GenomeNet

Database: RefSeq
Entry: NC_012586
LinkDB: NC_012586
Original site: NC_012586 
LOCUS       NC_012586            2430033 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Sinorhizobium fredii NGR234 plasmid pNGR234b, complete sequence.
ACCESSION   NC_012586
VERSION     NC_012586.1  GI:227818258
DBLINK      Project: 59081
KEYWORDS    RefSeq.
SOURCE      Sinorhizobium fredii NGR234
  ORGANISM  Sinorhizobium fredii NGR234
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
REFERENCE   1  (bases 1 to 2430033)
  AUTHORS   Schmeisser,C., Liesegang,H., Krysciak,D., Bakkou,N., Le Quere,A.,
            Wollherr,A., Heinemeyer,I., Morgenstern,B., Pommerening-Roser,A.,
            Flores,M., Palacios,R., Brenner,S., Gottschalk,G., Schmitz,R.A.,
            Broughton,W.J., Perret,X., Strittmatter,A.W. and Streit,W.R.
  TITLE     Rhizobium sp. strain NGR234 possesses a remarkable number of
            secretion systems
  JOURNAL   Appl. Environ. Microbiol. 75 (12), 4035-4045 (2009)
   PUBMED   19376903
REFERENCE   2  (bases 1 to 2430033)
  AUTHORS   Streit,W.R., Schmitz,R.A., Perret,X., Staehelin,C., Deakin,W.J.,
            Raasch,C., Liesegang,H. and Broughton,W.J.
  TITLE     An evolutionary hot spot: the pNGR234b replicon of Rhizobium sp.
            strain NGR234
  JOURNAL   J. Bacteriol. 186 (2), 535-542 (2004)
   PUBMED   14702322
REFERENCE   3  (bases 1 to 2430033)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 2430033)
  AUTHORS   Liesegang,H., Krysziak,D., Schmeisser,C., Bakkou,N., Le Quere,A.,
            Strittmatter,A.W., Wollherr,A., Heinemeyer,I., Morgenstern,B.,
            Gottschalk,G., Schmitz,R.A., Broughton,W.J., Perret,X. and
            Streit,W.R.
  TITLE     Direct Submission
  JOURNAL   Submitted (29-OCT-2007) Institute of Microbiology and Genetics,
            Goettingen Genomics Laboratory, Grisebachstrasse 8, Goettingen,
            Lower Saxony D-37077, Germany
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from CP000874.
            Rhizobium sp. NGR234 is available from Prof. Wolfgang Streit,
            Biozentrum Klein Flottbek,Mikrobiologie, Ohnhorststr. 18  D-22609
            Hamburg, wolfgang.streit@uni-hamburg.de.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2430033
                     /organism="Sinorhizobium fredii NGR234"
                     /mol_type="genomic DNA"
                     /strain="NGR234"
                     /db_xref="taxon:394"
                     /plasmid="pNGR234b"
     gene            245..1441
                     /gene="repA1"
                     /locus_tag="NGR_b00010"
                     /db_xref="GeneID:7788910"
     CDS             245..1441
                     /gene="repA1"
                     /locus_tag="NGR_b00010"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein A"
                     /protein_id="YP_002822230.1"
                     /db_xref="GI:227818259"
                     /db_xref="GeneID:7788910"
                     /translation="MLQPRVQSVDEQEHLPSLLSADAQELAHQLQEHQKKIFSPTAQK
                     TMRLFSPAEAAAFIGIGEGYLRQIASEGHGPQPLSNGRRMYAVEDVERIRRVLDEGAK
                     TGKYIPHRRPGEKLQVISVMNFKGGSGKTTTSAHLSQYLALRGYRVLAIDLDPQASLS
                     ALFGHQPELDVGEAETLYGAIRYESPRPIADVVRSTYTTNLHLIPGNLELMEFEHETP
                     KAMIGGSAETLFFARIGEVLTEIESFYDIVVIDCPPQLGFLTMSALCAATSVLITVHP
                     QMLDVMSMSQFLSMTSELMAVVEKAGGRTSYDWMRYLVTRFEPNDGPQSQMTGFMRAI
                     FGNRMLHNAMVKSTAISDAGVTKQTLYEVERSQFIRGTYDRAMDSLSLVNAEIEEMIR
                     SVWGRK"
     misc_feature    290..1435
                     /gene="repA1"
                     /locus_tag="NGR_b00010"
                     /note="plasmid partitioning protein RepA; Region:
                     partition_RepA; TIGR03453"
                     /db_xref="CDD:234215"
     misc_feature    596..1189
                     /gene="repA1"
                     /locus_tag="NGR_b00010"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    617..>1006
                     /gene="repA1"
                     /locus_tag="NGR_b00010"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    617..637
                     /gene="repA1"
                     /locus_tag="NGR_b00010"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(635..637,995..997)
                     /gene="repA1"
                     /locus_tag="NGR_b00010"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            1445..2449
                     /gene="repB1"
                     /locus_tag="NGR_b00020"
                     /db_xref="GeneID:7789542"
     CDS             1445..2449
                     /gene="repB1"
                     /locus_tag="NGR_b00020"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein B"
                     /protein_id="YP_002822231.1"
                     /db_xref="GI:227818260"
                     /db_xref="GeneID:7789542"
                     /translation="MARKNLIGISDSPAAPPDGERPAVERPIAGLAPGPRTSALVGGI
                     TRSLSNITQKVERAEELERQLAQGHAIVELEPSLVDASFIIDRLGVTPETQAALVQQI
                     RDHGQQVPILVRPHPEAENRYQVAYGHRRLAALREIGGKVKAVIRELSDEQLVISQGQ
                     ENNARTDLSYIERSLFATRLEDRGFSRETIMSALGVDKAALSKMISVVRRLPVEIIEA
                     IGAAPSFGRRRWMELADRLEHDGRRAKALAHIRQSPFMEMDSDRRFEKLFVVLAEARG
                     RAKAEAWLAPDRTRPVRIRDTDTETTLAFSKAAAPGFAEFVRGRLESLYLEYQQETGD
                     "
     misc_feature    1448..2434
                     /gene="repB1"
                     /locus_tag="NGR_b00020"
                     /note="plasmid partitioning protein RepB; Region:
                     partition_RepB; TIGR03454"
                     /db_xref="CDD:234216"
     misc_feature    1658..1933
                     /gene="repB1"
                     /locus_tag="NGR_b00020"
                     /note="ParB-like nuclease domain; Region: ParB;
                     smart00470"
                     /db_xref="CDD:214678"
     misc_feature    1934..2428
                     /gene="repB1"
                     /locus_tag="NGR_b00020"
                     /note="RepB plasmid partitioning protein; Region: RepB;
                     pfam07506"
                     /db_xref="CDD:254246"
     gene            2455..2501
                     /locus_tag="NGR_b00030"
                     /db_xref="GeneID:7789543"
     ncRNA           2455..2501
                     /locus_tag="NGR_b00030"
                     /ncRNA_class="antisense_RNA"
                     /product="antisense RNA regulator of RepB translation"
                     /note="ctRNA, p42d, RF00489"
                     /db_xref="GeneID:7789543"
     gene            2541..2608
                     /locus_tag="NGR_b00040"
                     /db_xref="GeneID:7789544"
     ncRNA           2541..2608
                     /locus_tag="NGR_b00040"
                     /ncRNA_class="antisense_RNA"
                     /product="negative antisense RNA regulator of RepC"
                     /note="S-element, RF00490"
                     /db_xref="GeneID:7789544"
     gene            2606..3919
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /db_xref="GeneID:7789545"
     CDS             2606..3919
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /codon_start=1
                     /transl_table=11
                     /product="replication initiation protein RepC"
                     /protein_id="YP_002822232.1"
                     /db_xref="GI:227818261"
                     /db_xref="GeneID:7789545"
                     /translation="MERGNVTTPFGRRAMTLGMLARQIAAGDIPPKQSVDKWKLFRTV
                     CEAKSAIGVSDRSLAVLNALLSFYPGAELSSENGLVVFPSNAQLSLRTHGMAGTTLRR
                     HLACLVEAGLIVRRDSPNGKRYARKSRNGAIGEAFGFDLSPLLARTEEFRAAAAKLAA
                     EKQHLRLVRERLSLCRRDIAKLLDLSRQSNPDADCQAFESAFGQLNAGLPRNAPVGFL
                     EALLEKLGKLREQLTNRLEILLNSQKTATNDHQNGRHKQNSNPDFQFESEPGLGKDGE
                     VSLADDCSRTESAGRTGKPHQQRPDETSSRLPDSVSPAPPVDRLRRQIPLPAVLQACP
                     QIADYGPSGRVANWKDLMTAAIVVRTMLNVSADAFEDACLVLGYENAATLMACILERA
