 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490285.1"
                     /db_xref="GI:220914977"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295695"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     misc_feature    354006..354404
                     /locus_tag="Mnod_8135"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    354771..355250
                     /locus_tag="Mnod_8135"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <355032..355262
                     /locus_tag="Mnod_8135"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            355639..356028
                     /locus_tag="Mnod_8136"
                     /db_xref="GeneID:7295696"
     CDS             355639..356028
                     /locus_tag="Mnod_8136"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_0730 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490286.1"
                     /db_xref="GI:220914978"
                     /db_xref="GeneID:7295696"
                     /translation="MPDRGYTVRMGREGWGVYAQQTGEPVRVNGRVLTGLPLETATEF
                     AESLQLLAVIGTDAVEQPIINPGQSMRISGVSSGEMIMSDDREVKEGGQTPPPPAGPP
                     PLEDTPSPSLTPKPHSPEAADPPTRKS"
     misc_feature    <355714..>355815
                     /locus_tag="Mnod_8136"
                     /note="radical SAM protein, TIGR01212 family; Region:
                     TIGR01212"
                     /db_xref="CDD:130279"
     gene            356188..356442
                     /locus_tag="Mnod_8137"
                     /db_xref="GeneID:7295697"
     CDS             356188..356442
                     /locus_tag="Mnod_8137"
                     /inference="similar to AA sequence:KEGG:M446_3363"
                     /note="KEGG: met:M446_3363 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490287.1"
                     /db_xref="GI:220914979"
                     /db_xref="GeneID:7295697"
                     /translation="MANGLFARAERAMEETRRLHKNRLRIQALVQQTVHAFRATREDV
                     KAYRQKAADGLARRSLQALAPMPDTIIRPRARRRGTRKQP"
     gene            complement(356508..357081)
                     /locus_tag="Mnod_8138"
                     /pseudo
                     /db_xref="GeneID:7295698"
     gene            357134..357736
                     /locus_tag="Mnod_8139"
                     /db_xref="GeneID:7295699"
     CDS             357134..357736
                     /locus_tag="Mnod_8139"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490288.1"
                     /db_xref="GI:220914980"
                     /db_xref="GeneID:7295699"
                     /translation="MVKLAVMNQPSAGSPGACLKQTCCGDRCHDPPAARARAAGMGDS
                     PAGCPAARRREGDDCAAVPPRREAGSQRCRREARRTLVRAHRSNAAGTREANVMTEPS
                     SVRHLADYELLWGVAASGGGADGRVAPAPLVDLRLPGRHEPRRHGEPLQRSYRRSSVP
                     EGRPRHDCILGGWGTQECPRPRLWRAPRSSSPVQVRQHYS"
     gene            complement(358029..358856)
                     /locus_tag="Mnod_8140"
                     /db_xref="GeneID:7295700"
     CDS             complement(358029..358856)
                     /locus_tag="Mnod_8140"
                     /inference="protein motif:PFAM:PF00515"
                     /note="PFAM: hypothetical protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: mlo:mll2209 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490289.1"
                     /db_xref="GI:220914981"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="GeneID:7295700"
                     /translation="MLRRGRWGIISLWLGFVLSLWMGGAVAQEMHIADYTNTIHQKRF
                     ASKDDNDDYMQMLLSASVDNVVRAANRLIERGTADSEALAYAYAQRSNFWKSSSDAWA
                     AAVRDYEHAVQLSTQCKPFYLVRLGEIVAERDWGRAMSYFDQAITLSPQDPYVFFRRG
                     RLYGKAQKNDLALRDFDEVIRLVPHRPAAYIQRAEVWRAAGDIDRALQDYHAAFDRAD
                     SQFIKNTQWNLRDKKLYRREPDGSNNDTFRGAVSDCVRDRGCTVVSGWSAETRDDSP"
     sig_peptide     complement(358773..358856)
                     /locus_tag="Mnod_8140"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 1.000 at
                     residue 28"
     misc_feature    complement(358218..358466)
                     /locus_tag="Mnod_8140"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(358218..358220,358227..358229,
                     358239..358241,358275..358277,358320..358322,
                     358329..358331,358341..358343,358377..358379,
                     358422..358424,358431..358433,358443..358445))
                     /locus_tag="Mnod_8140"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(358218..358406)
                     /locus_tag="Mnod_8140"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(order(358257..358262,358269..358274,
                     358281..358286,358362..358367,358374..358379,
                     358383..358388))
                     /locus_tag="Mnod_8140"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(359103..359283)
                     /locus_tag="Mnod_8141"
                     /pseudo
                     /db_xref="GeneID:7295701"
     gene            complement(359331..359513)
                     /locus_tag="Mnod_8142"
                     /db_xref="GeneID:7295702"
     CDS             complement(359331..359513)
                     /locus_tag="Mnod_8142"
                     /inference="similar to AA sequence:KEGG:M446_6710"
                     /note="KEGG: met:M446_6710 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490290.1"
                     /db_xref="GI:220914982"
                     /db_xref="GeneID:7295702"
                     /translation="MYVEGGWKPSWEPPPRRPQLTERQERVFLWLIALNALLLLLAPI
                     GGATIIHAVLAVLRHG"
     gene            359650..360033
                     /locus_tag="Mnod_8143"
                     /db_xref="GeneID:7295703"
     CDS             359650..360033
                     /locus_tag="Mnod_8143"
                     /inference="similar to AA sequence:KEGG:pRL100167"
                     /note="KEGG: rle:pRL100167  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_002490291.1"
                     /db_xref="GI:220914983"
                     /db_xref="GeneID:7295703"
                     /translation="MTGAEDGLRDDQWERVKDLLPGGRKGKRGPRLQNRLFLDAILWF
                     ARSGGRWKDLPERFGQSDTIKRRYYRLVDRGVFDQILDRLAQDADLEWLMIDSTIVRA
                     HHRAAGARLTKGGRLPRGWAGLAEA"
     misc_feature    359671..359895
                     /locus_tag="Mnod_8143"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     misc_feature    359677..360021
                     /locus_tag="Mnod_8143"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     gene            360009..360416
                     /locus_tag="Mnod_8144"
                     /db_xref="GeneID:7295704"
     CDS             360009..360416
                     /locus_tag="Mnod_8144"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: rle:pRL100168  transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490292.1"
                     /db_xref="GI:220914984"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295704"
                     /translation="MGRSRGGLSTTIHAAVDAHGNPVRLIGGPGQEHDLAKAGALIAG
                     FPAEFTLADKGYDGDPLCDAITAQGSEVVIPPRRGRTHPRSYDKDLYKERNVIERFFA
                     RLKDFRRVATRYDKLLKNYMGFVTLAAIAIWLR"
     misc_feature    360036..360413
                     /locus_tag="Mnod_8144"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    360159..360413
                     /locus_tag="Mnod_8144"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            360864..361289
                     /locus_tag="Mnod_8145"
                     /db_xref="GeneID:7295705"
     CDS             360864..361289
                     /locus_tag="Mnod_8145"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490293.1"
                     /db_xref="GI:220914985"
                     /db_xref="GeneID:7295705"
                     /translation="MMVATLADTSTELLLIAEHDLAEVLVIDEHQDRQTALLLKVAAE
                     LSDELQQAIAALASVGVQRAQRVVRAYVAARAVFENPPPKAKVKIAARVLPRLLRLEE
                     VAARDPDLDRALEQAREAVRKIPARGLAIDWITSKARGR"
     gene            complement(361337..361789)
                     /locus_tag="Mnod_8146"
                     /db_xref="GeneID:7295706"
     CDS             complement(361337..361789)
                     /locus_tag="Mnod_8146"
                     /inference="similar to AA sequence:KEGG:M446_6895"
                     /note="KEGG: met:M446_6895 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490294.1"
                     /db_xref="GI:220914986"
                     /db_xref="GeneID:7295706"
                     /translation="MTTQSDTGARLLIYGERRCSRPSAPSLVASMAALEGMHAAGLPG
                     IVDVILTTRDDTTLEVSFIETLHERQKGHAGRAIEIITEAADAAGVKLILKAQACPPK
                     RARRVLSTNELVRFYERRGIRIVSAALGGGILMERPPERRMRVVGRAA"
     gene            361960..362238
                     /locus_tag="Mnod_8147"
                     /db_xref="GeneID:7295707"
     CDS             361960..362238
                     /locus_tag="Mnod_8147"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490295.1"
                     /db_xref="GI:220914987"
                     /db_xref="GeneID:7295707"
                     /translation="MRTTLLSRAIQRGRGWRKWHTADASEIFFGGANALTDGMRLCWT
                     VQGRVGVVDASANRRLARHTAFDLINNTNVTGALRELNDLAAPHLKAG"
     gene            complement(362301..363998)
                     /locus_tag="Mnod_8148"
                     /db_xref="GeneID:7295708"
     CDS             complement(362301..363998)
                     /locus_tag="Mnod_8148"
                     /inference="protein motif:PFAM:PF01977"
                     /note="PFAM: Carboxylyase-related protein;
                     KEGG: bxe:Bxe_B2353 carboxylyase-related protein"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylyase"
                     /protein_id="YP_002490296.1"
                     /db_xref="GI:220914988"
                     /db_xref="InterPro:IPR002830"
                     /db_xref="GeneID:7295708"
                     /translation="MDATPKSALRRQQSMPEFVAAMEKAGLLVRIPGEKRVDELPMLM
                     EQHYDKAIFVERIQDCEFSFLANAYSNHAQYAWALGCSRSEIGNVTAELAKGRIKPKI
                     VATAPCKEVILKGADVDLSRLPLFLHHDRDGHAYINDNLVVSKDPDTGVTDWGIYRSM
                     FRTINEKNFDMTCASHRGRLNALKYQARGQDMPIAIVLGGPTLDKIAALAGVPPETED
                     FDVLGSFYGAPAELVKCETSDLFVPANAEIVLEGEVMATEGWVYDEGPYGEFTGMYGG
                     GMKHNPRVVIHCMTYRKGAIYQTATIGGAHPGFTDNMLQLPAVESDIYGALCAGGIHV
                     LDVRCPAPGLSNIAYARIKPQGGGDAKQALGIMLTCSKQGLPKIAMVFDADVDIWNDE
                     RIAQSMAFRYMPDRDTIIIPQCNTMSTDPKVGDPDKPFVCSKIGLDCTIPLVGDVDRS
                     AYDWSSACDLGQIPKGVVSMDKDALTKDMEVFIRAAPRSWKEILEHYHGQPYRPIYQA
                     FSTLRPRLGRRSDAPWYRYAFLDSGLADATPSAPKLSNHDPRHQPHFTPPPRAATGA"
     misc_feature    complement(362763..363944)
                     /locus_tag="Mnod_8148"
                     /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
                     Region: UbiD; pfam01977"
                     /db_xref="CDD:251009"
     gene            complement(364015..364649)
                     /locus_tag="Mnod_8149"
                     /pseudo
                     /db_xref="GeneID:7295709"
     gene            complement(364672..365097)
                     /locus_tag="Mnod_8150"
                     /db_xref="GeneID:7295710"
     CDS             complement(364672..365097)
                     /locus_tag="Mnod_8150"
                     /inference="similar to AA sequence:KEGG:AnaeK_1578"
                     /note="KEGG: ank:AnaeK_1578 activator of HSP90 ATPase 1
                     family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="activator of HSP90 ATPase 1 family protein"
                     /protein_id="YP_002490297.1"
                     /db_xref="GI:220914989"
                     /db_xref="GeneID:7295710"
                     /translation="MAEIHHEIKVRAEPDRIREAVTSPTSLQAWHGGRVTVAEGALRF
                     EFEDGAPTFRWAIEPAKSGTEIVWRCLEGPGDSVGTEASFKFSPADKGRTLVEFVHRG
                     WPHTGGNFRKCNTTWAILLHHLRQYLESGKADPALRAPA"
     misc_feature    complement(364711..365091)
                     /locus_tag="Mnod_8150"
                     /note="START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC (SRPBCC)
                     ligand-binding domain superfamily; Region: SRPBCC;
                     cl14643"
                     /db_xref="CDD:265438"
     misc_feature    complement(order(364726..364728,364735..364743,
                     364750..364755,364759..364770,364792..364794,
                     364798..364800,364804..364806,364810..364812,
                     364840..364842,364846..364848,364852..364857,
                     364894..364896,364900..364902,364930..364932,
                     364960..364962,364966..364968,364972..364974,
                     364978..364980,364987..364989,365032..365037,
                     365041..365049,365074..365076,365080..365082,
                     365086..365088))
                     /locus_tag="Mnod_8150"
                     /note="hydrophobic ligand binding site; other site"
                     /db_xref="CDD:176854"
     gene            complement(365168..366550)
                     /locus_tag="Mnod_8151"
                     /db_xref="GeneID:7295711"
     CDS             complement(365168..366550)
                     /locus_tag="Mnod_8151"
                     /inference="protein motif:PFAM:PF07452"
                     /note="PFAM: Hemolysin-type calcium-binding region; CHRD
                     domain containing protein;
                     KEGG: met:M446_1701 5'-nucleotidase domain-containing
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="CHRD domain-containing protein"
                     /protein_id="YP_002490298.1"
                     /db_xref="GI:220914990"
                     /db_xref="InterPro:IPR001343"
                     /db_xref="InterPro:IPR010895"
                     /db_xref="GeneID:7295711"
                     /translation="MSTAFRVIVEGSQEVPPNGSTARGTGTVIFDTTAQAASYSFRIT
                     GVDYGPATGGPAQTETPLDDATSTHFHNQVRGQNGPVVFGQINPAQDNDDLAIVPNAD
                     GSWTVSGRWETTDPANVSIANFSTTLGSATVGSEVPLYFNVHTNQFPAGEIRGQLVAI
                     ADDNNNTVVGTADDELLPGLGGDDIVLGLVGNDTIQGGDGNDFVSGGFGADSVSGDAG
                     NDLVFGDDDDDVADGGEGNDRVHGGTGADRVFGAAGDDQVYGEWGNDFVSGGEGHDFV
                     SGGFGNDEVNGDAGNDLLFGDDGDDAVSGGEGNDRVYGGTGNDLVSGDAGADQLFGEQ
                     GEDVLLGGAGSDYLSGGAGADQLFGGEGADLLFGNAGADALTGGLGSDAFAFGRGDGQ
                     DVIRDFVTGGAERDVIAFNNGALGSFAAVQAALRQEGSDAVIAYGTGDTITLQNVQAS
                     SLTADNFSFS"
     misc_feature    complement(366077..366544)
                     /locus_tag="Mnod_8151"
                     /note="CHRD domain; Region: CHRD; pfam07452"
                     /db_xref="CDD:254207"
     misc_feature    complement(365399..>366061)
                     /locus_tag="Mnod_8151"
                     /note="RTX toxins and related Ca2+-binding proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG2931"
                     /db_xref="CDD:225483"
     misc_feature    complement(365180..>365533)
                     /locus_tag="Mnod_8151"
                     /note="Peptidase M10 serralysin C terminal; Region:
                     Peptidase_M10_C; pfam08548"
                     /db_xref="CDD:117125"
     gene            complement(366990..367948)
                     /locus_tag="Mnod_8152"
                     /pseudo
                     /db_xref="GeneID:7295712"
     gene            368374..368814
                     /locus_tag="Mnod_8153"
                     /db_xref="GeneID:7295713"
     CDS             368374..368814
                     /locus_tag="Mnod_8153"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_3973 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490299.1"
                     /db_xref="GI:220914991"
                     /db_xref="GeneID:7295713"
                     /translation="MGTRVHHPDPLPSPGKCATYFVGLPDTPTIGELLKLKRITSEQI
                     NAAAAAYIADPAPGVREIAKRVKPDIAAAVEAHPYAQKALAQPEATVRERKSVVKRAI
                     LLARPARVSRPTHRSGVAGQRSSRRYGTRDAPHEKSPPRQNRAD"
     gene            complement(369023..369136)
                     /locus_tag="Mnod_8154"
                     /db_xref="GeneID:7295714"
     CDS             complement(369023..369136)
                     /locus_tag="Mnod_8154"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490300.1"
                     /db_xref="GI:220914992"
                     /db_xref="GeneID:7295714"
                     /translation="MAADQITQIEEHIARDEQCLTQLQVVIARQHAWGSTP"
     gene            369428..369637
                     /locus_tag="Mnod_8155"
                     /db_xref="GeneID:7295715"
     CDS             369428..369637
                     /locus_tag="Mnod_8155"
                     /inference="similar to AA sequence:KEGG:M446_2976"
                     /note="KEGG: met:M446_2976 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490301.1"
                     /db_xref="GI:220914993"