                     DRINSPGGYLRDLTQRARQQAFSLAPMVGALSQARRQGLRGSQSA"
     misc_feature    2606..3907
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /note="replication initiation protein RepC; Provisional;
                     Region: PRK13824"
                     /db_xref="CDD:184349"
     misc_feature    2642..3157
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /note="Replication protein C N-terminal domain; Region:
                     RP-C; pfam03428"
                     /db_xref="CDD:251945"
     misc_feature    <2855..2992
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(2855..2863,2891..2902,2906..2911,2918..2923,
                     2927..2932,2948..2956,2969..2977)
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(2855..2857,2864..2866)
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    3182..3892
                     /gene="repC"
                     /locus_tag="NGR_b00050"
                     /note="Replication protein C C-terminal region; Region:
                     RP-C_C; pfam11800"
                     /db_xref="CDD:256631"
     gene            4178..5389
                     /locus_tag="NGR_b00060"
                     /db_xref="GeneID:7789546"
     CDS             4178..5389
                     /locus_tag="NGR_b00060"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide biosynthesis protein"
                     /protein_id="YP_002822233.1"
                     /db_xref="GI:227818262"
                     /db_xref="GeneID:7789546"
                     /translation="MRLILVNDVSIIRGGATKVALQCIDASRQAGLNCAILVGDDGEG
                     LMPRFAGIRTVALGQRPLRDGPTFTDVFEKNYNQHAYDALDGLLKETDEETVVHVHGW
                     SQILSPSIFYALAKHKAKVIVTAHDFFLSCPNGGLINFQSGAVCDVRPMSAACLTTNC
                     DKRNYLHKLWRFRRTLTQRGVGEEFWSRVGIVLAHESMEPFLHSGPLQHFITLRTPTE
                     PLTHTPVEAWRNHRTLFLGRMCWEKGVRTLADALNKTGRTATLIGRGPLLDEMQRALP
                     HCWVPGWLADEEVTTLAGQARVFIMPSRMPEPYGLVAAEALMSGIPVIISSNALIAAE
                     VERYDAGLVFRSGDAGSLAESLASTDDDRLMQRLCEGALGLGQRIAPSKAEWGRRMVD
                     IYTGRSGLFAQ"
     misc_feature    4178..5293
                     /locus_tag="NGR_b00060"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     misc_feature    4355..5293
                     /locus_tag="NGR_b00060"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            5404..6384
                     /locus_tag="NGR_b00070"
                     /db_xref="GeneID:7789547"
     CDS             5404..6384
                     /locus_tag="NGR_b00070"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent epimerase/dehydratase"
                     /protein_id="YP_002822234.1"
                     /db_xref="GI:227818263"
                     /db_xref="GeneID:7789547"
                     /translation="MARALVTGGCGFVGRHLIKRLLTEGLDVVCVDPLVEGTGARHPD
                     LWQRFPGSRFAFFEEDCRSFFFRPLEHFDYVFHLAALVGGRVTLEARTLDVAEDLAVD
                     AELWKWAARAKPGCVVFFSSSAAYPVSLQTLANHRLLSEDMISFEAAIGVPDLSYGWA
                     KLTGEYLMKLYVERYGNRAVAYRPFSGYGEDQDLAYPFPAICRRLLDERGAAEVCVWG
                     SGRQCRDFIHIDDCIDFIWQTKELLPDGASLNLSTGRATSFMKLAEIIARQIGWNPVV
                     NGLRDRPEGVFYRCGDTALQRSYGLAPRVSLEEGIARMLDHLRMEFDTCS"
     misc_feature    5410..6372
                     /locus_tag="NGR_b00070"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    5410..6354
                     /locus_tag="NGR_b00070"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(5425..5427,5431..5436,5440..5442,5497..5505,
                     5635..5643,5761..5769,5872..5874,5884..5886,5953..5964)
                     /locus_tag="NGR_b00070"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(5707..5709,5767..5769,5872..5874,5884..5886)
                     /locus_tag="NGR_b00070"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(6983..7819)
                     /locus_tag="NGR_b00080"
                     /db_xref="GeneID:7789548"
     CDS             complement(6983..7819)
                     /locus_tag="NGR_b00080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822235.1"
                     /db_xref="GI:227818264"
                     /db_xref="GeneID:7789548"
                     /translation="MASVLAASGGVKQVICISWGTKYGAPFINRLYAMVARNITPPFT
                     FTCFTDSRENLRPEILCEDLPPLDVEMPTNTKGIWPKARLWGPKLGNLKGPVLFLDLD
                     VVIVGSLDSFFEAGGPDDVVLAVNQTTPFERLGQTSVFRFPVGKLVPLQEKFRTDPQG
                     VADEYRFEQRFVTRNAPGGAKFFPRRHVLHFRQDCRWPFPLNYYLAPRLPADARIVLF
                     PRGLLPQHAIDGQFGYKGRAATPLGHVRGLFSPERRERNPFRYLRHYIRPTGWVAEHW
                     RE"
     gene            8316..9518
                     /locus_tag="NGR_b00090"
                     /db_xref="GeneID:7789549"
     CDS             8316..9518
                     /locus_tag="NGR_b00090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822236.1"
                     /db_xref="GI:227818265"
                     /db_xref="GeneID:7789549"
                     /translation="MLASVSAKGFIFIMRYETPDPLHPALLPGLIAAEDGLARLDERA
                     ARHAVAEGFRERGQFFDAAAALWVAGELVHVEDLVLHDSHMDARAPSHELTIAHAVLR
                     ARRRLDLAEPGWALSLSGLNALRGEQGAVPANGGRSEAPDHPPDREEAGEAAVDGEDN
                     PLANEFAELDAAMARSQQLLDFHAGSLAEAASPLSAERMAPERTAEPTGQLGLLFDED
                     WDEAARLDAWRGVLAAADQLPACLGAAVLFDAWERIEPLRRQHWLGSLLVGAYLRCRG
                     KVASHVLGFNTGLKTIRHERRRSKDRSARLNAFLEAMAVTADLGLKELDRLSLSRTQM
                     EMRIKDRRSNSNLPGLIDLVLSRPIVSTAMIARHLGVTPRGALNLVRELGVREITGRG
                     RYRGWGVI"
     misc_feature    8949..9335
                     /locus_tag="NGR_b00090"
                     /note="Protein of unknown function (DUF1612); Region:
                     DUF1612; pfam07756"
                     /db_xref="CDD:149040"
     misc_feature    9354..9515
                     /locus_tag="NGR_b00090"
                     /note="HTH DNA binding domain; Region: HTH_13; pfam11972"
                     /db_xref="CDD:152407"
     gene            complement(9548..10048)
                     /locus_tag="NGR_b00100"
                     /db_xref="GeneID:7789550"
     CDS             complement(9548..10048)
                     /locus_tag="NGR_b00100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822237.1"
                     /db_xref="GI:227818266"
                     /db_xref="GeneID:7789550"
                     /translation="MTRHLLVAAMLLLFAGTAQADESAFLGSLEGQWTGGGMVRVRVD
                     RTPINVSCNFDSQATDAALSMRGTCRGLIVVSRSIGADLQFTGVNYSGTYVGPSGRKS
                     TLTGKRRGSAINLTIHWAREVNGDRRANLTLQKVGENGMKLMTVDVDPRSGNRVVTSE
                     INLQRK"
     gene            complement(10347..11210)
                     /locus_tag="NGR_b00110"
                     /db_xref="GeneID:7789551"
     CDS             complement(10347..11210)
                     /locus_tag="NGR_b00110"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane protein"
                     /protein_id="YP_002822238.1"
                     /db_xref="GI:227818267"
                     /db_xref="GeneID:7789551"
                     /translation="MDRITSGWMNGMAGVLIFSGSLPATRIAVMDFDPVFLTVARATI
                     AGLLAFCLLVVFREKRPERGDLLPLAIVSLGVVVGFPLLTALALRHVTSAHSIVFVGL
                     LPLATAIFGVLRGGERPKPAFWLFSGLGSTIVVGFALRQGFAASPVGDLLMLAAILAC
                     GLGYAEGAKLSRKLGGWQVISWALVLSLPVMLGLALATMPVSFDALRPASWFGLGYVS
                     VFSMLIGFIFWYRGLAQGGIVAVGQLQLLQPFFGLALAATLLDETVSWPMLAATLAIV
                     ACVAGAKKFAS"
     misc_feature    complement(10353..11210)
                     /locus_tag="NGR_b00110"
                     /note="Permeases of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism / Amino
                     acid transport and metabolism / General function
                     prediction only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     misc_feature    complement(10821..11165)
                     /locus_tag="NGR_b00110"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     misc_feature    complement(10380..10739)
                     /locus_tag="NGR_b00110"
                     /note="EamA-like transporter family; Region: EamA;
                     pfam00892"
                     /db_xref="CDD:250209"
     gene            11328..12725
                     /locus_tag="NGR_b00120"
                     /db_xref="GeneID:7789552"
     CDS             11328..12725
                     /locus_tag="NGR_b00120"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002822239.1"
                     /db_xref="GI:227818268"
                     /db_xref="GeneID:7789552"
                     /translation="MRPQSADADGETLIARVMATVRNRISGRTLTPGARLPSIRASAT
                     SLKVSKSTVVEAYERLAAEGLIRSRPGSGFFVAAPLAPLSLAEIGPRVEREVDPLWIS
                     RQALEADGNVLKPGCGWLPASWMPEEGLRRALRAVARGRAATLVEYGPPLGLLALRQL
                     LARRLAQHGIEASPEQVMLTESGTQAIDLLCRFLVEPGEAVLVDDPCYFNFHALLRAH
                     QAKIVGIPYTPAGPDIDRFAAALQEHRPRLYITNSALHNPTGATLSPLVAHRLLKLAE
                     QFGLTIVEDDIFADFEEAAAPRLAAFDGLERVVHIGSFSKSLSAAVRCGFIAAPRGWI
                     EPLTDLKIATSFGAAGFSAELVLTLLKDGSYRKHMETVRQRLSRAMAGTIARLRQIGI
                     EPWIEPQAGMFVWCRLPDGIDAAQLARRALAENIVLAPGNVFSQAQTAGNFLRFNVAQ
                     CEDERLFRELAGLMR"
     misc_feature    11355..12722
                     /locus_tag="NGR_b00120"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     misc_feature    11361..11558
                     /locus_tag="NGR_b00120"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(11361..11363,11367..11369,11436..11438,11442..11447,
                     11469..11483,11487..11492,11499..11501,11529..11534,
                     11538..11549)
                     /locus_tag="NGR_b00120"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    11829..12710
                     /locus_tag="NGR_b00120"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    order(11871..11879,11949..11951,12096..12098,12189..12191,
                     12264..12266,12270..12275,12294..12296)
                     /locus_tag="NGR_b00120"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(11880..11882,11979..11981,12168..12170,12288..12296,
                     12381..12383,12390..12392)
                     /locus_tag="NGR_b00120"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    12273..12275
                     /locus_tag="NGR_b00120"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(12791..13690)
                     /locus_tag="NGR_b00130"
                     /db_xref="GeneID:7789553"
     CDS             complement(12791..13690)
                     /locus_tag="NGR_b00130"
                     /note="specific inhibitor of chromosomal initiation of
                     replication in vitro; binds the three 13-mers in the
                     origin (oriC) to block initiation of replication; also
                     controls genes involved in arginine transport"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome replication initiation inhibitor
                     protein"
                     /protein_id="YP_002822240.1"
                     /db_xref="GI:227818269"
                     /db_xref="GeneID:7789553"
                     /translation="MLDYSALRAVSAVVQTGSFEKAAAMLNVTPSAVSQRVKQLEERL
                     GTVLIARGNPCTATEKGAWLCRHMETVGMLESELFEHLPALTDPGEPKQRVTLHVATS
                     ADSLGTWFVAAISRFAKGSDYLLNIALDDEDHTAEWLRRGRVIAAVTSLEKPIQGCRR
                     LSLGALRYHATASPDFVARHFADGVTPESIANAPALTFNQKDRLQSRWIRQALGKDLA
                     YPTHWLPSTQSFLDASLSGMGWCMNPTQLARQHLDAGRLVELIPDTPLDVPLYWQMNR
                     LAADRLADFTREVTTVAREQLLR"
     misc_feature    complement(12800..13690)
                     /locus_tag="NGR_b00130"
                     /note="chromosome replication initiation inhibitor
                     protein; Validated; Region: PRK03635"
                     /db_xref="CDD:235144"
     misc_feature    complement(13508..13675)
                     /locus_tag="NGR_b00130"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(12824..13405)
                     /locus_tag="NGR_b00130"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(12983..12988,12992..12997,13013..13030,
                     13298..13318,13325..13327,13337..13339,13346..13351,
                     13355..13360))
                     /locus_tag="NGR_b00130"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            13793..14401
                     /locus_tag="NGR_b00140"
                     /db_xref="GeneID:7789554"
     CDS             13793..14401
                     /locus_tag="NGR_b00140"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid efflux protein, LysE family"
                     /protein_id="YP_002822241.1"
                     /db_xref="GI:227818270"
                     /db_xref="GeneID:7789554"
                     /translation="MSFSIYVTGLMMGLSLIVAIGAQNAFVLRQGLRNEHLFAVCLAC
                     GLSDTLLIVLGVTSFQHIAALLPWLDPVMRYGGAAFLIWYGAKNLYSALRSSGALAAP
                     EARPSSFRQTLATCLALTWLNPHVYLDTVVLLGTISTRFPGQEFSFTTGAVTASFLFF
                     FGLGYGATWLRPIFLKPTAWRVLETLIAFTMWMIASKLLRGA"
     misc_feature    13799..14392
                     /locus_tag="NGR_b00140"
                     /note="Lysine efflux permease [General function prediction
                     only]; Region: COG1279"
                     /db_xref="CDD:224198"
     gene            14458..15093
                     /locus_tag="NGR_b00150"
                     /db_xref="GeneID:7789555"
     CDS             14458..15093
                     /locus_tag="NGR_b00150"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine efflux protein"
                     /protein_id="YP_002822242.1"
                     /db_xref="GI:227818271"
                     /db_xref="GeneID:7789555"
                     /translation="MLAELNHLLLVYTAYVIAAGSPGPSNMRIMGVAMNNGRRAALVL
                     AAGVVSGSIFWGTMAATGISAILSRYAEALIVLKIFGGLYLLYLAFKAGRAALASDAE
                     AARTSSGDETLSGAALYRRGLLMHLTNPKSVLAWIALVTLGLGPGSSWHTLAAILAGC
                     AVLSVTIFCGYAIIFSTAPMVRLYRRTRRWIEAILAVFFGVAGLRLLLSRA"
     misc_feature    14479..15090
                     /locus_tag="NGR_b00150"
                     /note="Putative threonine efflux protein [Amino acid
                     transport and metabolism]; Region: RhtB; COG1280"
                     /db_xref="CDD:224199"
     gene            15104..15997
                     /locus_tag="NGR_b00160"
                     /db_xref="GeneID:7789556"
     CDS             15104..15997
                     /locus_tag="NGR_b00160"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="YP_002822243.1"
                     /db_xref="GI:227818272"
                     /db_xref="GeneID:7789556"
                     /translation="MTLFTGLAAFPITPTDASGHVDTAALARLLERIRLAGADSIGLL
                     GSTGGYAFLSRDERRCAVEAAMACVGGRIPVIVGVGALRTDDAQALARDARAAGADGL
                     LLAPMSYTPLLDEEVYQHFAAVADAGDLPLSIYNNPGTTRFTFSNALIGRLSKVAKVA
                     AVKMPLPPDGDFKGEMARLRTETAPGFSIGYSGDWGAAAALLSGCDAWYSVVAGLLPA
                     EAMALTRAARAGDLSEVERLDRAFQPLWSLFKAFGSFRVMYAIAEALGLCRAEPPRPI
                     LPLPSTEIPRVRSALDRVLLK"
     misc_feature    15128..15976
                     /locus_tag="NGR_b00160"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(15131..15133,15227..15229,15236..15244,15506..15508,
                     15590..15592)
                     /locus_tag="NGR_b00160"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(15227..15229,15236..15244,15506..15508,15590..15592,
                     15728..15730)
                     /locus_tag="NGR_b00160"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(15239..15241,15254..15259,15350..15355,15425..15430,
                     15449..15451,15461..15463,15923..15928)
                     /locus_tag="NGR_b00160"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    15590..15592
                     /locus_tag="NGR_b00160"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            complement(15963..17291)