                     /db_xref="GeneID:7295715"
                     /translation="MAKLFIGSVRTQGGYRPPITVRATSQAEALWFLRAQYPQDRVEA
                     VLPALWWPPTSDTGRTIGDIREHRC"
     gene            complement(369884..371290)
                     /locus_tag="Mnod_8156"
                     /db_xref="GeneID:7295716"
     CDS             complement(369884..371290)
                     /locus_tag="Mnod_8156"
                     /inference="protein motif:COG:COG5653"
                     /note="KEGG: pmj:P9211_07781 cellulose biosynthesis
                     protein CelD"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein involved in cellulose biosynthesis
                     (CelD)-like protein"
                     /protein_id="YP_002490302.1"
                     /db_xref="GI:220914994"
                     /db_xref="GeneID:7295716"
                     /translation="MPEIEYKFYGDFSDIPTLETVWKAVESPHVFQTYEFVSSWFSIT
                     HHCQRPAVVIGYEQGVPFGILPACVIKRNQFRILSWAPVPLVLDYGDILFNTDAPIRP
                     EEFMRRAIDLAKESASCRTTAFYHVREDATCYPFLQQRFLLASRTIAPYLVAGQPFEA
                     TLRKVREARSNQKANCERNIKRLKEMGQLNLTIYRESSDDAERALAFIFKHKKKQFSR
                     TKIMIDYTDYKNWYIRQIRENRDAFVACLTLNGLPIAGLFGFFWKDRLYYLVPAYDVE
                     FRRYAPGKVLFYLLIKRYSEYIKIFDLGIGDEGYKLQWTIQSCDVFSFIEPTVIGRIV
                     YSSARVIAFAASQIARLKTLWTTFAPMRRIRSAHTRQLSPRSCSRPSTAANPIPAGSQ
                     NALLAPPSLTISARCRWASRRSSATWARPSRADRNSGRSSPAPFTVAPTSSSWTRRRA
                     TLMSQPRLSSLKRYVRSI"
     misc_feature    complement(370190..371251)
                     /locus_tag="Mnod_8156"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_6; cl19151"
                     /db_xref="CDD:267504"
     gene            complement(371409..371675)
                     /locus_tag="Mnod_8157"
                     /db_xref="GeneID:7295717"
     CDS             complement(371409..371675)
                     /locus_tag="Mnod_8157"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490303.1"
                     /db_xref="GI:220914995"
                     /db_xref="GeneID:7295717"
                     /translation="MAGADATLQIVWACDHKGEVRAWALPYDGQVEVEGTAITVVYDP
                     SNGTRSWTAVVMDGDQPTSILEPNDIRTLAERYELRDWSDKRYV"
     gene            371765..372115
                     /locus_tag="Mnod_8158"
                     /db_xref="GeneID:7295718"
     CDS             371765..372115
                     /locus_tag="Mnod_8158"
                     /inference="similar to AA sequence:KEGG:M446_7016"
                     /note="KEGG: met:M446_7016 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490304.1"
                     /db_xref="GI:220914996"
                     /db_xref="GeneID:7295718"
                     /translation="MRRGRDRDDGDGPPSTTAELRAEGITTVEVYCRRTGCRHRAVIA
                     TDRFPDDLSSVRFAFRLRCSRCGARRPEVRRDMLAHYAQIHAETGWGMRASGPLPAHH
                     KVVGRDVPWPDEKR"
     gene            372410..372670
                     /locus_tag="Mnod_8159"
                     /db_xref="GeneID:7295719"
     CDS             372410..372670
                     /locus_tag="Mnod_8159"
                     /inference="similar to AA sequence:KEGG:M446_1863"
                     /note="KEGG: met:M446_1863 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490305.1"
                     /db_xref="GI:220914997"
                     /db_xref="GeneID:7295719"
                     /translation="MPLHTDERWHYEGDAATREKRVYCDDALIGRVRRWHMMEPDGRF
                     SAWFAFEQWQDGAFRPVGGLQATFDEALLHLASLSVPPRACQ"
     gene            373315..373509
                     /locus_tag="Mnod_8160"
                     /db_xref="GeneID:7295720"
     CDS             373315..373509
                     /locus_tag="Mnod_8160"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490306.1"
                     /db_xref="GI:220914998"
                     /db_xref="GeneID:7295720"
                     /translation="MKSTAMADETAPESSTTVAAEAAAGASLRECVAASEAIAGQSDS
                     AAPEARTGKPGSAAQAARSG"
     gene            complement(373542..373688)
                     /locus_tag="Mnod_8161"
                     /db_xref="GeneID:7295721"
     CDS             complement(373542..373688)
                     /locus_tag="Mnod_8161"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490307.1"
                     /db_xref="GI:220914999"
                     /db_xref="GeneID:7295721"
                     /translation="MRDPSDSVRAGTTAASEAVDSGAEPAWELEVSAVVLGLRAEASV
                     EVVR"
     gene            complement(374038..375069)
                     /locus_tag="Mnod_8162"
                     /db_xref="GeneID:7295722"
     CDS             complement(374038..375069)
                     /locus_tag="Mnod_8162"
                     /inference="protein motif:PFAM:PF02388"
                     /note="PFAM: Methicillin resistance protein;
                     KEGG: mta:Moth_2408 methicillin resistance protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Methicillin resistance protein"
                     /protein_id="YP_002490308.1"
                     /db_xref="GI:220915000"
                     /db_xref="InterPro:IPR003447"
                     /db_xref="GeneID:7295722"
                     /translation="MSAEVAVKQPHSEFDRWKTWDAFIEQRADPGFRQLSWYTSLQVA
                     RGWEQFGTVLRYGDAIIGGAMVLARSFAPGKCYYIVPDGPIFLEEDSPSEQEQVFRTV
                     MSFIERKRQTEQRVVSHLCINPRWEHVPEFVTGFRKSSHYYGTPRDTLYIDLTSSESA
                     ILAQMKPKGRYNIRVAQRYGVSVVEDVSSKGIEDFLAVYRETFDRRRKDGRSSGYFHN
                     LIPRLLAADRGSIFFSEYQGTRIATALVVYSGRMATYYYGGSRDVHRNVMAPYLLHFE
                     IMRTAKSRGCLSYDLFGVTPQGAPSDGWQNFSIFKRKFGGREVRFVPTLEHIYDPAAY
                     QEWKEAEDE"
     misc_feature    complement(374065..375018)
                     /locus_tag="Mnod_8162"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_6; cl19151"
                     /db_xref="CDD:267504"
     gene            complement(375316..377619)
                     /locus_tag="Mnod_8163"
                     /db_xref="GeneID:7295779"
     CDS             complement(375316..377619)
                     /locus_tag="Mnod_8163"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter transmembrane region; ABC
                     transporter related; peptidase C39 bacteriocin processing;
                     SMART: AAA ATPase;
                     KEGG: bpd:BURPS668_3619  toxin secretion ABC transporter,
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490309.1"
                     /db_xref="GI:220915001"
                     /db_xref="InterPro:IPR001140"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR005074"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:7295779"
                     /translation="MARVSALEGLNLGWGRRVPMLLQTEAAECGLASLAMVASYFGYQ
                     TGLSELRRRYGMSLKGATLNELMRIADELGFATRPLRLEIAELGQLRLPCILHWDLNH
                     FVVLQKVARGSAVVHDPSVGIRRISKAQLSRHFTGVALELYPTDRFVPATAPARIRAL
                     HLLGRTVGVKRALTNQVVLALAIEVFAIISPLFLQWVVDHALVTADHDLLVTLALGFS
                     LLLLIQTAVTAMRSWMLIGLSATLKIQSRANLFSHLISLPATFFESRHLGDVTSRFSS
                     QETILQVVTTDLVESIIDGIMAGITLVIMVLFAPDLAAVTVLGALLYAGLRWASYTPL
                     REASAEAIVWSARRDSHFLETLRGIRTIKLFNGQEERRAHWLNLLVSTTNRQLSVERL
                     RFLFKTANGLLFGFLKITIIWLGARHIMANTMSVGLLLAFLLYKDQFIERVAELINKL
                     VDLKMLRLHAERLADIALTEPEPRSPVRLRPEGSHPPQAVELRHVSFRYGEHEPWILD
                     NVSLRIEAGESVAIVGPSGGGKTTLLKILSGLVAPTHGEILVNGEPMSRIGLQNYRAM
                     LGVVMQDDQLFAGSIADNISFFAEQPDLPRVVECADLAAVHADIIQMPMGYSTLIGDM
                     GTMLSGGQKQRVLIARALYRRPGILLLDEATSHLDVDRERAVNAALAAACVTRIVIAH
                     RPETIRASGRVITLCNGKVSCHRADEATELHELHLPPATPLTIPNTDVPACRGRVRRC
                     QRKRTKRRRRGARRGARRALARSGRLR"
     misc_feature    complement(375517..377571)
                     /locus_tag="Mnod_8163"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; COG2274"
                     /db_xref="CDD:225183"
     misc_feature    complement(377188..377568)
                     /locus_tag="Mnod_8163"
                     /note="A sub-family of peptidase family C39. Peptidase
                     family C39 mostly contains bacteriocin-processing
                     endopeptidases from bacteria. The cysteine peptidases in
                     family C39 cleave the 'double-glycine' leader peptides
                     from the precursors of various...; Region: Peptidase_C39C;
                     cd02419"
                     /db_xref="CDD:239100"
     misc_feature    complement(order(377266..377268,377314..377316,
                     377533..377535,377551..377553))
                     /locus_tag="Mnod_8163"
                     /note="putative active site [active]"
                     /db_xref="CDD:239100"
     misc_feature    complement(376291..377088)
                     /locus_tag="Mnod_8163"
                     /note="ABC transporter transmembrane region; Region:
                     ABC_membrane; pfam00664"
                     /db_xref="CDD:250039"
     misc_feature    complement(375496..376152)
                     /locus_tag="Mnod_8163"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(376027..376050)
                     /locus_tag="Mnod_8163"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(375574..375576,375661..375666,
                     375904..375906,376024..376032,376036..376041))
                     /locus_tag="Mnod_8163"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(375904..375915)
                     /locus_tag="Mnod_8163"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(375709..375738)
                     /locus_tag="Mnod_8163"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(375661..375678)
                     /locus_tag="Mnod_8163"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(375643..375654)
                     /locus_tag="Mnod_8163"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(375568..375588)
                     /locus_tag="Mnod_8163"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(377607..378938)
                     /locus_tag="Mnod_8164"
                     /db_xref="GeneID:7295780"
     CDS             complement(377607..378938)
                     /locus_tag="Mnod_8164"
                     /inference="protein motif:PFAM:PF00529"
                     /note="PFAM: secretion protein HlyD family protein;
                     KEGG: cvi:CV_0069 secretion protein"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD family protein"
                     /protein_id="YP_002490310.1"
                     /db_xref="GI:220915002"
                     /db_xref="InterPro:IPR003997"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="InterPro:IPR006144"
                     /db_xref="GeneID:7295780"
                     /translation="MSQDGSDSELAAGQKQLPIHRESLFRAEVLAEGQAQWLGTVLLE
                     PRLTHWMFALFASAAVMAIVLLLVFGSYTRKARINGWLVPEQGVVRSFSPQAGVITEV
                     LVQEGMAVRKGSPVLVISTEMLSSAAGATRQEVVRQLKRRRDSMMQEKSVQVRVFENQ
                     INDARKKLDILSAERKHLEVEVGLQKTKIEMADRTAVRLRELRKRDIVTAPRLEEAEK
                     ERLDEAAKLQALERSLATLEREQAEAWATLQAVPLRRQIQENESERSVAALEQDLIEA
                     EARREIVITAPQDGTITGLQAEPGGNATTSIPLFGIVPSRSKLQAQLFSPSRGIGFLR
                     AGQRVLLRYQAFPYQKFGFYGGVVTTVSRSALSPAELNQTLAGLTALFGSNEPIYRVT
                     VELDRQTAVAYGQAVALQPGMQLEADVLIESRRLIEWVLEPLYTLSGSWHA"
     misc_feature    complement(377631..378803)
                     /locus_tag="Mnod_8164"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; TIGR01843"
                     /db_xref="CDD:130902"
     misc_feature    complement(378534..378662)
                     /locus_tag="Mnod_8164"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     cl19169"
                     /db_xref="CDD:267522"
     misc_feature    complement(378096..378452)
                     /locus_tag="Mnod_8164"
                     /note="Apolipophorin-III and similar insect proteins;
                     Region: ApoLp-III_like; cl19113"
                     /db_xref="CDD:267466"
     misc_feature    complement(<377844..378092)
                     /locus_tag="Mnod_8164"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            complement(378947..379906)
                     /locus_tag="Mnod_8165"
                     /db_xref="GeneID:7295781"
     CDS             complement(378947..379906)
                     /locus_tag="Mnod_8165"
                     /inference="similar to AA sequence:KEGG:Smal_2054"
                     /note="KEGG: smt:Smal_2054 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490311.1"
                     /db_xref="GI:220915003"
                     /db_xref="GeneID:7295781"
                     /translation="MDARQHWPMTHGEPQVGVREAWLLGQPGLQDFLDYVEDHAVGVA
                     ALSRSALVDEWRAANDYYHHLELNEAGAADAIEVRDLDPTCAELADAVRADPRYRRAF
                     DKVPTRFAMVELDRLVVAQSHIDLDHADRLQARAGDRLNAQALFRFCQPLGDFEAPVQ
                     IRQAGARRYLFVSASSDLRFHECLLLKPQDLANHAAFGSVSGAVGLIVGFGSNFLSVV
                     QSESRLLLHNGHHRAYALRAMGVRFAPCIIQTATRGEELGLLASSKVMASPSFYFRAA
                     RPPLLKDFFEPRIRKVLQVRRTSQVIELSFEVKDYSVRSLDDA"
     misc_feature    complement(<379487..379873)
                     /locus_tag="Mnod_8165"
                     /note="mycofactocin radical SAM maturase; Region:
                     mycofact_rSAM; TIGR03962"
                     /db_xref="CDD:188477"
     gene            complement(380009..380164)
                     /locus_tag="Mnod_8166"
                     /db_xref="GeneID:7295782"
     CDS             complement(380009..380164)
                     /locus_tag="Mnod_8166"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490312.1"
                     /db_xref="GI:220915004"
                     /db_xref="InterPro:IPR013838"
                     /db_xref="GeneID:7295782"
                     /translation="MRELTIDELTHVYGAGSPSCGSGDRKHGSKSKSKHASRSKKHSK
                     SKSKRHG"
     gene            complement(381027..381662)
                     /locus_tag="Mnod_8167"
                     /pseudo
                     /db_xref="GeneID:7295783"
     gene            complement(381771..382103)
                     /locus_tag="Mnod_8168"
                     /pseudo
                     /db_xref="GeneID:7295784"
     gene            382305..383639
                     /locus_tag="Mnod_8169"
                     /db_xref="GeneID:7295785"
     CDS             382305..383639
                     /locus_tag="Mnod_8169"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_4843 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490313.1"
                     /db_xref="GI:220915005"
                     /db_xref="InterPro:IPR000307"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295785"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPD
                     FRTIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKAAESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKA
                     ALEAEAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGF
                     ATEANLAALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRY
                     RLRKQVVEPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
     misc_feature    382368..382766
                     /locus_tag="Mnod_8169"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    383133..383612
                     /locus_tag="Mnod_8169"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <383394..383624
                     /locus_tag="Mnod_8169"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            383827..383952
                     /locus_tag="Mnod_8170"
                     /db_xref="GeneID:7295786"
     CDS             383827..383952
                     /locus_tag="Mnod_8170"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490314.1"
                     /db_xref="GI:220915006"
                     /db_xref="GeneID:7295786"
                     /translation="MQVLWWNGARWGASGPFGIATMPLDAALDYIASEPLFWINA"
     gene            complement(383975..384886)
                     /locus_tag="Mnod_8171"
                     /db_xref="GeneID:7295787"
     CDS             complement(383975..384886)
                     /locus_tag="Mnod_8171"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: det:DET1315 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490315.1"
                     /db_xref="GI:220915007"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:7295787"
                     /translation="MSWFFIALWAPFLLACANHNDKLLLSKYFKDKTIGPIVIFSSLF
                     SGVAIPIALLIQPNVYEVSLVQGSALVTTGMLSVVAGVFYLYALDLDEASFVTPFYQT
                     VPIFAYFLGYFILGETITLSQGLGSSVIIAGAIALSLEFGQRGIRFKRNVVALMLVAS
                     FLSAINGVVFKLIAVSKGFWVSLFWGFIGQVIAGFIFLVCVPSYRRDFITLLKQQKVP
                     AAGLIALSRTLFSVSEAVTLYATLLAPVALVLVVNSFQPLFVFMLGIVLTLLLPRVAK
                     ESLDRRKMLQKGVGIGLMLAGGYLISR"
     misc_feature    complement(384467..>384679)