                     /locus_tag="NGR_b00170"
                     /db_xref="GeneID:7789557"
     CDS             complement(15963..17291)
                     /locus_tag="NGR_b00170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822244.1"
                     /db_xref="GI:227818273"
                     /db_xref="GeneID:7789557"
                     /translation="MDFVEALNAAASWLQTFLINEWTLYQSALIVVGYFVCGLLAKRL
                     EPALEARARMIKGNPDLLRVIIAFMRRLKWLFLIVWLWIADVVLSRYGWPSYRWLVAT
                     ALTLVAAWFIIAVLTRIIRNQTLARVVAVIGWLYFALYALGLDRPVLTALDSLAVNLG
                     AVRLSMLLVLKAILLSAAMIWLAVLFGNMSSNWVQKSADLTPSLKVLISKLIKIGLIM
                     LAGTIALSATGIDLTALTVFSGAVGVGIGFGLQKVVSNFISGIIILLDKSIKPGDTIT
                     LGETFGSVRDLRSRFVSVITRDGKEYLIPNEDFISKQVVNWSFSSDYVRIDVGFETSP
                     SSDPHEVARLAIETAKTVPRVASAYAEPVCWLTGFGGSSLGFKLRFWISDPSNGLTNI
                     RGQVFMALWDAFDAAGISMPDPREIIMKTPAELAGAEEPATSTRRDRARF"
     misc_feature    complement(15999..16910)
                     /locus_tag="NGR_b00170"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    complement(16059..16661)
                     /locus_tag="NGR_b00170"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            17622..18092
                     /locus_tag="NGR_b00180"
                     /db_xref="GeneID:7789558"
     CDS             17622..18092
                     /locus_tag="NGR_b00180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822245.1"
                     /db_xref="GI:227818274"
                     /db_xref="GeneID:7789558"
                     /translation="MRIVSLSAVVCIGLCGIASFASAEDAHTIIAPDDVKWAPAPKIL
                     PAGAETAVLFGDPSKEGLFALRLKVPSGYAVPPHTHPADEVVTVISGTINLGMGETAD
                     RSASKALSAGSFFALPPGMAHFAYFDEETVVQITTNGPWGIKYVNPADDPQKSQ"
     misc_feature    17802..>18026
                     /locus_tag="NGR_b00180"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            complement(18196..20085)
                     /locus_tag="NGR_b00190"
                     /db_xref="GeneID:7789559"
     CDS             complement(18196..20085)
                     /locus_tag="NGR_b00190"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxyphenylpyruvate dioxygenase"
                     /protein_id="YP_002822246.1"
                     /db_xref="GI:227818275"
                     /db_xref="GeneID:7789559"
                     /translation="MKTSIATVSLSGDLSDKLRAIAKAGFDGVEIFENDFLAFDESPR
                     EVGRMVRDFGLEISLFQPFRDFEGMPEPLRTRTFDRAERKFDLMQELGTDLVLVCSNV
                     SPAALGGIDRTAADFRELGERAAKRGLRVGYEALAWGRHISDHRDAWEIVRRADHPNI
                     GLILDSFHTLSRKIEVNSIRSIPKEKIFIVQLADAPLIDMDLLYWSRHFRNMPGEGDL
                     PVTDFTRAVAATGYDGYLSLEIFNDQFRGGNANAIAVDGYRSLIYLGDQVKRAEPGIR
                     LPVPAMPPRVDVKGVAFVEFTASEEEAVELEALIRTIGFRRAARHRTKQVLVYRQGAI
                     NLVINTEREGFASASYLVHGTSAYAFGLMVDDAAATAERARALGAEPFEQAVGPGELM
                     VPAIRGVGGGLIYFLDEKSDLSKIWEIEFEPVTDDDTAAPAGLTVIDHVAQTVKYEEL
                     LTWLLFYTSLLDTRKTPMVDIIDPAGIVRSQVVENDAGTLRLTLNGAENRNTLAGRFI
                     AETFGSGVQHLAFATDDIFATAAALRANGFRALPISPNYYDDVEARFGLEADLVERLK
                     AENILYDRDEGGEFFQLYSPTYGEGFFFEIIERRGYRGYGAANAIFRIAALKKHLRPE
                     GMPKG"
     misc_feature    complement(19300..20085)
                     /locus_tag="NGR_b00190"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    complement(19432..20034)
                     /locus_tag="NGR_b00190"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     misc_feature    complement(18199..19284)
                     /locus_tag="NGR_b00190"
                     /note="4-hydroxyphenylpyruvate dioxygenase and related
                     hemolysins [Amino acid transport and metabolism / General
                     function prediction only]; Region: COG3185"
                     /db_xref="CDD:225726"
     misc_feature    complement(18817..19215)
                     /locus_tag="NGR_b00190"
                     /note="N-terminal domain of 4-hydroxyphenylpyruvate
                     dioxygenase (HPPD) and hydroxymandelate Synthase (HmaS);
                     Region: HPPD_N_like; cd08342"
                     /db_xref="CDD:176690"
     misc_feature    complement(order(19021..19023,19105..19107,19111..19113,
                     19165..19170,19174..19182))
                     /locus_tag="NGR_b00190"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176690"
     misc_feature    complement(18238..18783)
                     /locus_tag="NGR_b00190"
                     /note="C-terminal domain of 4-hydroxyphenylpyruvate
                     dioxygenase (HppD) and hydroxymandelate Synthase (HmaS);
                     Region: HPPD_C_like; cd07250"
                     /db_xref="CDD:176673"
     misc_feature    complement(order(18256..18261,18271..18273,18301..18303,
                     18334..18336,18532..18534,18577..18579,18601..18603,
                     18607..18609,18646..18648,18766..18768))
                     /locus_tag="NGR_b00190"
                     /note="active site"
                     /db_xref="CDD:176673"
     misc_feature    complement(order(18301..18303,18532..18534,18766..18768))
                     /locus_tag="NGR_b00190"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:176673"
     gene            complement(20326..21201)
                     /locus_tag="NGR_b00200"
                     /db_xref="GeneID:7789560"
     CDS             complement(20326..21201)
                     /locus_tag="NGR_b00200"
                     /note="AroE; catalyzes the conversion of shikimate to
                     3-dehydroshikimate"
                     /codon_start=1
                     /transl_table=11
                     /product="shikimate 5-dehydrogenase"
                     /protein_id="YP_002822247.1"
                     /db_xref="GI:227818276"
                     /db_xref="GeneID:7789560"
                     /translation="MRAENMAETLVRPLKAGLIGAGIQASLTPAMHMAEGAAQGLSYE
                     YELIDLQALGATEDDLPRLLAEAEARGLAGLNITHPCKQAVIAHLDELAPDARRLGAV
                     NTVVLKGGRRYGHNTDWWGFAEGFKRGLPGADLSSAVQLGAGGAGVATAYAGLSLGLR
                     RLAVFDREPERAEALAEMLAPLFPEADIAAGTDLAAAMLDAAGVIHATPTGMAKYPGL
                     PLDAELLAPHHWVAEIVYFPLETALLKEAKRRGCRTLDGGGMAVFQAVGAFRLFTGLE
                     PDAGRMLEHFKAMTG"
     misc_feature    complement(20329..21177)
                     /locus_tag="NGR_b00200"
                     /note="shikimate 5-dehydrogenase; Reviewed; Region:
                     PRK12549"
                     /db_xref="CDD:183586"
     misc_feature    complement(20887..21150)
                     /locus_tag="NGR_b00200"
                     /note="Shikimate dehydrogenase substrate binding domain;
                     Region: Shikimate_dh_N; pfam08501"
                     /db_xref="CDD:254837"
     misc_feature    complement(20380..20853)
                     /locus_tag="NGR_b00200"
                     /note="NAD(P) binding domain of Shikimate dehydrogenase;
                     Region: NAD_bind_Shikimate_DH; cd01065"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(20410..20412,20419..20421,20494..20496,
                     20848..20850))
                     /locus_tag="NGR_b00200"
                     /note="shikimate binding site; other site"
                     /db_xref="CDD:133443"
     misc_feature    complement(order(20419..20424,20431..20433,20500..20502,
                     20575..20583,20701..20706,20764..20766,20773..20775))
                     /locus_tag="NGR_b00200"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133443"
     gene            complement(21269..22282)
                     /locus_tag="NGR_b00210"
                     /db_xref="GeneID:7789561"
     CDS             complement(21269..22282)
                     /locus_tag="NGR_b00210"
                     /codon_start=1
                     /transl_table=11
                     /product="extracytoplasmic solute receptor of
                     TRAP-transport system"
                     /protein_id="YP_002822248.1"
                     /db_xref="GI:227818277"
                     /db_xref="GeneID:7789561"
                     /translation="MLKFTKLALGLALPLALLTAGPTNAEIGEHTLKFASANNKGHPQ
                     VTGMEKFAELVKEKSGGKIEVKLFPGGTLGGDVQTISALQGGVIEMTVLNAGILSNNV
                     KQFGAVDLPFLFNSGEEADKVMDGPFGESLLKLLPDTGLVGLGYWELGFRNLTNNRHA
                     VTKLEDIKGLKIRTIQSPIPLELFNTLGANAVPLPYTELYTALETGTVDGQENPAANI
                     LNAKFYEVQKYMTLTRHQYNPQIVLVSKKFWDGLNDEEKAVLQSAATEARDFQRKVSR
                     EKDAEALEEIKKTGMEVSELSPEETQKLRDAVKPVIEKFSAEIGADTVQALFKEIGAA
                     RGQ"
     misc_feature    complement(21302..22213)
                     /locus_tag="NGR_b00210"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            complement(22345..23625)
                     /locus_tag="NGR_b00220"
                     /db_xref="GeneID:7789562"
     CDS             complement(22345..23625)
                     /locus_tag="NGR_b00220"
                     /codon_start=1
                     /transl_table=11
                     /product="large transmembrane subunit, TRAP-transport
                     system"
                     /protein_id="YP_002822249.1"
                     /db_xref="GI:227818278"
                     /db_xref="GeneID:7789562"
                     /translation="MTVSIFIGALLGPMALGVPIAFALILSGVALMLYLGLFDAQIVA
                     QNVLNGADSFPLMAVPFFLLAGEVMNTGGLSRRIVALAMAMVGHIRGGLGFVAIFAAC
                     ILSSLSGSAVADAAALGALLLPMMLKSGHDAARAGGLLASASIIGPIIPPSIGFILYG
                     VVGGVSITKLFLAGIFPGLMIAAALCITWFLVARKEQFELPPKESGAVRLKALADSIW
                     ALMLPVIIIVGLKFGVFTPTEAGVVAAVYSLFVAMVVYRELPPAQLFHVFVAAAKITA
                     VVMFLVACAAVSAWLITVADVPGALAALVEPLMDNQTLLLIAIMALVVVVGTAMDMTP
                     TILVMTPVLMPIIKQAGIDPVYFGVLFIINNSIGLITPPVGTVLNVICGVSKLSMEDL
                     MKGVMPFLIAELIVLFLLVLFPELVTVPVSWFGH"
     misc_feature    complement(22357..23625)
                     /locus_tag="NGR_b00220"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; cl17274"
                     /db_xref="CDD:266603"
     misc_feature    complement(22378..23607)
                     /locus_tag="NGR_b00220"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     gene            complement(23636..24199)
                     /locus_tag="NGR_b00230"
                     /db_xref="GeneID:7789563"
     CDS             complement(23636..24199)
                     /locus_tag="NGR_b00230"
                     /codon_start=1
                     /transl_table=11
                     /product="small transmembrane subunit, TRAP-transport
                     system"
                     /protein_id="YP_002822250.1"
                     /db_xref="GI:227818279"
                     /db_xref="GeneID:7789563"
                     /translation="MTRIIDFYFFALKVTIALLLAGMVVLVFGNVVLRYAFNQGITVS
                     EELSRIFFVWLTFLGAVVAMREHGHLGVDTLIKRLPPLGAKVAVLIGHVLMLYATWLM
                     ISGSWAQTLINLHVGAPATGLSMGFFYGAGLAFGIPAFLILLSDAFAIATGRIDVTTA
                     ELVRDSEDEVALDEIPSPALGPVSAKH"
     misc_feature    complement(23675..24199)
                     /locus_tag="NGR_b00230"
                     /note="TRAP-type C4-dicarboxylate transport system, small
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctM; COG3090"
                     /db_xref="CDD:225632"
     gene            24593..25258
                     /locus_tag="NGR_b00240"
                     /db_xref="GeneID:7789564"
     CDS             24593..25258
                     /locus_tag="NGR_b00240"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_002822251.1"
                     /db_xref="GI:227818280"
                     /db_xref="GeneID:7789564"
                     /translation="MAERQMNGRKNDPARTQEDILEVATEEFSTHGLAGARVDQIAER
                     TRTSKRMIYYYFGSKEALYLAVLERSYRKIRTLEADLELANLPPEQALRTLIATTFDH
                     DEANPDFVRLVSIENIHHAAHMLRSEAIRELNVSVIQTIDAIVQRGLADGTFRRRADP
                     IDIHMLISAFCFFRVSNRYTFGTIFRRDLSEPATIGRHRTMIADAVVSYLKEEEGGGR
                     GGR"
     misc_feature    24608..25126
                     /locus_tag="NGR_b00240"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    24650..24790
                     /locus_tag="NGR_b00240"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(25347..25841)
                     /locus_tag="NGR_b00250"
                     /db_xref="GeneID:7789565"
     CDS             complement(25347..25841)
                     /locus_tag="NGR_b00250"
                     /codon_start=1
                     /transl_table=11
                     /product="cytidine/deoxycytidylate deaminase family
                     protein"
                     /protein_id="YP_002822252.1"
                     /db_xref="GI:227818281"
                     /db_xref="GeneID:7789565"
                     /translation="MPGTKRPYDESLLRKAFDVARRSREGGDHPFGSILADRDGNVLL
                     EQCNGYSSEGGDRTAHAERLLATRAGKSYDLDFLAECTMYTSAEPCAMCSGAIYWAGI
                     GRVVFGLSEREMKQQIGDSKENPTLDLPCDIVFAAGQRPTEVVGPMLADEAAKLHKEY
                     WSRR"
     misc_feature    complement(25509..25805)
                     /locus_tag="NGR_b00250"
                     /note="Nucleoside deaminases include adenosine, guanine
                     and cytosine deaminases. These enzymes are Zn dependent
                     and catalyze the deamination of nucleosides. The zinc ion
                     in the active site plays a central role in the proposed
                     catalytic mechanism, activating a...; Region:
                     nucleoside_deaminase; cd01285"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(25563..25565,25572..25574,25656..25664,
                     25698..25700,25749..25751))
                     /locus_tag="NGR_b00250"
                     /note="nucleoside/Zn binding site; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(25542..25547,25554..25559,25566..25571,
                     25641..25643,25653..25655,25668..25670))
                     /locus_tag="NGR_b00250"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238612"
     misc_feature    complement(order(25563..25565,25572..25577,25656..25664))
                     /locus_tag="NGR_b00250"
                     /note="catalytic motif [active]"
                     /db_xref="CDD:238612"
     gene            complement(26074..26880)
                     /locus_tag="NGR_b00260"
                     /db_xref="GeneID:7789566"
     CDS             complement(26074..26880)
                     /locus_tag="NGR_b00260"
                     /note="similar to carboxyvinyl-carboxyphosphonate
                     phosphorylmutase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822253.1"
                     /db_xref="GI:227818282"
                     /db_xref="GeneID:7789566"
                     /translation="MDDKHTLFRKLHDDPGTFIIPNPWDTGTARILAAFPALATTSAG
                     MAFSLGLPEGRASREQTLAHCRSIVDATPLPVSADLEKGFGDDPESAAETVVAAAGIG
                     LAGCSLEDHTGDRARPIFDFGLAVERIEAAAQACRSLPHDFLLTARCENFLWGHTDLD
                     DTIRRLQAFERAGADVLYAPGLPDLDSIRAICEAVTKPVNVVMGMPGLTFGLAELAEA
                     GAKRISVGSALARLAFGAVVDAAREMRSQGTFRFSEKAMGFAELEGFFRN"
     misc_feature    complement(26152..26859)
                     /locus_tag="NGR_b00260"
                     /note="Members of the ICL/PEPM enzyme family catalyze
                     either P-C or C-C bond formation/cleavage. Known members
                     are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
                     hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
                     oxaloacetate hydrolase (OAH), isocitrate...; Region:
                     ICL_PEPM; cd00377"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(26155..26163,26167..26175,26179..26187,
                     26479..26481,26488..26493,26500..26502,26509..26514,