                     /locus_tag="Mnod_8171"
                     /note="EamA-like transporter family; Region: EamA;
                     cl17759"
                     /db_xref="CDD:266818"
     misc_feature    complement(383996..>384658)
                     /locus_tag="Mnod_8171"
                     /note="phosphonate utilization associated putative
                     membrane protein; Region: phn_DUF6; TIGR03340"
                     /db_xref="CDD:234171"
     gene            complement(384883..385953)
                     /locus_tag="Mnod_8172"
                     /db_xref="GeneID:7295788"
     CDS             complement(384883..385953)
                     /locus_tag="Mnod_8172"
                     /inference="protein motif:PFAM:PF00534"
                     /note="PFAM: glycosyl transferase group 1;
                     KEGG: met:M446_4785 glycosyl transferase group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_002490316.1"
                     /db_xref="GI:220915008"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:7295788"
                     /translation="MRTFPSNEPHLAFAVPGDLATPTGGYGYDRRIIQELRQLGWQVD
                     VADIGDGFPFPSVVQRATALATLSAVPAGCPTVLDGLAFGALPEAGALRSRTPLIALV
                     HQPLALDSCLDTAQADTFRESERAALAAAARVVVTSEATARVVCTDYDVPVQRISVVR
                     PGNDPVPPALGSSDGVVRLLSVGSVVPVKGYDLLIAAVATLADMPWRLTIAGDRTRNP
                     AIAAQLDADIEAYGLGDRVAVLGAVSPERISDLYLASDVFVLASRFEGYGMALTEAIA
                     HGLPVVSTVAGAIPDTVPSGTGFLVPPNDAAALAQALRYLIGDPAERQRLAANARAAA
                     TQLPTWQDSARLFARAVETVRL"
     misc_feature    complement(384898..>385719)
                     /locus_tag="Mnod_8172"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     misc_feature    complement(384889..>385683)
                     /locus_tag="Mnod_8172"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            complement(386040..386804)
                     /locus_tag="Mnod_8173"
                     /db_xref="GeneID:7295789"
     CDS             complement(386040..386804)
                     /locus_tag="Mnod_8173"
                     /inference="protein motif:PFAM:PF08241"
                     /note="PFAM: UbiE/COQ5 methyltransferase;
                     Methyltransferase type 11; Methyltransferase type 12;
                     KEGG: mba:Mbar_A2874 ubiquinone/menaquinone biosynthesis
                     methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="type 11 methyltransferase"
                     /protein_id="YP_002490317.1"
                     /db_xref="GI:220915009"
                     /db_xref="InterPro:IPR004033"
                     /db_xref="InterPro:IPR013216"
                     /db_xref="InterPro:IPR013217"
                     /db_xref="GeneID:7295789"
                     /translation="MRGVVPTPSYNTTDIRSFFDQCASTGFLEQHGHPQRLLEYRLAL
                     VRSLARPRPSDVVLDLGCGNGHHLLALVPEVARGIGIDVSPGMIELAHARVRSSPWID
                     NLTFEVDDAEELKEIADQSIDLAICIGAFEHMLDKRAVLAGIHRVLKFGGRFFCLTPD
                     ADYVWYRSIAPVLGFATKHLSSDRMLTRDEFSALLDQAGFRRIRSVPWTFIPKGDVPS
                     LVALLLTVLDAIGRHARLDSLRGGLALCAWKEAKPT"
     misc_feature    complement(386049..386777)
                     /locus_tag="Mnod_8173"
                     /note="SAM-dependent methyltransferases [Secondary
                     metabolites biosynthesis, transport, and catabolism /
                     General function prediction only]; Region: SmtA; COG0500"
                     /db_xref="CDD:223574"
     misc_feature    complement(386337..386636)
                     /locus_tag="Mnod_8173"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(386421..386423,386472..386480,
                     386556..386561,386607..386627))
                     /locus_tag="Mnod_8173"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(386921..387157)
                     /locus_tag="Mnod_8174"
                     /pseudo
                     /db_xref="GeneID:7295790"
     gene            387715..388122
                     /locus_tag="Mnod_8175"
                     /db_xref="GeneID:7295791"
     CDS             387715..388122
                     /locus_tag="Mnod_8175"
                     /inference="protein motif:PFAM:PF07681"
                     /note="PFAM: DoxX family protein;
                     KEGG: met:M446_0038 DoxX family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DoxX family protein"
                     /protein_id="YP_002490318.1"
                     /db_xref="GI:220915010"
                     /db_xref="InterPro:IPR011637"
                     /db_xref="GeneID:7295791"
                     /translation="MTRAATLDRHAPTVLSVLRIVAALIFMAHGTQKVLGFPAHPNPP
                     GLMTLSGVAGILELIGGALLALGLFTRPVAFILSGEMAFAYFIAHAPRSFFPVLNGGD
                     AAILYCFVFLYLVFAGPGPLSLDALGSRGRSPR"
     misc_feature    387715..388113
                     /locus_tag="Mnod_8175"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            388294..388521
                     /locus_tag="Mnod_8176"
                     /db_xref="GeneID:7295792"
     CDS             388294..388521
                     /locus_tag="Mnod_8176"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_7034 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490319.1"
                     /db_xref="GI:220915011"
                     /db_xref="GeneID:7295792"
                     /translation="MILNALALKLERQARGDFKGRHCEATLIVQAVSWYLRDALNHAH
                     LQGRGLRTTVTPARLQLCCTRGFNRRAASRP"
     gene            complement(388493..388693)
                     /locus_tag="Mnod_8177"
                     /db_xref="GeneID:7295793"
     CDS             complement(388493..388693)
                     /locus_tag="Mnod_8177"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490320.1"
                     /db_xref="GI:220915012"
                     /db_xref="GeneID:7295793"
                     /translation="MALWSRNGAPETVKRLAEFNDRLADHCGRALLLVGTAADHSARV
                     RNNPENLLTAGSPVTAATPLGD"
     gene            complement(388662..389783)
                     /locus_tag="Mnod_8178"
                     /db_xref="GeneID:7295794"
     CDS             complement(388662..389783)
                     /locus_tag="Mnod_8178"
                     /inference="protein motif:PFAM:PF01546"
                     /note="PFAM: peptidase M20; peptidase dimerisation domain
                     protein;
                     KEGG: mrd:Mrad2831_2432 acetylornithine deacetylase or
                     succinyl-diaminopimelate desuccinylase"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M20"
                     /protein_id="YP_002490321.1"
                     /db_xref="GI:220915013"
                     /db_xref="InterPro:IPR001261"
                     /db_xref="InterPro:IPR002933"
                     /db_xref="InterPro:IPR011650"
                     /db_xref="GeneID:7295794"
                     /translation="MNNPEVLALDLVRFDTISPPGSESACAAHLAVLLRRAGFDVTDY
                     PFAPGRTSLVARLPGTNPALAPLVFTGHLDTVPLGSAPWSFDPRGEIRDGRLYGRGAS
                     DMKAGVAAFVAAVLDVAHSAAVLTRGVTLVLTAGEETGCLGAADLARRGVLGEASGLV
                     VAEPTSNRLALAHKGALHLRARTHGATAHGSMPELGDNAVLKATRAVEALRNFEFGVP
                     THPLLGSPTLAVTSLHGGEAVNVIPDSCTLTLDLRTLPGQDHARTLAMLQDQLGPDVV
                     FDPPLADLPAVGTEPSDGFAMAAARSVRKVTQEVGEAIGMPYFTDGSVLQGAFGGCPT
                     VILGPGEPGQAHQTNEWCATSAITIAHRIYGALVQEWCA"
     misc_feature    complement(388728..389771)
                     /locus_tag="Mnod_8178"
                     /note="succinyl-diaminopimelate desuccinylase; Reviewed;
                     Region: PRK08588"
                     /db_xref="CDD:181490"
     misc_feature    complement(388680..389765)
                     /locus_tag="Mnod_8178"
                     /note="Peptidase M20 acetylornithine
                     deacetylase/succinyl-diaminopimelate desuccinylase
                     (ArgE/DapE)-like; Region: M20_ArgE_DapE_like; cd08659"
                     /db_xref="CDD:193570"
     misc_feature    complement(order(388746..388748,389295..389297,
                     389370..389375,389475..389477,389568..389570))
                     /locus_tag="Mnod_8178"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:193570"
     misc_feature    complement(order(388833..388835,389025..389027,
                     389031..389033,389055..389060,389076..389099,
                     389103..389105,389151..389153,389160..389165,
                     389169..389174,389181..389186,389190..389192,
                     389208..389219,389250..389252))
                     /locus_tag="Mnod_8178"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:193570"
     gene            complement(391070..393307)
                     /locus_tag="Mnod_8179"
                     /db_xref="GeneID:7295795"
     CDS             complement(391070..393307)
                     /locus_tag="Mnod_8179"
                     /inference="protein motif:TFAM:TIGR00198"
                     /note="TIGRFAM: catalase/peroxidase HPI;
                     PFAM: Haem peroxidase;
                     KEGG: mes:Meso_0626 catalase/peroxidase HPI"
                     /codon_start=1
                     /transl_table=11
                     /product="catalase/peroxidase HPI"
                     /protein_id="YP_002490322.1"
                     /db_xref="GI:220915014"
                     /db_xref="InterPro:IPR000763"
                     /db_xref="InterPro:IPR002016"
                     /db_xref="GeneID:7295795"
                     /translation="MDAKVDDTGEGKCPITGSRRGRTNRDWWPNHLDIQVLHRNSSLS
                     DPMGEDFDYAKEFKTLDLNAVIKDLHALMTDSQDWWPADFGHYGGLMIRMAWHSAGTY
                     RITDGRGGAGAGQQRFAPLNSWPDNANLDKARRLLWPIKQKYGRKISWADLMILAGNV
                     ALESMGFKTFGFAGGRKDVWEPEELYWGPEGTWLGDERYSGERQLQEPLGAVQMGLIY
                     VNPEGPNGKPDPVAAARDIRETFFRMAMNDEETVALIAGGHTFGKTHGAGDPSFMGPE
                     PEAGALEDQGLGWKSRHGRGFGPDTITGGPEVIWSQTPTKWSNYFFDNLFKYEWELTK
                     SPAGAWQWQAKGAEPTIPDPFDESKKRMPTMLITDLALRLDPAYEKISRRFYEHPDQF
                     ADAFARAWFKLTHRDMGPIQRYLGPLVPKEVLIWQDPIPALDHEVVNEQDIAVLKAKI
                     LASGPSVPQLVSTAWASASTFRGSDKRGGANGARIRLAPQKDWEVNQPAELAKVLQKL
                     EVIQKEFNASQKGGKKVSLADLIVLGGCAAVEKAAKDAETPVTVPFTPGRMDASQEQT
                     DVDSFAPLEPRADGFRNYISGRRQFMMPEEALVDRAQLLRLTAPEMTVLVGGLRVLGA
                     NVGQSKHGVFTNRPGMLTNDFFLNLLDMGTQWHHAGGDVYEGRDRKTNELRWTGTRVD
                     LIFGSHSQLRALAEVYGCADSQEKFVKDFVAAWTKVMNLDRFDVAGRIAEKAADLKVS
                     VDAAL"
     misc_feature    complement(391127..393286)
                     /locus_tag="Mnod_8179"
                     /note="catalase/hydroperoxidase HPI(I); Provisional;
                     Region: PRK15061"
                     /db_xref="CDD:237891"
     misc_feature    complement(392036..393250)
                     /locus_tag="Mnod_8179"
                     /note="N-terminal catalytic domain of
                     catalase-peroxidases; Region: catalase_peroxidase_1;
                     cd00649"
                     /db_xref="CDD:173824"
     misc_feature    complement(order(392447..392455,392459..392464,
                     392474..392476,392480..392482,392729..392737,
                     392750..392755,392756..392758,392762..392770,
                     392858..392860,392870..392875,392882..392884,
                     392894..392896,392903..392905,392939..392944,
                     392948..392959,393071..393073,393194..393196,
                     393209..393211,393215..393217,393224..393232,
                     393236..393250))
                     /locus_tag="Mnod_8179"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:173824"
     misc_feature    complement(order(392108..392110,392120..392122,
                     392204..392206,392210..392212,392378..392380,
                     392396..392401,392513..392527,392531..392536,
                     392543..392548,392585..392587,392645..392647,
                     392651..392653,393020..393022,393029..393034,
                     393038..393043))
                     /locus_tag="Mnod_8179"
                     /note="active site"
                     /db_xref="CDD:173824"
     misc_feature    complement(order(392108..392110,392120..392122,
                     392204..392206,392210..392212,392378..392380,
                     392396..392401,392513..392527,392531..392536,
                     392543..392548,392585..392587,392645..392647,
                     392651..392653,393020..393022,393029..393034,
                     393038..393043))
                     /locus_tag="Mnod_8179"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:173824"
     misc_feature    complement(391139..392026)
                     /locus_tag="Mnod_8179"
                     /note="C-terminal non-catalytic domain of
                     catalase-peroxidases; Region: catalase_peroxidase_2;
                     cd08200"
                     /db_xref="CDD:173828"
     gene            complement(393335..394216)
                     /locus_tag="Mnod_8180"
                     /db_xref="GeneID:7295796"
     CDS             complement(393335..394216)
                     /locus_tag="Mnod_8180"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: bpm:BURPS1710b_A1438 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490323.1"
                     /db_xref="GI:220915015"
                     /db_xref="GeneID:7295796"
                     /translation="MTWAGRMRCRASRTATRRLSCTDQRISGRAVLASPDFLGAARWP
                     DGGSPSAWRRPASPARCAGASHARSGSRCGRARVRSWPKASAMAQRRPSTATRVAIGV
                     PAGHHVVQEARSPSLRLRRISRPRVHSLSSRAGSTAPAGRVVADGRIELFAAPCHLGA
                     EMLLELVNLHRQCGLGDRASGRGAAEMTVLRECRDRSAHHRNQAIRLDMIARGGHGMW
                     QWPGGALPSAPREAPAPRLSSPLQSRSTLWRMSCQHKTIADRSAPLDCYDEVNKRVIG
                     FALEAETNLPQSTAEHR"
     gene            complement(394402..394707)
                     /locus_tag="Mnod_8181"
                     /db_xref="GeneID:7295797"
     CDS             complement(394402..394707)
                     /locus_tag="Mnod_8181"
                     /inference="similar to AA sequence:KEGG:M446_5558"
                     /note="KEGG: met:M446_5558 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490324.1"
                     /db_xref="GI:220915016"
                     /db_xref="GeneID:7295797"
                     /translation="MFLARFSYDVLPVNRQQAIEHIRREIEAARANGLKARLLVPLTR
                     VQRCAALQFEVELTNLDQLDQFRRGGVGSEGETSEWMRSFSDILQSPPLVEILRAED"
     gene            complement(395025..395435)
                     /locus_tag="Mnod_8182"
                     /db_xref="GeneID:7295798"
     CDS             complement(395025..395435)
                     /locus_tag="Mnod_8182"
                     /inference="similar to AA sequence:KEGG:Mext_0357"
                     /note="KEGG: mex:Mext_0357 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490325.1"
                     /db_xref="GI:220915017"
                     /db_xref="GeneID:7295798"
                     /translation="MADPGVSFDSWPAIVVGITAALAGALVPLNGFIKTLLDYRLEAK
                     KAEALQAETARDVASASGPTVLDSIAIADLTDAVKELALAIREDTASDTARHNDQLIS
                     VLERLTDRLGDLEQGGRGPHQGQHRGSRRDQHHR"
     gene            complement(395410..395970)
                     /locus_tag="Mnod_8183"
                     /db_xref="GeneID:7295799"
     CDS             complement(395410..395970)
                     /locus_tag="Mnod_8183"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mex:Mext_0356 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490326.1"
                     /db_xref="GI:220915018"
                     /db_xref="GeneID:7295799"
                     /translation="MRIPPRHCWLAYLAPWPNQAMIQYDPDPVINERIRRAVRYGQTR
                     WAEVWLSLIMMTLGGVLLLPEPTFVGPEWRVIASCVTERTAGTISVSVGGARILALWI
                     NGRRGRETSLIRTLGCMSGFAFWLVTAAGVAAAYPPLSTGIAVYGVLALAELHSSGRA
                     ASDMAAEDTFGLRKRRRAGGRPGRLL"
     gene            complement(395998..396510)
                     /locus_tag="Mnod_8184"
                     /db_xref="GeneID:7295800"
     CDS             complement(395998..396510)
                     /locus_tag="Mnod_8184"
                     /inference="similar to AA sequence:KEGG:Mpop_3758"
                     /note="KEGG: mpo:Mpop_3758 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490327.1"
                     /db_xref="GI:220915019"
                     /db_xref="GeneID:7295800"
                     /translation="MIRKLSLAALALCALAAPALAAEVTAVANTAVVVPWGDWIVAIA
                     QTITSVLVPILVTVITAAIALIAPWLQLFITQKRIQQMVEACLEYALNTVEGAAKGKA
                     LNVEIGSKVLATAVNRALNAAPAAVVRAAGGPKGVARTIFRALHLDETANANAVLTPV
                     LNGLPAAARK"
     sig_peptide     complement(396445..396510)
                     /locus_tag="Mnod_8184"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.996 at
                     residue 22"
     gene            complement(396570..396871)
                     /locus_tag="Mnod_8185"
                     /pseudo
                     /db_xref="GeneID:7295801"
     gene            complement(396871..397143)
                     /locus_tag="Mnod_8186"
                     /db_xref="GeneID:7295802"
     CDS             complement(396871..397143)
                     /locus_tag="Mnod_8186"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: bvi:Bcep1808_1030 ribonuclease E"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490328.1"
                     /db_xref="GI:220915020"
                     /db_xref="GeneID:7295802"
                     /translation="MKAVRRGQTYYLGDGINKVLATAAEVEKAIAKAKSLGNAAPAPA
                     PVVVRVAEPVVVVPATPATPVPPAVLATTGFVARLGGWIDRVFGAA"
     gene            complement(397238..398068)
                     /locus_tag="Mnod_8187"
                     /db_xref="GeneID:7295803"
     CDS             complement(397238..398068)
                     /locus_tag="Mnod_8187"
                     /inference="protein motif:PFAM:PF01844"
                     /note="PFAM: HNH endonuclease;
                     SMART: HNH nuclease;
                     KEGG: mex:Mext_1995 regulatory protein LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="YP_002490329.1"
                     /db_xref="GI:220915021"
                     /db_xref="InterPro:IPR002711"
                     /db_xref="InterPro:IPR003615"
                     /db_xref="GeneID:7295803"
                     /translation="MTSPGFEQGTAEYVAEGWPARTDRAARLFAKQHSGFLTDLDVYT
                     PAEIEVEPVFRDFLRPRGLGWGVASAVTVPSGDRLIFNVERAFARGPVTRDVVARLDA
                     LRPHLARAATMSARLRLQTVRAAAQALDVVGVPAAILGRQLQVLAVNAGCEALFGYTV
                     QEARRFALTHPEADNPRTARPMPKTADAELQTPEHRAWRLAVLQRAGWCCEDCGAQGG
                     RGGVRLFADHVIERQDGGALTDPNNGRCLCGSCHTRKTVAERARRMAVRSAAAEPGRG
                     "
     misc_feature    complement(397301..397483)
                     /locus_tag="Mnod_8187"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    complement(order(397301..397303,397313..397315,
                     397322..397327,397337..397342,397376..397378,
                     397382..397390,397394..397396))
                     /locus_tag="Mnod_8187"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            complement(398065..398217)
                     /locus_tag="Mnod_8188"
                     /db_xref="GeneID:7295804"
     CDS             complement(398065..398217)
                     /locus_tag="Mnod_8188"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mex:Mext_1995 regulatory protein LuxR"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490330.1"
                     /db_xref="GI:220915022"
                     /db_xref="GeneID:7295804"
                     /translation="MDAEAGDLIDRIYEAAVLPEFWPNVLSDLARFGEGDAPFSSRRR
                     GTIFVT"
     gene            complement(398444..398800)
                     /locus_tag="Mnod_8189"
                     /db_xref="GeneID:7295805"
     CDS             complement(398444..398800)
                     /locus_tag="Mnod_8189"
                     /inference="similar to AA sequence:KEGG:Daud_1705"
                     /note="KEGG: dau:Daud_1705 NusG antitermination factor"
                     /codon_start=1
                     /transl_table=11
                     /product="NusG antitermination factor"
                     /protein_id="YP_002490331.1"
                     /db_xref="GI:220915023"
                     /db_xref="GeneID:7295805"
                     /translation="MRRPVFPGYAFVGKRPEQSWRDILRVPGVRALVTTGEAPTELPP
                     WMMKMLIAADEMAAYDRPRPQLAVGDKVQIRDELWEGLIGEVMRAPEGRRIAVLLKAF
                     GKKHVLSVDVDRLAAK"
     misc_feature    complement(398666..>398797)
                     /locus_tag="Mnod_8189"
                     /note="Transcription termination factor nusG; Region:
                     NusG; pfam02357"
                     /db_xref="CDD:251244"
     misc_feature    complement(398462..398605)
                     /locus_tag="Mnod_8189"
                     /note="KOW: an acronym for the authors' surnames
                     (Kyrpides, Ouzounis and Woese); Region: KOW; cl00354"
                     /db_xref="CDD:260377"
     gene            complement(398830..399351)
                     /locus_tag="Mnod_8190"
                     /db_xref="GeneID:7295806"
     CDS             complement(398830..399351)
                     /locus_tag="Mnod_8190"
                     /inference="similar to AA sequence:KEGG:Mrad2831_5181"
                     /note="KEGG: mrd:Mrad2831_5181  transposase of insertion
                     sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase of insertion sequence"
                     /protein_id="YP_002490332.1"
                     /db_xref="GI:220915024"
                     /db_xref="GeneID:7295806"
                     /translation="MFLDETAATTSMVRRYGWAPRGERCRLAAPAGHWKTTTVIAGLR
                     TSGPDAIALLDGPVTGERFRAYVTDTLVPTLRPGDTVILDNLGAHKVAGVREAIAATG
                     ARLLYLPPYSPEFNPIEQAFAKLKALLRRAAARSVSELWAAIHQAFKCFSPAECRNYF
                     TAAGYEDDAYAST"
     misc_feature    complement(398929..399348)
                     /locus_tag="Mnod_8190"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            complement(399408..400046)
                     /locus_tag="Mnod_8191"
                     /db_xref="GeneID:7295807"
     CDS             complement(399408..400046)
                     /locus_tag="Mnod_8191"
                     /inference="protein motif:COG:COG3415"
                     /note="KEGG: mrd:Mrad2831_5182 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="Transposase and inactivated derivatives-like
                     protein"
                     /protein_id="YP_002490333.1"
                     /db_xref="GI:220915025"
                     /db_xref="GeneID:7295807"
                     /translation="MSTLESIVGTAPAYDPSLTYYAASVAGHGEYRACEWLQKAGFVT
                     LVPSRTAVVRQASRAGSERVETVVMATRWPVPGGAAQRRWPMPSALSVDLRQRVVSAV
                     AEGASCHQAAARFGVSVASVSRWSRQQEGQGDVTPKPMGGDQRSQRIEAHAELILQTY
                     QAHPQSFLHELCETLQEQGVPVSRSSLSRFFARHRITRKKGRRTQLSRSGRM"
     misc_feature    complement(399447..399782)
                     /locus_tag="Mnod_8191"
                     /note="Homeodomain-like domain; Region: HTH_23; cl17451"
                     /db_xref="CDD:266692"
     misc_feature    complement(399465..399764)
                     /locus_tag="Mnod_8191"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     gene            complement(400095..400265)
                     /locus_tag="Mnod_8192"
                     /db_xref="GeneID:7295808"
     CDS             complement(400095..400265)
                     /locus_tag="Mnod_8192"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_6580 MucR family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="YP_002490334.1"
                     /db_xref="GI:220915026"
                     /db_xref="GeneID:7295808"
                     /translation="MRQGRRRARGASPERYREKWGLPLAYLMAAAAYAAQRSELAKLH
                     GLGRRAAAKTAA"
     sig_peptide     complement(400161..400265)
                     /locus_tag="Mnod_8192"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.902) with cleavage site probability 0.895 at
                     residue 35"
     misc_feature    complement(400098..>400232)
                     /locus_tag="Mnod_8192"
                     /note="ROS/MUCR transcriptional regulator protein; Region:
                     ROS_MUCR; cl19880"
                     /db_xref="CDD:268233"
     gene            complement(400595..401254)
                     /locus_tag="Mnod_8193"
                     /db_xref="GeneID:7295809"
     CDS             complement(400595..401254)
                     /locus_tag="Mnod_8193"
                     /inference="similar to AA sequence:KEGG:M446_1546"
                     /note="KEGG: met:M446_1546 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490335.1"
                     /db_xref="GI:220915027"
                     /db_xref="GeneID:7295809"
                     /translation="MSPLPERTESLTAPPTDPSGPIAGRPGHSLARRAIDEAERYLWF
                     ALYLIVILGTLILFSLNIYARIDQDVPRYPGYHFYALGLINALVFAKIMLIAEAAGVG
                     SRFIGRRLEAGRLVMVILYRALAFTVVLVAAYVLEAVLEGAWHGKAVGQVLPEIAGGP
                     LGLVSLAWIMLVALVPYFAYRELGRVLGHARLQAIMLKPGGTFRDGADPQTASQSRFA
                     A"
     gene            401807..403141
                     /locus_tag="Mnod_8194"
                     /db_xref="GeneID:7295810"
     CDS             401807..403141
                     /locus_tag="Mnod_8194"
                     /inference="protein motif:PFAM:PF01609"
                     /note="PFAM: transposase IS4 family protein;
                     KEGG: xau:Xaut_4843 transposase IS4 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS4 family protein"
                     /protein_id="YP_002490336.1"
                     /db_xref="GI:220915028"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="GeneID:7295810"
                     /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLS
                     AILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDVMAVTGLNRPD
                     FRTIAEFRKRHLAALSDLFVQVLRLCQAAGLVGFAHVAVDGTKLKANASRHKAMSYGR
                     MKTTEAALAAEVEAWLAQAAEMDAAEDRAHGMDRRGDETPDWMADKQRRLAAIRAAKA
                     ALEAEAADPPAPEDESGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTEPDSRILPTRD
                     GFVQGYNGQIAVDAAHQVIVAQRLVTNAADYRALVPLIDDVSAHLGRKPREVSGDAGF
                     ATEANLTALQARRIRGYLPPGRARHGEAHAAGRRKLTKMPLMSAMAQRLKRAGRRSRY
                     RLRKQVVEPVFGQMKQARGFRQFLLRGLEQVRGEWAMICTAHNLLKLAQAAR"
     misc_feature    401870..402268
                     /locus_tag="Mnod_8194"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    402635..403114
                     /locus_tag="Mnod_8194"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    <402896..403126
                     /locus_tag="Mnod_8194"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            complement(403362..404810)
                     /locus_tag="Mnod_8195"
                     /db_xref="GeneID:7295811"
     CDS             complement(403362..404810)
                     /locus_tag="Mnod_8195"
                     /inference="protein motif:PFAM:PF06863"
                     /note="PFAM: protein of unknown function DUF1214; protein
                     of unknown function DUF1254;
                     KEGG: met:M446_6753 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490337.1"
                     /db_xref="GI:220915029"
                     /db_xref="InterPro:IPR010621"
                     /db_xref="InterPro:IPR010679"
                     /db_xref="GeneID:7295811"
                     /translation="MGVTRRIFATGAATIPLIGSGFPRASAQNAAQDALLIGNNAVAD
                     PLELATDAYIYGYPLVTMEMTRRVLTNVVAPEGKSAPMGQFANLREYPDAKFRAVTAP
                     NADTLYSSAFLDVGREPYILSIPNEDGRYFLMPMLSAWTNVFSVPGKRTTGTGPQTYF
                     IAGPGWSGSVPSGAKLIQAPTSLVWIIGRTYCTGTPEDYKTVHALQDQYRLIPASAAA
                     TSYTPPAGQVDPGIDTKTAVREQVNNLDAATYFNLLAALMKDNPPALADGVAVAKMAS
                     LGIVSGRTFDPRGLTPSVREAVEQAPKQAISRIMGHMKTTGRHINGWTFTTDGGDYGK
                     DYLQRALVTAVGLGCNLPQDAVYPLTTVDAAGRRLAGTSKYVMRFPAGELPPVDGFWS
                     LTMYDANFFFVDNPLNRYTVSPRNNLQTNPDGSVDLFIQTESPGPQRESNWLPAPTGP
                     FILMLRTYWPKDALLNGSWAPPPVTRGAGAAL"
     sig_peptide     complement(404727..404810)
                     /locus_tag="Mnod_8195"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.990) with cleavage site probability 0.721 at
                     residue 28"
     misc_feature    complement(403383..404759)
                     /locus_tag="Mnod_8195"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5361"
                     /db_xref="CDD:227659"
     misc_feature    complement(404178..404564)
                     /locus_tag="Mnod_8195"
                     /note="Protein of unknown function (DUF1254); Region:
                     DUF1254; pfam06863"
                     /db_xref="CDD:253949"
     misc_feature    complement(403422..403547)
                     /locus_tag="Mnod_8195"
                     /note="Protein of unknown function (DUF1214); Region:
                     DUF1214; pfam06742"
                     /db_xref="CDD:253888"
     gene            406049..406399
                     /locus_tag="Mnod_8196"
                     /db_xref="GeneID:7295812"
     CDS             406049..406399
                     /locus_tag="Mnod_8196"
                     /inference="similar to AA sequence:KEGG:M446_1257"
                     /note="KEGG: met:M446_1257 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490338.1"
                     /db_xref="GI:220915030"
                     /db_xref="GeneID:7295812"
                     /translation="MTSQNPFEVPAELRDFADKSLAQAQQAVAAFFQNTRKLNETVQS
                     SFKASQLPVSVAYARSLDFAEQNADAAFAVAHKIIRARDLQEAGQIRAEYLRAQFDTF
                     QAQAKEIYSVAKAA"
     misc_feature    406070..406396
                     /locus_tag="Mnod_8196"
                     /note="Phasin protein; Region: Phasin_2; cl11491"
                     /db_xref="CDD:245658"
     gene            406469..407113
                     /locus_tag="Mnod_8197"
                     /db_xref="GeneID:7295813"
     CDS             406469..407113
                     /locus_tag="Mnod_8197"
                     /inference="similar to AA sequence:KEGG:M446_1256"
                     /note="KEGG: met:M446_1256 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490339.1"
                     /db_xref="GI:220915031"
                     /db_xref="GeneID:7295813"
                     /translation="MAARRGRRSTSAQRGSSMTEAVAPGEQITEAGDEQAVLPPTEGE
                     QTSLEAVPVYDPEPLPAQEEAPEALMSEAAQSEADEPASASEIIAAEPEPIAVHSLEV
                     SAPEISGEIPAPAPATNEHAVAGVSAAPQPAATQASVYSIATRLLEKAGAQQRIWFSY
                     AESELKAKLTYGRVLSKSRTPVDVILASNAEYLRALVASSNVLSEIVADGITLA"
     misc_feature    <406526..406840
                     /locus_tag="Mnod_8197"
                     /note="ribonuclease E; Reviewed; Region: rne; PRK10811"
                     /db_xref="CDD:236766"
     gene            407158..407439
                     /locus_tag="Mnod_8198"
                     /db_xref="GeneID:7295814"
     CDS             407158..407439
                     /locus_tag="Mnod_8198"
                     /inference="similar to AA sequence:KEGG:M446_5739"
                     /note="KEGG: met:M446_5739  signal peptide"
                     /codon_start=1
                     /transl_table=11
                     /product="signal peptide"
                     /protein_id="YP_002490340.1"
                     /db_xref="GI:220915032"
                     /db_xref="GeneID:7295814"
                     /translation="MLISCLEATLLLIEGQKVVELRLMKLARGGLEAWLEAQLMVSEK
                     VSAAFEAAGMLVVGKGFEAVIVRYREHVAANTQRLSTATTSDLHPQAWS"
     gene            complement(407881..409525)
                     /locus_tag="Mnod_8199"
                     /pseudo
                     /db_xref="GeneID:7295815"
     gene            409743..410378
                     /locus_tag="Mnod_8200"
                     /db_xref="GeneID:7295816"
     CDS             409743..410378
                     /locus_tag="Mnod_8200"
                     /inference="protein motif:PFAM:PF06080"
                     /note="PFAM: protein of unknown function DUF938;
                     KEGG: met:M446_4540 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490341.1"
                     /db_xref="GI:220915033"
                     /db_xref="InterPro:IPR010342"
                     /db_xref="GeneID:7295816"
                     /translation="MLEWDAVLGQTGSSGDALFAPAVARNREVILDVLRRVLPPTGLI
                     LEVASGSGEHVVHFASALPDLQWQPSDADPKALRSIAAHAQASGVPNILSPMPLDVRE
                     ERWPVARADAVLAINMVHIAPWAATEGLMAGAGRVLPEGGLLYLYGPFRVAGVHTAPS
                     NAAFDADLRARDPAWGVRDVEAVSAAALAQGLTLLDRIPMPANNFSLVYSR"
     misc_feature    409797..410375
                     /locus_tag="Mnod_8200"
                     /note="Protein of unknown function (DUF938); Region:
                     DUF938; pfam06080"
                     /db_xref="CDD:253548"
     gene            410500..410610
                     /locus_tag="Mnod_8201"
                     /db_xref="GeneID:7295817"
     CDS             410500..410610
                     /locus_tag="Mnod_8201"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490342.1"
                     /db_xref="GI:220915034"
                     /db_xref="GeneID:7295817"
                     /translation="MEFRIPKPISAQAHRRFDMLAFPGLLALTAWRAALC"
     gene            complement(410927..411580)
                     /locus_tag="Mnod_8202"
                     /db_xref="GeneID:7295818"
     CDS             complement(410927..411580)
                     /locus_tag="Mnod_8202"