                     26581..26583,26590..26592,26602..26607,26626..26628,
                     26668..26673,26680..26685,26689..26694,26701..26706,
                     26710..26721,26725..26730,26737..26742,26752..26754,
                     26773..26778,26779..26781,26788..26793,26797..26811,
                     26815..26826,26830..26832,26851..26853))
                     /locus_tag="NGR_b00260"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(26203..26205,26269..26271,26275..26277,
                     26341..26343,26437..26439,26554..26556,26638..26640,
                     26644..26646,26752..26760,26764..26766))
                     /locus_tag="NGR_b00260"
                     /note="active site"
                     /db_xref="CDD:119340"
     misc_feature    complement(order(26554..26556,26638..26640,26644..26646))
                     /locus_tag="NGR_b00260"
                     /note="Mg2+/Mn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:119340"
     gene            complement(27085..28278)
                     /locus_tag="NGR_b00270"
                     /db_xref="GeneID:7789567"
     CDS             complement(27085..28278)
                     /locus_tag="NGR_b00270"
                     /note="related to major facilitator superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_002822254.1"
                     /db_xref="GI:227818283"
                     /db_xref="GeneID:7789567"
                     /translation="MFCNHAGMTNIDQSISTLSAERARIPPFAFVLTVCIGVIGSNSL
                     ALGPIAPEVAKALGADVPAVMTASAAFGLGTAASAVFLGRLIDRNGPRRMLAAALLLL
                     AAGLAGSAFAPALPLLVAAQLVVGIAAGIALPAIYTLASVIAPAGRESETIGLVLTGW
                     TLSMVAGVPLSAAIADFAGWRAVYLVVAAATLVACAAVRLATVREGPGGKATSPLAAL
                     GVSGVAPLLIACAAFMAAFYGVYAYIGDHLHAALGLPVSANGLVAVSYGLGFGGAAFL
                     DRLIDRFGADRLLPLIFLAVAGVYVLMSAASGSYPAMLAVVFLWGLANHFGLNVLIMR
                     LTGLDPARRGAIMGLNSGVTYLALFAGTLGFGAAYSGTAFYTLPLAAAALMLAAAASA
                     ALAPR"
     misc_feature    complement(27157..28224)
                     /locus_tag="NGR_b00270"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    complement(27151..28191)
                     /locus_tag="NGR_b00270"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(order(27205..27207,27214..27219,27226..27231,
                     27238..27243,27271..27273,27280..27285,27295..27297,
                     27304..27309,27316..27318,27460..27462,27478..27480,
                     27490..27492,27502..27504,27544..27546,27553..27558,
                     27565..27570,27577..27579,27787..27789,27805..27810,
                     27817..27822,27856..27858,27865..27870,27877..27882,
                     27889..27894,28030..28035,28039..28044,28054..28056,
                     28063..28068,28075..28077,28126..28131,28135..28143,
                     28150..28152))
                     /locus_tag="NGR_b00270"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            28306..28830
                     /locus_tag="NGR_b00280"
                     /db_xref="GeneID:7789568"
     CDS             28306..28830
                     /locus_tag="NGR_b00280"
                     /codon_start=1
                     /transl_table=11
                     /product="AsnC family transcriptional regulator"
                     /protein_id="YP_002822255.1"
                     /db_xref="GI:227818284"
                     /db_xref="GeneID:7789568"
                     /translation="MDQNTDDVRRKRPPERDLDAMDRKLLGVLVEDATTSYAELGERV
                     GLSPPAAHERVKRLRRSGAIRRVAALIDPEAVGKTLLAFVHVDTTGWGKTQALLAIEE
                     YPEVEEIHSVAGDTCMLLKVRTESTHALEGLLARLYDTPGVKATRSYVVLSTYLERPV
                     QPGTTSEWPAVVKS"
     misc_feature    28342..28791
                     /locus_tag="NGR_b00280"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    28357..28677
                     /locus_tag="NGR_b00280"
                     /note="helix_turn_helix ASNC type; Region: HTH_ASNC;
                     smart00344"
                     /db_xref="CDD:214628"
     misc_feature    order(28369..28371,28408..28410,28414..28419,28444..28455,
                     28459..28464,28471..28476,28480..28485,28501..28503)
                     /locus_tag="NGR_b00280"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(28408..28410,28420..28422)
                     /locus_tag="NGR_b00280"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(28832..29245)
                     /locus_tag="NGR_b00290"
                     /db_xref="GeneID:7789569"
     CDS             complement(28832..29245)
                     /locus_tag="NGR_b00290"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein"
                     /protein_id="YP_002822256.1"
                     /db_xref="GI:227818285"
                     /db_xref="GeneID:7789569"
                     /translation="MIFLDTNVISETLRKSPSETVISWLVRHDAEIALPTVTIAEIAY
                     AIQKIMPDQRAVRLEQALSDWRRRFAGRIFGLMEEAAIAYGEIMGAASRQGSTMSAPD
                     GMIAAITQVNRGRLATRNIADFRSTGLDLVSPWEF"
     misc_feature    complement(28850..29236)
                     /locus_tag="NGR_b00290"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(28874..28876,28931..28936,28940..28945,
                     28949..28951,28970..28972,28979..28984,28991..28996,
                     29000..29002,29015..29023,29027..29029,29051..29053,
                     29072..29074,29111..29119,29123..29131,29135..29140,
                     29150..29152,29171..29173,29180..29182,29204..29212,
                     29216..29221,29228..29236))
                     /locus_tag="NGR_b00290"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(28886..28888,28940..28942,29123..29125,
                     29231..29233))
                     /locus_tag="NGR_b00290"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(28937..28939,28943..28948,28979..28984,
                     28988..28996,29000..29005,29018..29020,29045..29047,
                     29066..29071,29114..29119,29123..29128,29135..29140))
                     /locus_tag="NGR_b00290"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(29242..29490)
                     /locus_tag="NGR_b00300"
                     /db_xref="GeneID:7789570"
     CDS             complement(29242..29490)
                     /locus_tag="NGR_b00300"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein"
                     /protein_id="YP_002822257.1"
                     /db_xref="GI:227818286"
                     /db_xref="GeneID:7789570"
                     /translation="MAEPQLSVRSARARDLAHRLARRENRSIADIVERALEAYEIREA
                     GREPASAFYARLSDSSGSDIDLEAVIREGRRPHKGPEL"
     gene            29695..31926
                     /locus_tag="NGR_b00310"
                     /db_xref="GeneID:7789571"
     CDS             29695..31926
                     /locus_tag="NGR_b00310"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate class-3/4/guanylyl cyclase"
                     /protein_id="YP_002822258.1"
                     /db_xref="GI:227818287"
                     /db_xref="GeneID:7789571"
                     /translation="MERRLAAVMIADVAGYGLLSQADEEGTRVRFQADLHELFEKRIA
                     AHGGRLIKTMGDGLLIEFHSVVEAVRCAVEVQRAKSENRGVEQNGLEFRIGINLGDVI
                     VEGDDIQGDGVIIAERLQSRAEPGGIMISGTAFDQVEKHLDVGFDFLGEQRLKHIEKP
                     VRTYRLLPCETPVGSTKTAVRRRRRRFGVLAACAAVFAVAAGLIWWQPWRQTTQTASI
                     ARAELALPDKPSIAVLPFANVSDDPRQEYFADGMTDALVTELAQISGLFVIARNSTFT
                     YKGRAVTAAQVSGELGVRYILEGSVQRAGEQLRINAQLVDAQSGGHAWAGKFDGTLAD
                     VFALQDDVTRGIAEALALRLQPGEQMALGRKETTVPAAFDAFLRGWEHHRRMTPEDIA
                     KAVPYFEEAIALDPAYGRAYAAAAMVYARLYAWRWHYHLGMTRFEARAKASKYLRTAQ
                     RYKTALAHQVAGLLAEADWQHAQALAELKEAIALEPGDSWSYAMMALTLTSVGRPDEA
                     IPHIRTAIRLDPHYPSFFMYVLGLTEFSMRNYEAAAEAAESSTKLNSGDENSFLLLAA
                     AAGHLGQRSAAENAVARFNALSVGRGGTVATISTTPPLDLARHEDRQSLLEGLRLAGV
                     PESLTSGDFTSINKLTAEEVRSLFFGQRLRGRMLDYGEAHEATFSTEGKGTLSGGWAS
                     IGGGRMSGVEIRFEGDEVCFLWLDTARLCGLVLRNPGGLNAKENEFVWYHGDIAFTFS
                     QVK"
     misc_feature    29704..30195
                     /locus_tag="NGR_b00310"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    29710..30192
                     /locus_tag="NGR_b00310"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    order(29722..29724,29728..29745,29848..29850,29854..29862,
                     29869..29871,30013..30021,30031..30036,30043..30048,
                     30157..30159)
                     /locus_tag="NGR_b00310"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    order(29728..29730,29860..29862)
                     /locus_tag="NGR_b00310"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    order(29743..29745,29779..29781,29788..29793,29800..29802,
                     29812..29814,29848..29853,29998..30000,30007..30009,
                     30016..30027,30034..30036,30157..30159)
                     /locus_tag="NGR_b00310"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     misc_feature    30331..30756
                     /locus_tag="NGR_b00310"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5616"
                     /db_xref="CDD:227903"
     misc_feature    31051..31254
                     /locus_tag="NGR_b00310"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    31102..31314
                     /locus_tag="NGR_b00310"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(31114..31116,31126..31128,31135..31137,31180..31182,
                     31216..31218,31228..31230,31237..31239,31285..31287)
                     /locus_tag="NGR_b00310"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(31171..31176,31180..31185,31192..31197,31273..31278,
                     31288..31293,31300..31305)
                     /locus_tag="NGR_b00310"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            32088..33680
                     /locus_tag="NGR_b00320"
                     /db_xref="GeneID:7789572"
     CDS             32088..33680
                     /locus_tag="NGR_b00320"
                     /codon_start=1
                     /transl_table=11
                     /product="gamma-glutamyltranspeptidase"
                     /protein_id="YP_002822259.1"
                     /db_xref="GI:227818288"
                     /db_xref="GeneID:7789572"
                     /translation="MRNFEDPGRSLAVARHGMAATSHPAATLTAIEVLKAGGNAVDAA
                     VAAVAVQSVVEAGSTGVGGDCFAMIALEGSTDIRAYNGSGRAPAGLTGEALRAEGVEA
                     IERSTPHAVTVPGAVDAWCRLLRDFGRMPIAEVLQPAIAMAREGYVLTPRVAADLGLQ
                     RDLLAGDPTARATFLVEGEAPPVGSIQHQPLLADTLDAIAHEGRDAFYGGAVAADMVD
                     YLRGLGGRHSLEDFGSAQGDYVTPISTTYRGRTVYECPPNGQGVVALLILNILARFSL
                     SKDPFAIDDLHVLLEATRLAYAARDAMVADPTGSDKAVEHMLSSTLADRLVSAISVDR
                     IAEPLPSFDTVEHKDTVYLCVVDRDRNAVSFINSIFSAYGSGLMAPRSGVLFHNRGQS
                     FSLVAGHPNEVGPRKRPMHTIIPGMVAEAGRVVMPFGVMGGHYQAMGHAHLLSRLYDC
                     GLDLQTAIDLPRLFPLPATATVEAEAAIRTRLGAELERRGFKIESPRIAIGGAQAIRI
                     DWERGVLIGASDPRKDGMALGY"
     misc_feature    32091..33677
                     /locus_tag="NGR_b00320"
                     /note="Gamma-glutamyltransferase [Amino acid transport and
                     metabolism]; Region: Ggt; COG0405"
                     /db_xref="CDD:223482"
     gene            33913..34467
                     /gene="recX"
                     /locus_tag="NGR_b00330"
                     /db_xref="GeneID:7789573"
     CDS             33913..34467
                     /gene="recX"
                     /locus_tag="NGR_b00330"
                     /note="binds RecA and inhibits RecA-mediated DNA strand
                     exchange and ATP hydrolysis and coprotease activities"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination regulator RecX"
                     /protein_id="YP_002822260.1"
                     /db_xref="GI:227818289"
                     /db_xref="GeneID:7789573"
                     /translation="MDEETQQSDTPTPRMFAWARNSAIYRLERRMHTEKQLFDAISRK
                     ARQEFDKISDAQVKALADSAVKFASDNRALDDTAYAEIKARSGMRGGKSKRAIAQNLS
                     QKGVAKDTVAAAVAEADDLYAALVLARKRAFGPFRKCDSDEKRRSKELSAFARAGFGF
                     EIGKTVFEMSVDDAEEALAAGRHF"
     misc_feature    33934..34434
                     /gene="recX"
                     /locus_tag="NGR_b00330"
                     /note="recombination regulator RecX; Reviewed; Region:
                     recX; PRK00117"
                     /db_xref="CDD:234646"
     gene            complement(34508..34975)
                     /locus_tag="NGR_b00340"
                     /db_xref="GeneID:7789574"
     CDS             complement(34508..34975)
                     /locus_tag="NGR_b00340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822261.1"
                     /db_xref="GI:227818290"
                     /db_xref="GeneID:7789574"
                     /translation="MNNELQGRAAHVAAIRESAEEEMSAIGVDAAFIGTLVDTFYGRV
                     LAHPELGPVFDARLSGRWPEHMEKMKSFWSAIAFRSGAYGGKPVQAHLGVANMTPELF
                     PKWLELFAATLEDIAPNNEAKVWFMATAERIARSLTLSLFYNPALDDPALRRA"
     misc_feature    complement(34556..34903)
                     /locus_tag="NGR_b00340"
                     /note="Truncated hemoglobins (trHbs) are a family of
                     oxygen-binding heme proteins found in cyanobacteria,
                     eubacteria, unicellular eukaryotes, and plants. The
                     truncated hemoglobins have a characteristic two-over-two
                     alpha helical folding pattern that is distinct...; Region:
                     Trunc_globin; cd00454"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(34586..34588,34595..34597,34628..34630,
                     34637..34639,34649..34651,34658..34660,34745..34747,
                     34754..34759,34856..34858,34865..34870,34880..34885,
                     34898..34900))
                     /locus_tag="NGR_b00340"
                     /note="apolar tunnel; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(34565..34567,34577..34579,34661..34663,
                     34670..34672,34694..34696,34703..34708,34712..34714,
                     34718..34720,34727..34729,34757..34762,34769..34771,
                     34781..34783,34814..34819,34853..34855))
                     /locus_tag="NGR_b00340"
                     /note="heme binding site [chemical binding]; other site"
                     /db_xref="CDD:238256"
     misc_feature    complement(order(34625..34633,34643..34645,34652..34654,
                     34835..34840,34847..34849))
                     /locus_tag="NGR_b00340"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238256"
     gene            complement(35350..36858)
                     /locus_tag="NGR_b00350"
                     /db_xref="GeneID:7789575"
     CDS             complement(35350..36858)
                     /locus_tag="NGR_b00350"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822262.1"
                     /db_xref="GI:227818291"
                     /db_xref="GeneID:7789575"
                     /translation="MMDLFSNLALGFATAASPANLLFCLIGVLLGTLIGVLPGIGATA
                     TIAMLLPITFQLEPVSSLIMLAGIYYGAQYGGSTTAILINMPGESSSAVTAIDGYQMA
                     RNGRAGTALAVAALGSFFAGTVSTFLVALFAPPLTEIALEFGAAEYFSLMIVGLVSSV
                     ALAHGSVVKALAMVALGLLLGLVGTDIYTGTPRFTLGIREYADGLNFVALAVGVFGIA
                     EILRNLESEKTREVLMAKVSELLPTKEDFKRMFAPVVRGTVIGSALGVLPGGGAILAA
                     FASYTVEKRLSDRPEEFGRGAIAGVAGPESANNAGAQTSFIPLLTLGIPANPVMALMI
                     GAMIIQGIVPGPNVAVEQPALFWGIIASMWIGNLMLVVLNLPLIGLWVKLLKIPYFVL
                     FPIIMAFCSIGVYSVNSNVFDLYAVAFFGLIGYLLLKLRCEPAPLLLGFVLGPLLEEN
                     LRRAMILSRGDPTTFVTRPISAVLLLIAAIVLVVVFLPSVKAKREEVFVEED"
     misc_feature    complement(35353..36855)