                     /inference="protein motif:PFAM:PF05023"
                     /note="PFAM: Phytochelatin synthase;
                     KEGG: bja:bll7663 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Phytochelatin synthase"
                     /protein_id="YP_002490343.1"
                     /db_xref="GI:220915035"
                     /db_xref="InterPro:IPR007719"
                     /db_xref="GeneID:7295818"
                     /translation="MKLKLIATACLALGIPGAIALAPISPRVSPEAIQSAVTRSGPLL
                     DRAWQLPVAASFRRDLVWQSNVSLCGPASVASAFRSLNERADTESAVLAGTGRCWTGF
                     CVLGLTLDQLADVARTHTKRKVIVLRDLSADEFREHMRRANDSGRRYIINFSRASIFG
                     GGAGHHSPVGGYMEAEDLVFVLDVNRNYQPWLIERPRLYSAMDTLDGDKKRGLLLIE"
     sig_peptide     complement(411518..411580)
                     /locus_tag="Mnod_8202"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.976 at
                     residue 21"
     misc_feature    complement(410930..411508)
                     /locus_tag="Mnod_8202"
                     /note="Phytochelatin synthase; Region: Phytochelatin;
                     pfam05023"
                     /db_xref="CDD:252952"
     gene            complement(411623..411811)
                     /locus_tag="Mnod_8203"
                     /db_xref="GeneID:7295819"
     CDS             complement(411623..411811)
                     /locus_tag="Mnod_8203"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490344.1"
                     /db_xref="GI:220915036"
                     /db_xref="GeneID:7295819"
                     /translation="MGRLWDGGGKLGGYASRRVNALTFATSVDGPDGASGKQCSTVGF
                     CTRRQSVLISGAATAPPM"
     gene            411874..412392
                     /locus_tag="Mnod_8204"
                     /db_xref="GeneID:7295820"
     CDS             411874..412392
                     /locus_tag="Mnod_8204"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490345.1"
                     /db_xref="GI:220915037"
                     /db_xref="GeneID:7295820"
                     /translation="MRAFMIKHNAGSRRVLSFAGPVLTMTQDVTKLAKVKLEEARQRP
                     IVAEESPTLPALSMPASTPTTALGGRQVASDRADDLARGDHLAVEQLLSRPVEFSRLM
                     TPVRDRLFALPLQLGERRRLHGSLTSIMNARMFSDGATKLGPDTTGVVEVIKQDATVM
                     APDEPGPEKSVL"
     gene            412389..412544
                     /locus_tag="Mnod_8205"
                     /db_xref="GeneID:7295821"
     CDS             412389..412544
                     /locus_tag="Mnod_8205"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490346.1"
                     /db_xref="GI:220915038"
                     /db_xref="GeneID:7295821"
                     /translation="MIDTLSWLFGRADHAVLYHDVGLALFAFAVVGWCAERILGRRQT
                     HERPAEG"
     gene            complement(412831..413514)
                     /locus_tag="Mnod_8206"
                     /db_xref="GeneID:7295822"
     CDS             complement(412831..413514)
                     /locus_tag="Mnod_8206"
                     /inference="protein motif:PFAM:PF03741"
                     /note="PFAM: Integral membrane protein TerC;
                     KEGG: mes:Meso_0688 integral membrane protein TerC"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane protein TerC"
                     /protein_id="YP_002490347.1"
                     /db_xref="GI:220915039"
                     /db_xref="InterPro:IPR005496"
                     /db_xref="GeneID:7295822"
                     /translation="MSELLTAEALSALFEVIMIDLVLAGDNAIVIGLAAAGLPREQRN
                     KAILIGIAAATVLRIVFAGLVSQLLAIVGLLLAGGILLLWVCWKMWRESRAGHVEKDL
                     EADEALEDRDLGQDGLIAEHAPRKTFGQAAWQIVVADVSMSLDNVLAVAGAAREHPVA
                     LIFGLGLSIALMGIAASFIARLLQKYHWIGYIGLAIILYVALDMIYRGFLEVWPVVSS
                     VVGSGIDLS"
     misc_feature    complement(412891..413481)
                     /locus_tag="Mnod_8206"
                     /note="integral membrane protein, YjbE family; Region:
                     R_switched_YjbE; TIGR03717"
                     /db_xref="CDD:163429"
     gene            complement(414968..415393)
                     /locus_tag="Mnod_8207"
                     /db_xref="GeneID:7295823"
     CDS             complement(414968..415393)
                     /locus_tag="Mnod_8207"
                     /inference="similar to AA sequence:KEGG:Mext_2437"
                     /note="KEGG: mex:Mext_2437 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490348.1"
                     /db_xref="GI:220915040"
                     /db_xref="GeneID:7295823"
                     /translation="MAEPPEPADPLPAWTAKDIERWVIIPMRLLRESAVATRPGNALR
                     STDLEQPSASFDILAFAHTVLTDKDEFLALTTYARIRAAGGDAEASIAEWCREKGWQE
                     RTFHRRRVRACERLAAAKNAASLAEGENRSGFGTRPARR"
     gene            complement(415466..415735)
                     /locus_tag="Mnod_8208"
                     /pseudo
                     /db_xref="GeneID:7295824"
     gene            complement(415980..416855)
                     /locus_tag="Mnod_8209"
                     /db_xref="GeneID:7295825"
     CDS             complement(415980..416855)
                     /locus_tag="Mnod_8209"
                     /inference="protein motif:PFAM:PF00583"
                     /note="PFAM: GCN5-related N-acetyltransferase; regulatory
                     protein MarR;
                     KEGG: bra:BRADO2365 transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="MarR family transcriptional regulator"
                     /protein_id="YP_002490349.1"
                     /db_xref="GI:220915041"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="GeneID:7295825"
                     /translation="MPLDPVARFRRFSRAVTLEVGALDTSFLGRGRPLGAARVLNAIG
                     QGRSDVADLRDCLRLDSGLMSRLLRRLEDEGLVRIEPHPDDARRRMAILTDAGQREFQ
                     IYEDLSNAQASSILSKHPDQELLLSAMDIVASALGRDRIKLDEVDPRSDAARYCLQEY
                     YAELAQRFAKGFDVSLSRDPDAADMIRPRGTFVVALSDGLPLGCVGLKGTGGDTAEIK
                     RLWVSSCARGLGIARRLMAAAEDTARALSIKTLRLDTNSALPEAVRLYCQSGWVEIDR
                     FNDDPYPDRFFEKKL"
     misc_feature    complement(416481..416744)
                     /locus_tag="Mnod_8209"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(<416535..416744)
                     /locus_tag="Mnod_8209"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     misc_feature    complement(416094..416282)
                     /locus_tag="Mnod_8209"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    complement(order(416157..416162,416190..416198))
                     /locus_tag="Mnod_8209"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(417288..418190)
                     /locus_tag="Mnod_8210"
                     /db_xref="GeneID:7295826"
     CDS             complement(417288..418190)
                     /locus_tag="Mnod_8210"
                     /inference="protein motif:PFAM:PF07859"
                     /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
                     KEGG: mpo:Mpop_3187 alpha/beta hydrolase fold-3 domain
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha/beta hydrolase"
                     /protein_id="YP_002490350.1"
                     /db_xref="GI:220915042"
                     /db_xref="InterPro:IPR002168"
                     /db_xref="InterPro:IPR013094"
                     /db_xref="GeneID:7295826"
                     /translation="MTVSEIDAIRHLLLAQPRPTDPAARRERMNSFGRRYALPADVSV
                     TAADAGGVPAEWTVTPGADPNRVLIFLHGGGYMAGSLDSHRHVVAQAGREAQARTLAL
                     DYRLTPEHPFPAALDDALAGYRFVIERGVAPRRIVLSGESAGGGLALATLLRLREAGE
                     PLPGCVWLSSPWVDLTLSGDSLITKAAVDPLIQKPYLAELARAYLNSADPHDPLISPL
                     YADLRGLPPMLIQVGSSETLLDDAVRLAGAAGGADVSVTLRIWPEMIHAWHLFYPQLA
                     AGRAALAEVGRFVDTCINYAGERR"
     misc_feature    complement(417390..>418013)
                     /locus_tag="Mnod_8210"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     misc_feature    complement(417381..417989)
                     /locus_tag="Mnod_8210"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
                     pfam07859"
                     /db_xref="CDD:254474"
     gene            complement(418212..420158)
                     /locus_tag="Mnod_8211"
                     /db_xref="GeneID:7295827"
     CDS             complement(418212..420158)
                     /locus_tag="Mnod_8211"
                     /inference="protein motif:PFAM:PF01494"
                     /note="catalyzes the formation of catechol from phenol"
                     /codon_start=1
                     /transl_table=11
                     /product="phenol 2-monooxygenase"
                     /protein_id="YP_002490351.1"
                     /db_xref="GI:220915043"
                     /db_xref="InterPro:IPR002938"
                     /db_xref="InterPro:IPR003042"
                     /db_xref="InterPro:IPR012941"
                     /db_xref="GeneID:7295827"
                     /translation="MQFHLNGYKPGDPGISEPARQDNAMQPGGGLPEHVDVLIIGCGP
                     TGLTLATQLAAFPDITTRIVDQKPGRLLVGQADGIACRTMEMFEAFGFSERVLKEAYW
                     VNETCFWNPDDSQRTTIVRTGRIQDTEDGLSEFPHVIMNQARVHDFYLDVMRNSPSRL
                     EPSYARSFLDLSIAPLGLGCSGEPNGSSRYPVTVRLERLDDAHRGEVETVRARCVVGC
                     DGAHNSVRKALGRAVHGDSANQAWGVMEVLALTDFPDIRLKTAIHSANEGSLLIIPRE
                     GGYLVRMYIELDKLNANERVADRAITVDHLIAAAQRILHPYTLEVKEVAWWSVYEIGQ
                     RPCDKFDDVPEEDIDRRCPSVFIAGDACHTHSPKAGQGMNVSMQDAFNLGWKLAAVIR
                     GHCSAGILHTYSAERRAVAQELIDFDRKFARMFGAAPKRPGEAGGDGVDPAEFQRYFL
                     KQSRFTAGTETCYAPSLISAEPTYQRLAEGLVIGMRFHSAPVIRLADARPLQLGHTVK
                     ADGRWRLFLFADAEEPDAPSSKLRALCTFLAEAPGAPVRRCTPAGADIDSVIDVRRSS
                     SRAIANWPLVRCRPFSGPGRATTASSITRRCSVPTSKLATFSRRAASCGRPAASSSCD
                     RTSMSRMSCRSMLIPSCRLSSTGS"
     misc_feature    complement(418215..420158)
                     /locus_tag="Mnod_8211"
                     /note="phenol 2-monooxygenase; Provisional; Region:
                     PRK08294"
                     /db_xref="CDD:236223"
     misc_feature    complement(418905..420056)
                     /locus_tag="Mnod_8211"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(<418470..418709)
                     /locus_tag="Mnod_8211"
                     /note="FAD-dependent Phenol hydoxylase (PHOX) family,
                     C-terminal TRX-fold domain; composed of proteins similar
                     to PHOX from the aerobic topsoil yeast Trichosporon
                     cutaneum. PHOX is a flavoprotein monooxygenase that
                     catalyzes the hydroxylation of phenol and...; Region:
                     PHOX_C; cd02979"
                     /db_xref="CDD:239277"
     gene            complement(420713..421624)
                     /locus_tag="Mnod_8212"
                     /db_xref="GeneID:7295559"
     CDS             complement(420713..421624)
                     /locus_tag="Mnod_8212"
                     /inference="protein motif:PFAM:PF00892"
                     /note="PFAM: protein of unknown function DUF6
                     transmembrane;
                     KEGG: rpe:RPE_2502 protein of unknown function DUF6,
                     transmembrane"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490352.1"
                     /db_xref="GI:220915044"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="GeneID:7295559"
                     /translation="MQTNSRWECQLKAPLSARWIGFLCLAATALGWALNWPAMKFLLR
                     EWPPLFARGVAGAAAAFLLTGVAVLYGESLKAPRHVIPRLLFAAFTNVFAWMGFSTLC
                     MKWLDVGEGALLVYTMPIWATLLAWPILGSRPTRRGTGALLLGMAGVSVLLSARGFNL
                     DTGKLLGIGFAFSAAVLFALGTVLNCTPLPLPPITAVAWQVGLGCLPMILIGLVFERP
                     NLGGLNSAGWSVLAYMTLVPMGLCYLAWFATLRRLPPAVASTGMLLVPLIGVLSAAVI
                     LGEPLGPRQFVSLALTLGGVTLALQTS"
     misc_feature    complement(420725..421579)
                     /locus_tag="Mnod_8212"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    complement(421166..421531)
                     /locus_tag="Mnod_8212"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(420725..421054)
                     /locus_tag="Mnod_8212"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            422198..423376
                     /locus_tag="Mnod_8213"
                     /db_xref="GeneID:7295428"
     CDS             422198..423376
                     /locus_tag="Mnod_8213"
                     /inference="protein motif:PFAM:PF00515"
                     /note="PFAM: hypothetical protein; hypothetical protein;
                     SMART: Tetratricopeptide domain protein;
                     KEGG: met:M446_0540 peptidase C14 caspase catalytic
                     subunit P20"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490353.1"
                     /db_xref="GI:220915045"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR013105"
                     /db_xref="GeneID:7295428"
                     /translation="MQQIYVLTSSLALLALTTSAVQALDAAGYLNRGITYYGNREYEQ
                     AIADYNEAIRIEPGLALAYLGRGSVYESRREYDQAMADYNKAIRIDPKYAIAYNYRGN
                     VYVSKGEYDRAIADYSMAIRIDPEYTDAYDNRGYIYQNKHEYDRAIADYNEAIRINPE
                     LVSAYFNRGLIYYNMGNYDLAIADYGNAIRIEPNHKSAYNNRGLAYFGKGEYDRAISD
                     YDEAIRIDPSYTSAYINRANLNDIIGDIDKALIDYKNVILLDLNHEIAYINRALIYQN
                     KNNYDLAITDCNNAIRIKPKHANSYFIRGGIYYDKTEYDRAAVDYSEAIRIDPKYALA
                     YFNRGLAYLNKNEPRRSLTDFAEAVRLKPELEKNDNFLKARADAQAALTRSQEQRRRP
                     "
     sig_peptide     422198..422269
                     /locus_tag="Mnod_8213"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.977 at
                     residue 24"
     misc_feature    422270..422470
                     /locus_tag="Mnod_8213"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    422273..422368
                     /locus_tag="Mnod_8213"
                     /note="Tetratricopeptide repeat; Region: TPR_1; pfam00515"
                     /db_xref="CDD:249923"
     misc_feature    422381..422677
                     /locus_tag="Mnod_8213"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(422381..422383,422387..422392,422399..422404,
                     422489..422494,422498..422503,422510..422515,
                     422591..422596,422603..422608,422615..422620)
                     /locus_tag="Mnod_8213"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(422396..422398,422432..422434,422444..422446,
                     422453..422455,422498..422500,422534..422536,
                     422546..422548,422555..422557,422600..422602,
                     422636..422638,422648..422650,422657..422659)
                     /locus_tag="Mnod_8213"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    422471..422674
                     /locus_tag="Mnod_8213"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    422582..422881
                     /locus_tag="Mnod_8213"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(422582..422587,422591..422596,422603..422608,
                     422693..422698,422702..422707,422714..422719,
                     422795..422800,422807..422812,422819..422824)
                     /locus_tag="Mnod_8213"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(422600..422602,422636..422638,422648..422650,
                     422657..422659,422702..422704,422738..422740,
                     422750..422752,422759..422761,422804..422806,
                     422840..422842,422852..422854,422861..422863)
                     /locus_tag="Mnod_8213"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    422687..422878
                     /locus_tag="Mnod_8213"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    422789..423085
                     /locus_tag="Mnod_8213"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(422789..422791,422795..422800,422807..422812,
                     422897..422902,422906..422911,422918..422923,
                     422999..423004,423011..423016,423023..423028)
                     /locus_tag="Mnod_8213"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    422789..422977
                     /locus_tag="Mnod_8213"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    order(422804..422806,422840..422842,422852..422854,
                     422861..422863,422906..422908,422942..422944,
                     422954..422956,422963..422965,423008..423010,
                     423044..423046,423056..423058,423065..423067)
                     /locus_tag="Mnod_8213"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    422993..423289
                     /locus_tag="Mnod_8213"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(422993..422995,422999..423004,423011..423016,
                     423101..423106,423110..423115,423122..423127,
                     423203..423208,423215..423220,423227..423232)
                     /locus_tag="Mnod_8213"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    422993..423184
                     /locus_tag="Mnod_8213"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    order(423008..423010,423044..423046,423056..423058,
                     423065..423067,423110..423112,423146..423148,
                     423158..423160,423167..423169,423212..423214,
                     423248..423250,423260..423262,423269..423271)
                     /locus_tag="Mnod_8213"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    423089..423286
                     /locus_tag="Mnod_8213"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     gene            complement(423379..423810)
                     /locus_tag="Mnod_8214"
                     /pseudo
                     /db_xref="GeneID:7295429"
     gene            complement(423839..424087)
                     /locus_tag="Mnod_8215"
                     /db_xref="GeneID:7295430"
     CDS             complement(423839..424087)
                     /locus_tag="Mnod_8215"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490354.1"
                     /db_xref="GI:220915046"
                     /db_xref="GeneID:7295430"
                     /translation="MFVRLLALPACAGLLAAVTPLQARPLIETYAPTACFTCGYNQRA
                     EPLVVSGPYGARESVRPSGRQRFTRFDIEALRLMTRMR"
     sig_peptide     complement(424016..424087)
                     /locus_tag="Mnod_8215"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 1.000) with cleavage site probability 0.992 at
                     residue 24"
     gene            complement(424951..425091)
                     /locus_tag="Mnod_8216"
                     /db_xref="GeneID:7295431"
     CDS             complement(424951..425091)
                     /locus_tag="Mnod_8216"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490355.1"
                     /db_xref="GI:220915047"
                     /db_xref="GeneID:7295431"
                     /translation="MSEAESPVINQTGPIVDALSASVIPLGAVINLLIKHNAIPKEEL
                     TQ"
     gene            complement(425473..425688)
                     /locus_tag="Mnod_8217"
                     /db_xref="GeneID:7295432"
     CDS             complement(425473..425688)
                     /locus_tag="Mnod_8217"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: mex:Mext_2437 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490356.1"
                     /db_xref="GI:220915048"
                     /db_xref="GeneID:7295432"
                     /translation="MLTAKDELLALKTYARIRAAGGDAEASIAEWCRLKGWQESTFHR
                     RRVRACEKLAVAKNAADRAQGRCAPEA"
     gene            complement(426138..426929)
                     /locus_tag="Mnod_8218"
                     /db_xref="GeneID:7295433"
     CDS             complement(426138..426929)
                     /locus_tag="Mnod_8218"
                     /inference="protein motif:PFAM:PF08220"
                     /note="PFAM: regulatory protein DeoR;
                     KEGG: dge:Dgeo_2172 DeoR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="DeoR family transcriptional regulator"
                     /protein_id="YP_002490357.1"
                     /db_xref="GI:220915049"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR014036"
                     /db_xref="GeneID:7295433"
                     /translation="MEGPTLLRDVRLNGIVDALRDGRVRSTAELALQFGVSEMTLRRD
                     LDHLGRRGLVRRVHGGARAAAGADPGYHRRAEENAAAKHRVGQAAAQLVTPGSCVYLD
                     AGTTAREVGRAIAERARAEGLTARIVTHAVNIGAELAGIVGLSVHQLGGEVDPGTLAA
                     TGPALVTELRGLNFDLYFMGVTGIDPERGMTNSTPVGLEVKRAAMSRARETWVVADVS
                     KWRQVSAYYIASMDAITGLVTDAAQNSRPHLEIERASLKLKVLSS"
     misc_feature    complement(426210..426911)
                     /locus_tag="Mnod_8218"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    complement(426756..426899)
                     /locus_tag="Mnod_8218"
                     /note="DeoR-like helix-turn-helix domain; Region:
                     HTH_DeoR; cl17531"
                     /db_xref="CDD:248085"
     misc_feature    complement(426210..426701)
                     /locus_tag="Mnod_8218"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            427077..428489
                     /locus_tag="Mnod_8219"
                     /db_xref="GeneID:7295434"
     CDS             427077..428489
                     /locus_tag="Mnod_8219"
                     /EC_number="2.5.1.26"
                     /inference="protein motif:PFAM:PF02913"
                     /note="PFAM: FAD linked oxidase domain protein;
                     KEGG: scl:sce9031  alkyl-dihydroxyacetonephosphate
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase domain-containing protein"
                     /protein_id="YP_002490358.1"
                     /db_xref="GI:220915050"
                     /db_xref="InterPro:IPR004113"
                     /db_xref="InterPro:IPR006094"
                     /db_xref="GeneID:7295434"
                     /translation="MTVTFSQALASSRPSLRISADAADRTAHARDWWPRAAKWTDEEL
                     DRHRPDAVVFATGEEDCIAVVAACRDTGTKLVTYGAGSGVVGAAVPDSGSVVIDMRGM
                     SRIVAFNATDGFVTVEPGCLGGELENWLNERGFTLGHYPQSLHLASIGGLISTRSTGT
                     FSNKYGGIEELVLALRVVGADGSVTAFRNTPRNSSGPALQQLFIGAEGTLGVITQATL
                     RVFPRAERRIFEGYQFPSVAAGVEAVRKAYAAHLRPAVLRLYDETEAANLYRRVGRDS
                     GPPLLIAGFEGLSGVAAAEQAAFAAIAKAEGGISLGPDIGNAWEAHRFDANWLTAGNE
                     GPRRMADAIEIALPWSTLAEAHAAITAEVAPYCATVMSHYSHFYSTGGALYVIVLLEG
                     ADTASVLEQYRQVWDRVMRKALAFGGSLAHHHGVGRQRAPFLPQELDGGHRLLQLVKA
                     ALDPEGILNPGKLALNGAVQ"
     misc_feature    427158..428465
                     /locus_tag="Mnod_8219"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    427221..427628
                     /locus_tag="Mnod_8219"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    427776..428465
                     /locus_tag="Mnod_8219"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            428486..429496
                     /locus_tag="Mnod_8220"
                     /db_xref="GeneID:7295435"
     CDS             428486..429496
                     /locus_tag="Mnod_8220"
                     /EC_number="1.1.1.262"
                     /inference="protein motif:TFAM:TIGR00557"
                     /note="TIGRFAM: 4-hydroxythreonine-4-phosphate
                     dehydrogenase;
                     PFAM: Pyridoxal phosphate biosynthetic protein PdxA;
                     KEGG: chy:CHY_1259 4-hydroxythreonine-4-phosphate
                     dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxythreonine-4-phosphate dehydrogenase"
                     /protein_id="YP_002490359.1"
                     /db_xref="GI:220915051"
                     /db_xref="InterPro:IPR005255"
                     /db_xref="GeneID:7295435"
                     /translation="MSAAVKPVIGVTMGDAAGIGPEIVVRALVEPEVREACHAIVIGD
                     AGIMRDAVALTGLPCEIRAVSSVAEAEFRDGTIDVLDLRNIARSDFEPGRISAACGRA
                     FVEYIRRAARMALSGEIDAVASAPTNKEAMHAAGEIYPGQTEIFAEESRSTDPFTILT
                     GGKMRVFLVSSHVSLSQAIALVTQPRIELVIRKAVASLKELWGIDDPLIGVAGLNPHA
                     GDGGLFGREEIEHVIPVLERLRAEGIRIEGPGPADSVYDRADRGAYDGVIGMYHDQGV
                     IPLKRYGYVTVISGTPIIRTTAGHGTAYDIAWKGIGRANVMQRAVVLAAELAASRAAR
                     AR"
     misc_feature    428501..429433
                     /locus_tag="Mnod_8220"
                     /note="Pyridoxal phosphate biosynthetic protein PdxA;
                     Region: PdxA; cl00873"
                     /db_xref="CDD:260671"
     gene            429493..430692
                     /locus_tag="Mnod_8221"
                     /db_xref="GeneID:7295436"
     CDS             429493..430692
                     /locus_tag="Mnod_8221"
                     /inference="protein motif:PFAM:PF07005"
                     /note="PFAM: type III effector Hrp-dependent outers;
                     KEGG: bpt:Bpet1986 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Hrp-dependent type III effector protein"
                     /protein_id="YP_002490360.1"
                     /db_xref="GI:220915052"
                     /db_xref="InterPro:IPR010737"
                     /db_xref="GeneID:7295436"
                     /translation="MSIKVAVLADDLSGGNSVGAEFARQGLATLVARVSEVDAAVRYG
                     PEIIVVTTDTRNRSPEEADAITRDALTRAVTLQPAYLFKKLDSLLRGPIAVEAAATMA
                     AAGADSALVVTASPPTGRTTRAGRQLVDGRPLLDVIAALDPGASLATDEVGSFFLACG
                     RPLRHLDLDTVRAGEIKTGEWSGRITIADCETQSDLDRTVSAAIAADVRLFFGTYGMG
                     ASIARLLGRNAGMPVLVIAGSLSEATHRQVLALREEGECTLLSVDAPSTSEEARRALS
                     AGRDVVLCARPDTLGPSAARLLAPPTRAAASAMEERIARCAEPLLGLVSGLIVSGGST
                     ADTLLVLMGAHGLVLSGSELLPGVPVARILGGSHDGLRCVTKPGSFGTDDALCVARRF
                     VRDRRMS"
     misc_feature    429499..430665
                     /locus_tag="Mnod_8221"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3395"
                     /db_xref="CDD:225930"
     gene            430843..432111
                     /locus_tag="Mnod_8222"
                     /db_xref="GeneID:7295437"
     CDS             430843..432111
                     /locus_tag="Mnod_8222"
                     /inference="protein motif:PFAM:PF07690"
                     /note="PFAM: major facilitator superfamily MFS_1;
                     KEGG: spe:Spro_3565 major facilitator transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily protein"
                     /protein_id="YP_002490361.1"
                     /db_xref="GI:220915053"
                     /db_xref="InterPro:IPR007114"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="GeneID:7295437"
                     /translation="MRIRWAVLAITAGVLILNYADRSALGVAGASIIHEFNLTKTEFG
                     LISSIFFVGYAPFCFVGGWLADKYGPRAVMGAAVGWWSIFTGLTAAGAGYVSFLIIRL
                     LFGLGEGPQGSVTIKTMRNWFPQKQMGLAVGISQGSTPLGGLIGTPLVAGLIAYNGDW
                     RLPFIVLGVIGILMTIGWFVIVRDTPGQHPWAGQAEVDEMKADAAVVAQSPASPGGAP
                     HSVGYYIRQPHVLATSIAFFGYAWVLYTFLSWFPVYLVEARGVNIKEVAIVGALPWAL
                     GVLGYMLGGVLTDWIAARTGRPAAARRGVILVGLVGTAALLAGVGYVETITAAVLLMS
                     GVIFLLYLTGAQYFLMISDTIPGEKLGGVVGFVHLIANTSGILAPLIVGVIVDQTKSW
                     VLTFGLSAAICIVGVVAVGVWGRARSLTEA"
     misc_feature    430864..432054
                     /locus_tag="Mnod_8222"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    430891..432018
                     /locus_tag="Mnod_8222"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:233174"
     misc_feature    order(430906..430908,430915..430923,430927..430932,
                     430981..430983,430990..430995,431002..431004,
                     431014..431019,431023..431028,431164..431169,
                     431176..431181,431188..431193,431200..431202,
                     431236..431241,431248..431253,431269..431271,
                     431563..431565,431572..431577,431584..431589,
                     431596..431598,431638..431640,431650..431652,
                     431662..431664,431671..431673,431683..431685,
                     431851..431853,431860..431865,431872..431874,
                     431884..431889,431896..431898,431929..431934,
                     431941..431946,431953..431958,431965..431967)
                     /locus_tag="Mnod_8222"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            432327..432779
                     /locus_tag="Mnod_8223"
                     /db_xref="GeneID:7295438"
     CDS             432327..432779
                     /locus_tag="Mnod_8223"
                     /inference="protein motif:PFAM:PF01575"
                     /note="PFAM: MaoC domain protein dehydratase;
                     KEGG: gtn:GTNG_2019 monoamine oxidase regulatory protein"
                     /codon_start=1
                     /transl_table=11
                     /product="MaoC domain-containing protein dehydratase"
                     /protein_id="YP_002490362.1"
                     /db_xref="GI:220915054"
                     /db_xref="InterPro:IPR002539"
                     /db_xref="GeneID:7295438"
                     /translation="MPGWQTVERFFEDYTLGERDVERRRTIDQADINMFAGLTLDFHP
                     AHIDRTFADARYGGRLVHGVLTFALVTGLNVEYNMRAISYGYEKMRFPGPLRAGDTLV
                     ARSEVVDLKPHRRPEIGLVTKQYTGLNQDGATVFSCLHILAVDRRSAA"
     misc_feature    432351..432773
                     /locus_tag="Mnod_8223"
                     /note="Acyl dehydratase [Lipid metabolism]; Region: MaoC;
                     COG2030"
                     /db_xref="CDD:224941"
     misc_feature    order(432510..432515,432597..432608)
                     /locus_tag="Mnod_8223"
                     /note="active site 2 [active]"
                     /db_xref="CDD:239524"
     misc_feature    order(432528..432530,432537..432542,432570..432572,
                     432576..432581)
                     /locus_tag="Mnod_8223"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            432776..433966
                     /locus_tag="Mnod_8224"
                     /db_xref="GeneID:7295439"
     CDS             432776..433966
                     /locus_tag="Mnod_8224"
                     /inference="protein motif:PFAM:PF02515"
                     /note="PFAM: L-carnitine dehydratase/bile acid-inducible
                     protein F;
                     KEGG: msm:MSMEG_0489 racemase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-carnitine dehydratase/bile acid-inducible
                     protein F"
                     /protein_id="YP_002490363.1"
                     /db_xref="GI:220915055"
                     /db_xref="InterPro:IPR003673"
                     /db_xref="GeneID:7295439"
                     /translation="MSTTEFLSEYRGKGPLRNVTVLDFTQMMMGPVATQLLGDLGAVV
                     IKVERPVNGEWERSYMPRGRRLHGESPYFLAMNRNKLAVTADLNDEADRSFLFDLVKS
                     CDVVVENFRPGVMDKLGFGYDDLVKHNPRLVYASGSGFGAEGPLVKRPGQDMLLQSMS
                     GLAANSGPGNGPPVPVAAPILDASTGFLLSFAIASAVLDARENGTPRQIEASLLGTSL
                     MIQCQEALVSMNTDLTWERSSSGIAAPWTDAPYGVYQTRDGFMAMSMTPRAKLAEIFA
                     LDPSLVACTDDEWFLRRDEINAILVEKLRTRTSDEWIAELTEKGMWVAPVQSVAEMVR
                     HPQVEANGYVEAIDAPGGKQVQAVGLPFRISGVHGANRLPVPTIGQHDAVVRQALAGR
                     KPQG"
     misc_feature    432809..433942
                     /locus_tag="Mnod_8224"
                     /note="Predicted acyl-CoA transferases/carnitine
                     dehydratase [Energy production and conversion]; Region:
                     CaiB; COG1804"
                     /db_xref="CDD:224717"
     gene            433986..435170
                     /locus_tag="Mnod_8225"
                     /db_xref="GeneID:7295440"
     CDS             433986..435170
                     /locus_tag="Mnod_8225"
                     /inference="protein motif:PFAM:PF01547"
                     /note="PFAM: extracellular solute-binding protein family
                     1;
                     KEGG: fjo:Fjoh_4122 ABC-type sugar transport system
                     periplasmic component-like protein"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_002490364.1"
                     /db_xref="GI:220915056"
                     /db_xref="InterPro:IPR006059"
                     /db_xref="GeneID:7295440"
                     /translation="MAQQPSLRGMTWSHPRGLDPLVACVPPLRDRGVAVTWDARSLQG
                     FEEASIQHLATQYDLIAIDHPFLGDAFRQGALHPVDGIVGEAFVDELRASSVGPSFQS
                     YLWKDRLWAIPVDAAAQVAAFRADLLADLGRAVPRSWAEVRALVDALPAGRSVAMPAN
                     PTHVLLAFGTICHAVAADRSTQADLRPRWWRDDGFDPETARAALALLRSLLDALHPMS
                     WDSDPIQIFDHMVGNDDVVYTPIAFGYSNYARPSSYERPLGFCGVPSMDGAVIGGMLG
                     GVGLCVSRQCRDLEAAAAVLRFVAASGTQRGLYTEAGGQPAHREAWIDERVNTICPNF
                     FAPTLASLDASFVRPRLPGYPAFQREGGEVLHRLLRQGASDDEMIAAMNALWSEIRER
                     DV"
     misc_feature    434079..434900
                     /locus_tag="Mnod_8225"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            435176..436723
                     /locus_tag="Mnod_8226"
                     /db_xref="GeneID:7295441"
     CDS             435176..436723
                     /locus_tag="Mnod_8226"
                     /inference="protein motif:PFAM:PF00501"
                     /note="PFAM: AMP-dependent synthetase and ligase;
                     KEGG: mpt:Mpe_A2687  long-chain-fatty-acid CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="AMP-dependent synthetase/ligase"
                     /protein_id="YP_002490365.1"
                     /db_xref="GI:220915057"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="GeneID:7295441"
                     /translation="MAEEAPGRPEASSHLETWAALLLAAHANFAGQVAVVRPEGAWSY
                     ADVLGAASRCAGRLSGLGVTRGARVVIALDNRPETVVIERALALWGFVRVALSPRLHP
                     EEIDFIAADCEAAVVICEAAVAGALRCEATVVSAEPHPAATLSLDALMAEATAPALPA
                     IGPDDLASLMYTSGTTGRPKGAMNTHRNWHAMATRMASILPPIGPGDVLLHVAPMSHF
                     SGSVASAYAANGAAIATLRRFDPARAVAVARQIGATCMPLVPTMVLDLIAGRDEGPLL
                     PSLKVLPYGGSSIAADALVRARAVLGDTLLQVYGMSEALIPVTALATTEHRAGDGERA
                     RLSSAGSPVPGAAVEVCAPPGEVGEIRVRGPNVMIGYWNNPDQTREVLDAEGWYASGD
                     LGRQDPSGRIEIVGRRRDVIITGGFNVYPAEVERVIAAVPGVAEAAVIGAPHARWIET
                     VVAVVVREAGAQVGADQLLAACRDHLAAYKKPTEIRFVPALPRISTGKVDKRRLRELY
                     LAGAYAP"
     misc_feature    435257..436714
                     /locus_tag="Mnod_8226"
                     /note="Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases
                     II [Lipid metabolism / Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: CaiC; COG0318"
                     /db_xref="CDD:223395"
     misc_feature    435257..436690
                     /locus_tag="Mnod_8226"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(435680..435682,435689..435706,435710..435715)
                     /locus_tag="Mnod_8226"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    order(435689..435691,436028..436033,436094..436111,
                     436349..436351,436385..436387,436394..436396,
                     436427..436429,436667..436669)
                     /locus_tag="Mnod_8226"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    order(435689..435691,435812..435817,435950..435952,
                     435956..435961,435968..435970,436028..436033,
                     436094..436111,436349..436351,436385..436387,
                     436394..436396,436418..436429,436610..436612)
                     /locus_tag="Mnod_8226"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    order(435812..435814,435956..435961,435968..435970,
                     436028..436030,436418..436426,436592..436594,
                     436610..436612)
                     /locus_tag="Mnod_8226"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            436720..436812
                     /locus_tag="Mnod_8227"
                     /db_xref="GeneID:7295442"
     CDS             436720..436812
                     /locus_tag="Mnod_8227"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490366.1"
                     /db_xref="GI:220915058"
                     /db_xref="GeneID:7295442"
                     /translation="MRLVPALDRGLRSLALLAERGGYMRVDEIA"
     gene            436919..437209
                     /locus_tag="Mnod_8228"
                     /db_xref="GeneID:7295443"
     CDS             436919..437209
                     /locus_tag="Mnod_8228"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: sen:SACE_3534 IclR family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490367.1"
                     /db_xref="GI:220915059"
                     /db_xref="GeneID:7295443"
                     /translation="MLVQGSAFERQLDFGDIAVSTAKAVMQEASETAQVGVLDGRSVL
                     YVAKADSIRRSYANGAGLTRAGAFPATTGAHIQRALNWVNELVLCNMQTAPA"
     misc_feature    <436931..>437077
                     /locus_tag="Mnod_8228"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     gene            437383..438663
                     /locus_tag="Mnod_8229"
                     /db_xref="GeneID:7295444"
     CDS             437383..438663
                     /locus_tag="Mnod_8229"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /note="KEGG: met:M446_5531 transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490368.1"
                     /db_xref="GI:220915060"
                     /db_xref="GeneID:7295444"
                     /translation="MGRSELERLSKQELIELVLRLQRPEKTSRTSSKPPSTDRKERRE
                     QAKPGGAKPGHEGHSRTLSPDPDEIVAHRPGHCPCCGGVLAPDLPAEIVSVCEQIDLP
                     AVAPMVTQHQRLAVRCPACGTRVVAPVPQAARGTPFGPRLHAVAVYLKTFQALSYERL
                     QAALSDLFGLTLSQGGLMNLLRRAQRQFRADREAAVSALRRAAVVASDETGVRIEGSN
                     SYHWVFRSDAAVVHHAASTRAAAVVHAMMDGHRPSVWLSDRYTAQQGHGEHHQTCLAH
                     LARDVAYAVEVSDDPVPLRLQLWLGSVFSLAERVTDLAASTLSAKRRALDRQLSAILA
                     APSRCDLTRALQAKIGRARDQLLVFLDHPGRVAVTNNACERALRPAVVQRKVTNGYRA
                     MWAAAGEADVRTVVDTARLSGAGTFATILNIIRA"
     misc_feature    437530..438018
                     /locus_tag="Mnod_8229"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3436"
                     /db_xref="CDD:225970"
     misc_feature    437599..437748
                     /locus_tag="Mnod_8229"
                     /note="zinc-finger binding domain of transposase IS66;
                     Region: zf-IS66; pfam13005"
                     /db_xref="CDD:257452"
     misc_feature    437785..438570
                     /locus_tag="Mnod_8229"
                     /note="Transposase IS66 family; Region: DDE_Tnp_IS66;
                     pfam03050"
                     /db_xref="CDD:251693"
     gene            439064..439264
                     /locus_tag="Mnod_8230"
                     /db_xref="GeneID:7295445"
     CDS             439064..439264
                     /locus_tag="Mnod_8230"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490369.1"
                     /db_xref="GI:220915061"
                     /db_xref="GeneID:7295445"
                     /translation="MKDPNLAEVLRQVEETITEWNRQAAELRRSTEELLRVEVTAERK
                     SARAIRCAWTPAPGRRRVAGGV"
     gene            complement(439717..440142)
                     /locus_tag="Mnod_8231"
                     /db_xref="GeneID:7295446"
     CDS             complement(439717..440142)
                     /locus_tag="Mnod_8231"
                     /inference="similar to AA sequence:KEGG:Mext_2437"
                     /note="KEGG: mex:Mext_2437 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490370.1"
                     /db_xref="GI:220915062"
                     /db_xref="GeneID:7295446"
                     /translation="MAEPPEPADPLPAWTAKDIERWVIIPMRLLRESAVATRPGNALR
                     STDLEQPSASFDILAFAHTVLTDKDEFLALTTYARIRAAGGDAEASIAEWCREKGWQE
                     RTFHRRRVRACERLAAAKNAASLAEGENRSGFGTRPARR"
     gene            complement(440215..440667)
                     /locus_tag="Mnod_8232"
                     /db_xref="GeneID:7295447"
     CDS             complement(440215..440667)
                     /locus_tag="Mnod_8232"
                     /inference="protein motif:PFAM:PF05443"
                     /note="PFAM: ROSMUCR transcriptional regulator;
                     KEGG: met:M446_0065 MucR family transcriptional regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="YP_002490371.1"
                     /db_xref="GI:220915063"
                     /db_xref="InterPro:IPR008807"
                     /db_xref="GeneID:7295447"
                     /translation="MSDTTTSPLPTQDLVSLTAGIVGAYVAHTAVPPAELPDLIASVH
                     GALASLGQPSEPETPVLVPSVPIKRTVTPDAIISLEDGKPYKSLKRHLRTHGLTPERY
                     RAKWGLPLDYPMVAANYAAQRSELAKNSGLGRKGAAGRSGGRSQAKAR"
     misc_feature    complement(440266..440637)
                     /locus_tag="Mnod_8232"
                     /note="ROS/MUCR transcriptional regulator protein; Region:
                     ROS_MUCR; pfam05443"
                     /db_xref="CDD:253198"
     gene            complement(440732..441340)
                     /locus_tag="Mnod_8233"
                     /db_xref="GeneID:7295448"
     CDS             complement(440732..441340)
                     /locus_tag="Mnod_8233"
                     /inference="protein motif:PFAM:PF07120"
                     /note="PFAM: protein of unknown function DUF1376;
                     KEGG: mex:Mext_1874 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490372.1"
                     /db_xref="GI:220915064"
                     /db_xref="InterPro:IPR010781"
                     /db_xref="GeneID:7295448"
                     /translation="MSAYPSLPLFTDAFIADTGHLSAAETGAYLMLLMVAWRSPGCSL
                     PVLATQAVGEGGRTLAKGLYLSVLARYPAWAIEQACNRFAQGFAGDRKFMPSPGDLAH
                     EVRRLIEPQVAERARLSRVLDAEVIPDPDPTMAEKARKAAADLAARLAMPGEERPTPE
                     AEAEAATNHLEQLKAQGLGGLKLSEATVAKMLGRPAQHAEPA"
     misc_feature    complement(<441206..441328)
                     /locus_tag="Mnod_8233"
                     /note="Protein of unknown function (DUF1376); Region:
                     DUF1376; cl01531"
                     /db_xref="CDD:242561"
     gene            complement(441337..441792)
                     /locus_tag="Mnod_8234"
                     /db_xref="GeneID:7295449"
     CDS             complement(441337..441792)
                     /locus_tag="Mnod_8234"
                     /inference="protein motif:PFAM:PF01844"
                     /note="PFAM: HNH endonuclease;
                     SMART: HNH nuclease;
                     KEGG: lch:Lcho_1844 HNH endonuclease"
                     /codon_start=1
                     /transl_table=11
                     /product="HNH endonuclease"
                     /protein_id="YP_002490373.1"
                     /db_xref="GI:220915065"
                     /db_xref="InterPro:IPR002711"
                     /db_xref="InterPro:IPR003615"
                     /db_xref="GeneID:7295449"
                     /translation="MSKVSRRQLALLASCPQCGARRGMACQGVRGNRKAPHQARLKNL
                     LARATKEAGHLGDEVPPARMKRQGFYWSDEWRAVRYQALKLHGGACQCCGARGTKRAP
                     LHVDHIKPRSRYPHLALEISNLQVLCEDCNLGKGASDDTDWRPAPARLQ"
     sig_peptide     complement(441715..441792)
                     /locus_tag="Mnod_8234"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.781) with cleavage site probability 0.752 at
                     residue 26"
     misc_feature    complement(441385..441552)
                     /locus_tag="Mnod_8234"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    complement(order(441385..441387,441397..441399,
                     441406..441411,441421..441426,441463..441465,
                     441469..441477,441481..441483))
                     /locus_tag="Mnod_8234"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            complement(441789..442037)
                     /locus_tag="Mnod_8235"
                     /db_xref="GeneID:7295450"
     CDS             complement(441789..442037)
                     /locus_tag="Mnod_8235"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490374.1"
                     /db_xref="GI:220915066"
                     /db_xref="GeneID:7295450"
                     /translation="MNAPSHPTIQQQIDEVLCCALSIEAAVRAWEQAPEKRRAVETGC
                     CRSKIEPLRAAVRTLELVRDNADEFRAAIIAKRGRDAA"
     gene            complement(442043..442978)
                     /locus_tag="Mnod_8236"
                     /db_xref="GeneID:7295451"
     CDS             complement(442043..442978)
                     /locus_tag="Mnod_8236"
                     /inference="protein motif:PFAM:PF01555"
                     /note="PFAM: DNA methylase N-4/N-6 domain protein;
                     KEGG: mes:Meso_1200 DNA methylase N-4/N-6"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase N-4/N-6 domain-containing protein"
                     /protein_id="YP_002490375.1"
                     /db_xref="GI:220915067"
                     /db_xref="InterPro:IPR001091"
                     /db_xref="InterPro:IPR002295"
                     /db_xref="InterPro:IPR002941"
                     /db_xref="GeneID:7295451"
                     /translation="MTANVFASHISQRFAAYHVDTVEFTKEMPDDCVDFSVYSPPFSS
                     LYIYSESERDMGNVGSDDEFQAHYRYLVKELFRITKPGRLTAIHVKDLVYYSNASERG
                     DRGIRDFTGACIRTHVQEGWSFHRRITIDRCPVREMQKTKSDRLLYKNFRTDAARTGG
                     GLPEYIVVFRKWADGMDAVPPVLHDPAEHPLESWQDLAQPIWMTSGIWYDTDETDVLN
                     VRVARDAEAEKHLCPMPLDLTERLVRQYTNPDETVYSPFMGIGSEGYQSLLQGRRFIG
                     TELKQSYYTQAVRYLTEAEQRGTTATLFTHMAAAE"
     misc_feature    complement(442112..442882)
                     /locus_tag="Mnod_8236"
                     /note="DNA methylase; Region: N6_N4_Mtase; pfam01555"
                     /db_xref="CDD:250703"
     gene            complement(442975..443963)
                     /locus_tag="Mnod_8237"
                     /pseudo
                     /db_xref="GeneID:7295452"
     gene            444201..444482
                     /locus_tag="Mnod_8238"
                     /pseudo
                     /db_xref="GeneID:7295453"
     gene            444482..444895
                     /locus_tag="Mnod_8239"
                     /db_xref="GeneID:7295454"
     CDS             444482..444895
                     /locus_tag="Mnod_8239"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490376.1"
                     /db_xref="GI:220915068"
                     /db_xref="GeneID:7295454"
                     /translation="MRYRWPHTLRGWKTLFWLWLGRCPIHHTRLSVEAARQGQLTVAE
                     HKKLVAATEAAFAALRTEHQEVLCDLGDRVDEIVRLREALKPFVEYARYALIAGMEGE
                     IGEVIVVGFRRSISTQALRRTVEAYGEPPETSDAR"
     gene            444885..445001
                     /locus_tag="Mnod_8240"
                     /pseudo
                     /db_xref="GeneID:7295455"
     gene            444998..445135
                     /locus_tag="Mnod_8241"
                     /pseudo
                     /db_xref="GeneID:7295456"
     gene            445156..445701
                     /locus_tag="Mnod_8242"
                     /pseudo
                     /db_xref="GeneID:7295457"
     gene            445710..446557
                     /locus_tag="Mnod_8243"
                     /pseudo
                     /db_xref="GeneID:7295458"
     gene            446554..447600
                     /locus_tag="Mnod_8244"
                     /db_xref="GeneID:7295459"
     CDS             446554..447600
                     /locus_tag="Mnod_8244"
                     /inference="protein motif:PFAM:PF01032"
                     /note="PFAM: transport system permease protein;
                     KEGG: mpo:Mpop_3805 transport system permease protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transport system permease"
                     /protein_id="YP_002490377.1"
                     /db_xref="GI:220915069"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:7295459"
                     /translation="MNAAVPTLARSASRRFGTSAAGRTVVVLLAVTVVALTLASIAIG
                     YAPFDVQAAFADLLAGRTTLPALVLWELRIPRALLGGVVGFSLGLTGAVMQGYLRNPL
                     ADPGILGISSAAALGAVVVFYGGFAASLSLALPLGGIAGAAGAALLLNLLAARGSSTL
                     GLILAGVGLSSLAGALTALALNLSPNPYAALEIVFWLMGSLADRSMDHVLLCLPLMAI
                     GWGLMLSTASALDALALGEDTAASLGVGLVSARLRLVTGAALAVGSGVAVSGAIGFVG
                     LVVPHLMRPLVGARPGACLWPSGLAGAALVLSADIGVRLLATRPELKLGVVTALVGAP
                     FLIVLLLRNRGSRA"
     misc_feature    446797..447573
                     /locus_tag="Mnod_8244"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(446836..446838,446848..446856,447223..447228,
                     447232..447240,447244..447249,447253..447270,
                     447274..447282,447403..447405,447424..447426)
                     /locus_tag="Mnod_8244"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(446851..446853,446857..446859,446872..446874,
                     447034..447036,447040..447045,447052..447057,
                     447064..447069,447076..447078,447085..447090,
                     447094..447096,447133..447138,447145..447147,
                     447373..447375,447529..447531,447538..447543,
                     447550..447552,447559..447564,447571..447573)
                     /locus_tag="Mnod_8244"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(447094..447096,447175..447177,447349..447351,
                     447361..447363,447493..447495,447520..447522)
                     /locus_tag="Mnod_8244"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            447597..448412
                     /locus_tag="Mnod_8245"
                     /db_xref="GeneID:7295460"
     CDS             447597..448412
                     /locus_tag="Mnod_8245"
                     /inference="protein motif:PFAM:PF00005"
                     /note="PFAM: ABC transporter related;
                     SMART: AAA ATPase;
                     KEGG: mpo:Mpop_3804 ABC transporter related"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002490378.1"
                     /db_xref="GI:220915070"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:7295460"
                     /translation="MSLAARDIRVTLDGRTVLSDVSIALERGRFVGLVGPNGAGKTTL
                     LRVLAALVAPTEGSVTLEGRSTSGMCRDERARRVAALFQGAGVGWPMTVREIVALGRL
                     PHRRAFAPLTDADEVAIARAMVRTDVEHLADRPEPTLSSGERMRALLARALAVEAEWL
                     LADEPVTALDPAHQLDAMALLRAVARDGAGVVAVLHDLGLAARFCDRIVVLKGGRLVA
                     DGHPEEALTDALLAEVFGVTARRGRAPDGTRYILPWARSGAVKEESDGAIIPP"
     misc_feature    447597..448355
                     /locus_tag="Mnod_8245"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    447606..448256
                     /locus_tag="Mnod_8245"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    447699..447722
                     /locus_tag="Mnod_8245"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(447708..447713,447717..447725,447843..447845,
                     448083..448088,448182..448184)
                     /locus_tag="Mnod_8245"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    447834..447845
                     /locus_tag="Mnod_8245"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    448011..448040
                     /locus_tag="Mnod_8245"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    448071..448088
                     /locus_tag="Mnod_8245"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    448095..448106
                     /locus_tag="Mnod_8245"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    448170..448190
                     /locus_tag="Mnod_8245"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            448390..449355
                     /locus_tag="Mnod_8246"
                     /db_xref="GeneID:7295461"
     CDS             448390..449355
                     /locus_tag="Mnod_8246"
                     /inference="similar to AA sequence:KEGG:Mpop_3803"
                     /note="KEGG: mpo:Mpop_3803 hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490379.1"
                     /db_xref="GI:220915071"
                     /db_xref="InterPro:IPR000408"
                     /db_xref="GeneID:7295461"
                     /translation="MAQSSRHEEVAALLREALADPGTAWSLGSFGAIAEFMRDPDEPV
                     MALPDERMGMATTRGAIALTACPDLRPVAYETAVASGWNHAVALCLPEDACAMSRRGV
                     VTELGPDRNAAREQDRDGVLFDLGLDLLAVDACVRTRDPDAIACLRAGAGRPLFDPGN
                     PIGPHLVAMSPHRVFLARIGRVEVYAPIPGPGGTSPEGPHTHVLPKLLRSGRTHAATT
                     PIPTGWVPCAGIHPAHPYKDMMGQRIAFDASRHEAFQVLLDRWGDPELLAIKRGAAPT
                     SAGTVSIRHVQAVRRVAEAQARYLRGETIEAGTGEDEDEATDVHA"
     gene            449342..449482
                     /locus_tag="Mnod_8247"
                     /db_xref="GeneID:7295462"
     CDS             449342..449482
                     /locus_tag="Mnod_8247"
                     /inference="ab initio prediction:Prodigal:1.4"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002490380.1"
                     /db_xref="GI:220915072"
                     /db_xref="GeneID:7295462"
                     /translation="MCTPDCVAGGYGQRLAAVSAKANEEAEVVALEPCPFRLKRVRLF
                     SL"
     gene            complement(449618..450523)
                     /locus_tag="Mnod_8248"
                     /db_xref="GeneID:7295463"
     CDS             complement(449618..450523)
                     /locus_tag="Mnod_8248"
                     /inference="protein motif:PFAM:PF03466"
                     /note="PFAM: regulatory protein LysR; LysR
                     substrate-binding;
                     KEGG: bch:Bcen2424_4053 LysR family transcriptional
                     regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, LysR family"
                     /protein_id="YP_002490381.1"
                     /db_xref="GI:220915073"
                     /db_xref="InterPro:IPR000847"
                     /db_xref="InterPro:IPR005119"
                     /db_xref="GeneID:7295463"
                     /translation="MRNLTDLYYFAKVAEHGGFSAASRVLDQPKSTLSRRIAALERDL
                     GVRLIQRTNNRFALTEIGSAYVAHCQAMIAEAQAAQQVVENWRAEPTGTLRVSCPIAL
                     AQARVSEIVARFMIAHPGVSVRFIATNRTVDLIEEGIDVALRVRFPPLEESDLVMRVL
                     SDSTQAIVGAPALLDRLGRPSAPEALAGMDALDLIRQDRNHVWHLTHQDGRSVAIPFA
                     PRLVSDDMLTLRQAAREGVGVVRLPTYLVQAALDKGDLEAVLPAWTPRSGIIHAVLPS
                     RRGLARATRLFVDSLVEGFRQPARR"
     misc_feature    complement(449639..450523)
                     /locus_tag="Mnod_8248"
                     /note="LysR family transcriptional regulator; Provisional;
                     Region: PRK14997"
                     /db_xref="CDD:184959"
     misc_feature    complement(450338..450514)
                     /locus_tag="Mnod_8248"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(449651..450256)
                     /locus_tag="Mnod_8248"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_4; cd08473"
                     /db_xref="CDD:176162"
     misc_feature    complement(order(449714..449716,449795..449797,
                     449846..449848,450035..450037,450041..450043,
                     450089..450091,450206..450208,450218..450220))
                     /locus_tag="Mnod_8248"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176162"
     misc_feature    complement(order(449819..449821,449828..449833,
                     449852..449866,449954..449956,450143..450163,
                     450167..450169,450179..450181,450188..450193,
                     450197..450202,450212..450217))
                     /locus_tag="Mnod_8248"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176162"
     gene            450631..451230
                     /locus_tag="Mnod_8249"
                     /db_xref="GeneID:7295464"
     CDS             450631..451230
                     /locus_tag="Mnod_8249"
                     /inference="protein motif:TFAM:TIGR01755"
                     /note="TIGRFAM: flavoprotein WrbA;
                     PFAM: flavodoxin/nitric oxide synthase;
                     KEGG: bra:BRADO6142 TrpR binding protein WrbA"
                     /codon_start=1
                     /transl_table=11
                     /product="flavoprotein WrbA"
                     /protein_id="YP_002490382.1"
                     /db_xref="GI:220915074"
                     /db_xref="InterPro:IPR008254"
                     /db_xref="InterPro:IPR010089"
                     /db_xref="GeneID:7295464"
                     /translation="MPKVLVLYHSAYGHVEAMAQAVAAGAREAGATVALRRVPETVPD
                     AVARQAGYKLDQAAPLASVEELPDYDAIIIGCGTRYGRVSAQMANFLDQTGGLWARGA
                     LNGRVGAAFTATATQHGGQETTLFSLITNLLHLGLVVVGLPYSFQGQLGIEAVSGASP
                     YGATTITGGDGSRWPSATEIEGAHFQGRLVAETAARLFG"
     misc_feature    450631..451227
                     /locus_tag="Mnod_8249"
                     /note="NAD(P)H:quinone oxidoreductase; Provisional;
                     Region: PRK03767"
                     /db_xref="CDD:179647"
     gene            451264..452370
                     /locus_tag="Mnod_8250"
                     /db_xref="GeneID:7295465"
     CDS             451264..452370
                     /locus_tag="Mnod_8250"
                     /inference="protein motif:TFAM:TIGR01730"
                     /note="TIGRFAM: efflux transporter, RND family, MFP
                     subunit;
                     PFAM: secretion protein HlyD family protein;
                     KEGG: bmn:BMA10247_A1201 RND family efflux transporter MFP
                     subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="RND family efflux transporter MFP subunit"
                     /protein_id="YP_002490383.1"
                     /db_xref="GI:220915075"
                     /db_xref="InterPro:IPR006143"
                     /db_xref="GeneID:7295465"
                     /translation="MRRTSRILLGLAVATPGALLLAGTGGAPARPDPDQPVKPLAVET
                     SRVSDTPLGRGVTAVASLRAVQQVTLSPEVDGRVVAIHFQEGARVEAGAPILDLFRDP
                     QQAELNRSRAEETLARLQLDRARALLQREATAQAEVDRRQAGLDQAVAQRQAAEAALA
                     QRVVRAPFAGELGLRRTDPGHYLRAGDPIVTLTALDALYVDFAVPQRYLADLREGQAV
                     EVASDAAGGRTVLARLDTIEPQIDPGTRNIRLRARLDNRDRSLRPGASVTATLRFAPE
                     RGVVTVPETAIVASAATDTAFVVRDLDADGHGHVAQVSVTTGRRSEGRIVVSAGLEPG
                     EVVVTAGQLRLSPGQPVRLEARHAASAAPEPALR"
     sig_peptide     451264..451332
                     /locus_tag="Mnod_8250"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.999) with cleavage site probability 0.827 at
                     residue 23"
     misc_feature    451387..452319
                     /locus_tag="Mnod_8250"
                     /note="RND family efflux transporter, MFP subunit; Region:
                     RND_mfp; TIGR01730"
                     /db_xref="CDD:233547"
     misc_feature    451459..451599
                     /locus_tag="Mnod_8250"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     misc_feature    451750..452055
                     /locus_tag="Mnod_8250"
                     /note="HlyD family secretion protein; Region: HlyD_3;
                     pfam13437"
                     /db_xref="CDD:257762"
     gene            452383..455448
                     /locus_tag="Mnod_8251"
                     /db_xref="GeneID:7295466"
     CDS             452383..455448
                     /locus_tag="Mnod_8251"
                     /inference="protein motif:PFAM:PF00873"
                     /note="PFAM: acriflavin resistance protein;
                     KEGG: bte:BTH_II1287 hydrophobe/amphiphile efflux family
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="acriflavin resistance protein"
                     /protein_id="YP_002490384.1"
                     /db_xref="GI:220915076"
                     /db_xref="InterPro:IPR001036"
                     /db_xref="GeneID:7295466"
                     /translation="MAFTDLFVRRPTLAIVVSLMVLLGGTFALLALPVRQYPKLQSAA
                     ITVETRYPGAAQGLMQGFVTVPLSQAIATADGIEYLSSISSDGRSLIKARLRLDADPD
                     RSLAEIMAKVQQTKYRLPEEAYDPVIEKVTDDPTAVMYVALMSETLPIPEITDYAVRA
                     VQPLFASVKGVASAQIMGGRNLSLRVWLDPDRLAAHGLTAAEVGQALTRNNVQIAAGQ
                     VKGSFTAAAITADTDAQDPEAFRRLVLRDGDPQVRLEDVARIAFGGQDYEESALINGR
                     PAVVVAVNGTPDANPLDIVRAVTALLPQLERSKPPGLDISNVFDVARFVQAALTEVEH
                     TLVEAAIVVVIVIFLFLGSWRAVLIPMVTIPLSLVGAAALMLVAGFSLNLLTLLAMVL
                     AIGLVVDDAIVVVENVHRHIEEGASPFEASLRGAREVVGPVIGMTVTLAAVYAPIGLI
                     GGITGSLFREFAFTLAGAVLVSGVVALCVSPMMSSLLLQPQSQHGGFARRIEQAFARL
                     AEAYAVMLRASLRHRALMTAFAVAALAGTVALYLAAEREFAPTEDQGTVMEVAKAPRY
                     ANLDYTERYSVRLEAAFRRLPEADTTWVLNGSSQTEPGPHSVFAGVNLVPWDRRSRSA
                     AAIMAELQADGAQNPGLSVIAFLLPALPTAPGLPVQMVVRGPVPYDQLYAVKERIVAA
                     ARASGLFAVVDSDLTWDKPGIALSVDRARAGKLGLSMRDVAATLATLVGEKYVNRFEF
                     RGRSYDVIPQVERRFRADGAGLERFYVRARSGELVPLGTVIATAPRAEPNQLGQHDQM
                     NAVTISAVPAPGTTMGQAVAFLQRQAEDLPPGMGTAWLGQSRQFVTEGHRLTVAFGLA
                     LAVIFLVLAAQFNSFRDPFVILVSVPLSIFGALLPLWLGYTTLNIFTQIGLVTLVGLI
                     AKHGILMTAFANELQERDGLDRAAAIVEAARIRLRPILMTTAAMVVGLVPLIFASGAG
                     AASRFAIGAVVVAGLLVGTAFTLIVLPTIYTLLARDHRRGTVAGLAQAG"
     misc_feature    452383..455442
                     /locus_tag="Mnod_8251"
                     /note="multidrug efflux protein; Reviewed; Region:
                     PRK09579"
                     /db_xref="CDD:169983"
     sig_peptide     452383..452478
                     /locus_tag="Mnod_8251"
                     /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
                     probability 0.979) with cleavage site probability 0.772 at
                     residue 32"
     misc_feature    <453424..453843
                     /locus_tag="Mnod_8251"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     misc_feature    <454783..455403
                     /locus_tag="Mnod_8251"
                     /note="MMPL family; Region: MMPL; cl14618"
                     /db_xref="CDD:265435"
     gene            456058..457248
                     /locus_tag="Mnod_8252"
                     /db_xref="GeneID:7295467"
     CDS             456058..457248
                     /locus_tag="Mnod_8252"
                     /EC_number="2.3.3.10"
                     /inference="protein motif:TFAM:TIGR01835"
                     /note="TIGRFAM: hydroxymethylglutaryl-CoA synthase;
                     PFAM: Hydroxymethylglutaryl-coenzyme A synthase domain;
                     Hydroxymethylglutaryl-coenzyme A synthase domain protein;
                     KEGG: tcx:Tcr_1719 hydroxymethylglutaryl-coenzyme A
                     synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="hydroxymethylglutaryl-CoA synthase"
                     /protein_id="YP_002490385.1"
                     /db_xref="GI:220915077"
                     /db_xref="InterPro:IPR011554"
                     /db_xref="InterPro:IPR013528"
                     /db_xref="InterPro:IPR013746"
                     /db_xref="GeneID:7295467"
                     /translation="MTGVGIDDISIYTPEYYYSLHDLVIAHGIDPNKYLVGIGQERMA
                     VPPPDEDVVSMAANAVAPLLTRQLRDTVSTVIFATESGIDQSKSAGLFVHGLLGLNPH
                     CRVVEFKQACYSATAGIQLAADLVRQRPMEKVLVIASDIARYERGSEGECTQGAGAVA
                     MVISANPRLLELHPVSGLYSVDVMDFWRPNHRSTACVDGKLSIDVYLRSLAEAWADYR
                     RKGGLPLGAVDKLCFHQPFTRMAKKAFAALSEAAGSEAAHLDESCYADSQIYGRAIGN
                     TYSASLYIGLCSLLDRCGEDLGGRTIGLFSYGSGAVGEFFTATVKPQYRRHLRAEAHR
                     AMLDSRRRLDGRTYAAWFYDAPSQAEDRVFPQESRGRFRLAAIEGQRRIYAAASSEPA
                     RAAA"
     misc_feature    456067..457209
                     /locus_tag="Mnod_8252"
                     /note="3-hydroxy-3-methylglutaryl CoA synthase,
                     prokaryotic clade; Region: HMG-CoA-S_prok; TIGR01835"
                     /db_xref="CDD:213655"
     misc_feature    456067..457011
                     /locus_tag="Mnod_8252"
                     /note="'initiating' condensing enzymes are a subclass of
                     decarboxylating condensing enzymes, including
                     beta-ketoacyl [ACP] synthase, type III and polyketide
                     synthases, type III, which include chalcone synthase and
                     related enzymes. They are...; Region: init_cond_enzymes;
                     cd00827"
                     /db_xref="CDD:238423"
     misc_feature    order(456295..456297,456301..456303,456328..456330,
                     456337..456339,456364..456381,456406..456408,
                     456415..456420,456427..456432,456487..456489,
                     456592..456603,456610..456615,456985..456987)
                     /locus_tag="Mnod_8252"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238423"
     misc_feature    order(456391..456393,456766..456768,456883..456885)
                     /locus_tag="Mnod_8252"
                     /note="active site"
                     /db_xref="CDD:238423"
     gene            457253..458068
                     /locus_tag="Mnod_8253"
                     /db_xref="GeneID:7295468"
     CDS             457253..458068
                     /locus_tag="Mnod_8253"
                     /inference="protein motif:PFAM:PF00378"
                     /note="PFAM: Enoyl-CoA hydratase/isomerase;
                     KEGG: rru:Rru_A1942 methylglutaconyl-CoA hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Enoyl-CoA hydratase/isomerase"
                     /protein_id="YP_002490386.1"
                     /db_xref="GI:220915078"
                     /db_xref="InterPro:IPR001753"
                     /db_xref="GeneID:7295468"
                     /translation="MDQSVVVHRRALPGGAPVAEIRLMRPERGNALDEDMLGRIARIA
                     QDLAGEEALRAVLLTGEGRHFCAGADLGWMRRAAELSGAENLRDAAHLDRALGSLAAL
                     PVPLIAVVQGCCYGGGLGLISCADVALAEASATFRFSEPRLGLVPAVISPFVVRAIGL
                     RRARRRFLTAEPFGADEAWADGLVHEVLPAPAMQGRIEALVAAIAACGPQALRQCKAL
                     LARLERHDGLADETDHARALIARMRTTPEAQEGMAAFLAKRPPAWAAASPDAD"
     misc_feature    457253..458041
                     /locus_tag="Mnod_8253"
                     /note="enoyl-CoA hydratase; Provisional; Region: PRK05995"
                     /db_xref="CDD:235664"
     misc_feature    457301..457864
                     /locus_tag="Mnod_8253"
                     /note="Crotonase/Enoyl-Coenzyme A (CoA) hydratase
                     superfamily. This superfamily contains a diverse set of
                     enzymes including enoyl-CoA hydratase, napthoate synthase,
                     methylmalonyl-CoA decarboxylase, 3-hydoxybutyryl-CoA
                     dehydratase, and dienoyl-CoA isomerase; Region:
                     crotonase-like; cd06558"
                     /db_xref="CDD:119339"
     misc_feature    order(457337..457339,457343..457345,457439..457441,
                     457451..457465,457589..457591,457595..457603,
                     457667..457672,457679..457681)
                     /locus_tag="Mnod_8253"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119339"
     misc_feature    order(457457..457459,457601..457603)
                     /locus_tag="Mnod_8253"
                     /note="oxyanion hole (OAH) forming residues; other site"
                     /db_xref="CDD:119339"
     misc_feature    order(457541..457543,457565..457567,457628..457639,
                     457673..457684,457697..457699,457703..457711,
                     457715..457720,457733..457738,457742..457747,
                     457751..457756,457763..457765,457796..457798,
                     457805..457807,457850..457852,457859..457864)
                     /locus_tag="Mnod_8253"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119339"
CONTIG      join(CP001351.1:1..458070)
//
DBGET integrated database retrieval system