                     /locus_tag="NGR_b00350"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3333"
                     /db_xref="CDD:225870"
     gene            complement(36866..37327)
                     /locus_tag="NGR_b00360"
                     /db_xref="GeneID:7789576"
     CDS             complement(36866..37327)
                     /locus_tag="NGR_b00360"
                     /note="similar to transmembrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822263.1"
                     /db_xref="GI:227818292"
                     /db_xref="GeneID:7789576"
                     /translation="MKAISFDATNALCGSILTAVGLFFAWQSFGLELGTAFRMGPGYF
                     PLLLSVVLTLLGVVILVQSARVNHEPMGPIAIRGMLFILPAPIFFGLTVRGLGFVPAV
                     FFTALIACFASHRMKPLWALAVSLGLAIFSVAVFSYGLNLPFERFGPWVRF"
     misc_feature    complement(36896..37300)
                     /locus_tag="NGR_b00360"
                     /note="Tripartite tricarboxylate transporter TctB family;
                     Region: TctB; pfam07331"
                     /db_xref="CDD:254158"
     misc_feature    37580..37658
                     /note="NGR_b00370; temperature sensor, ROSE, RF00435"
     gene            complement(37684..38661)
                     /locus_tag="NGR_b00380"
                     /db_xref="GeneID:7789577"
     CDS             complement(37684..38661)
                     /locus_tag="NGR_b00380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822264.1"
                     /db_xref="GI:227818293"
                     /db_xref="GeneID:7789577"
                     /translation="MKILNALLGAAAAVSLFAASASAQTYPERSITMVVPFSAGGPTD
                     TVARLVAESMSKDLGQQIIVENVGGAGGTLGAGRVAQADPDGYTILLHHIGMATSATL
                     YRKLAYDTLNAFEYVGLVTEVPMTIVARKDFEPTDLKGLIEYAKANKDTVTVANAGIG
                     AASHLCGMMFMSAIETPLTTVPYKGTGPAMTDLLGGQVDIMCDQTTNTTKQIQGGTIK
                     AYATTSPKRLKIFPDLPTAEEAGLKGFQVGIWHGVYAPKGTPADVTDRLSKSLQKALK
                     DENVAARFAELGTEPSSEADATPAALKAKLESEIARWKPVIEAAGQYAD"
     misc_feature    complement(37690..38592)
                     /locus_tag="NGR_b00380"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3181"
                     /db_xref="CDD:225722"
     gene            complement(38864..39655)
                     /locus_tag="NGR_b00390"
                     /db_xref="GeneID:7789578"
     CDS             complement(38864..39655)
                     /locus_tag="NGR_b00390"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosomal pseudouridine synthase B"
                     /protein_id="YP_002822265.1"
                     /db_xref="GI:227818294"
                     /db_xref="GeneID:7789578"
                     /translation="MKQRRPSPDTKRAGTKADDGAAGKRVTLARALSKLGYCSRTQAE
                     RLIAEGRVSVGGRKTTDLSLWIDIDRDRITVDGTPVAAEARIYLMLNKPRGLVTTRDD
                     PEGRPTVFDCLGKVDARFMSPVGRLDKASEGLLLFTNDTVLAQRLLDPATHLGKTYHV
                     QVRGLFDEAAARAMMDGVSEGGEMLKAIDVRRLRSGDKNSWIEVELQEGRNRQIRRML
                     DALGFECLRLVRVSIGEIRLGDLPKGASRPLSEAEVQYLRRHTGS"
     misc_feature    complement(38870..39586)
                     /locus_tag="NGR_b00390"
                     /note="16S rRNA uridine-516 pseudouridylate synthase and
                     related pseudouridylate synthases [Translation, ribosomal
                     structure and biogenesis]; Region: RsuA; COG1187"
                     /db_xref="CDD:224108"
     misc_feature    complement(39383..39574)
                     /locus_tag="NGR_b00390"
                     /note="S4/Hsp/ tRNA synthetase RNA-binding domain; The
                     domain surface is populated by conserved, charged residues
                     that define a likely RNA-binding site;  Found in stress
                     proteins, ribosomal proteins and tRNA synthetases; This
                     may imply a hitherto unrecognized...; Region: S4; cd00165"
                     /db_xref="CDD:238095"
     misc_feature    complement(order(39455..39457,39461..39484,39503..39505,
                     39509..39514,39521..39526,39530..39535,39539..39541))
                     /locus_tag="NGR_b00390"
                     /note="RNA binding surface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238095"
     misc_feature    complement(38957..39397)
                     /locus_tag="NGR_b00390"
                     /note="Pseudouridine synthases, RsuA subfamily; Region:
                     PseudoU_synth_RsuA_like; cd02870"
                     /db_xref="CDD:211347"
     misc_feature    complement(order(39011..39013,39272..39283))
                     /locus_tag="NGR_b00390"
                     /note="active site"
                     /db_xref="CDD:211347"
     gene            39923..41344
                     /locus_tag="NGR_b00400"
                     /db_xref="GeneID:7789579"
     CDS             39923..41344
                     /locus_tag="NGR_b00400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822266.1"
                     /db_xref="GI:227818295"
                     /db_xref="GeneID:7789579"
                     /translation="MHKSVLGGLVALAASSLLQIDGTPLSSAALAQQAAAPSTPAPPA
                     EQPAAPEPLTDDELEVLVARIALYPDELVALVSAASLFPLQIIEAERFLEARKKNAEL
                     KPKESWDGSVISLLNYPEIVKMMSEDLEWTQAFGEAIANQQKDVLIAIQQLRDEAVAK
                     DIIKTDDKMKVVEEGDNIIIQSASPETIYVPQYPPEMLYEPGYMPAPIDYYDDPYPAY
                     WYPGAAFFAGAVTGAIFGAIVDWDDWGVWGGRWDGDIDVDCNKCFNNIDFDGKLNFND
                     IDWKNVDRSKLSFDRDQFNKFDRTNIKNNIKARGDNNLRNRAAEINRDRPQARPGGAG
                     GGQLKDVRKSTLEGLKAQPRRDASARPGTRPGGGQAAARAKAGDLKPSVNRPQGKKSS
                     VNRPAGKKKMASKAQNRPRKPSGLGNVNSGRREVASSRRGGHSMGGGHRGGGRPQMSR
                     GGGGRPPMGRGGGGRGGGRGGRR"
     misc_feature    40079..40762
                     /locus_tag="NGR_b00400"
                     /note="Protein of unknown function (DUF3300); Region:
                     DUF3300; pfam11737"
                     /db_xref="CDD:256584"
     gene            41366..42331
                     /locus_tag="NGR_b00410"
                     /db_xref="GeneID:7789580"
     CDS             41366..42331
                     /locus_tag="NGR_b00410"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822267.1"
                     /db_xref="GI:227818296"
                     /db_xref="GeneID:7789580"
                     /translation="MSKLFHPLLLGPVLPGLAIGLTLAVASIDLAFAQVKPPENIEDY
                     AAAEDPPVFDDPAKAVEALKSALAANDFDGVAKLLGLDAAKVRTGEDAMETFAQIREG
                     AARNVRVRDLEGRKIIEIGDRLWPLPFPITKGEDGKWAFDTYVGLEEIVNRRVGENEL
                     QAIETARAYVEAQKDYASVDRDADGVLEYAQKLISSPDQTDGLFWPADQGDGESPVGD
                     AINEAALEKAKAGEGYFGYRYRILTSQGDNIAGGRYDYVINDNMIAGFALIVWPVTYA
                     ETGVKTFLVNQQGIVYERDLGASTAAIVPFIDRFDPDDTWTVVND"
     misc_feature    41513..42322
                     /locus_tag="NGR_b00410"
                     /note="Protein of unknown function (DUF2950); Region:
                     DUF2950; pfam11453"
                     /db_xref="CDD:256464"
     gene            42413..43558
                     /locus_tag="NGR_b00420"
                     /db_xref="GeneID:7789581"
     CDS             42413..43558
                     /locus_tag="NGR_b00420"
                     /codon_start=1
                     /transl_table=11
                     /product="cation Ca exchange protein"
                     /protein_id="YP_002822268.1"
                     /db_xref="GI:227818297"
                     /db_xref="GeneID:7789581"
                     /translation="MHNFEERGAAAPPRSAIGAAIAEFRRTPLLALIVFVPVVILLER
                     VSPEAHTLLFLLSVVAIVPLAALLSRATEAVAAKTGDAVGGLLNATLGNLTELVISLA
                     ALQAGQYLLVKASIAGAIVTNTLFMLGGAFLVGGLKHHLQEFNRVNARFQASLLFLAT
                     IAILVPSLISEVDRAPAAAFSQQLSLGLAILLIIVYALGMLFSLRTHRELFASSGHAE
                     EEEKPWPLPVGTVVLIVVTLLVAMVSEIFVGSVQVAAQHLGMTPAFVGFIVVALVGGA
                     AEMTSAFSAARANRLDLSVSIALGSAAQIALFVAPVLVLVSYFVGPAPMSLQFWPGAV
                     AMMLVATMAATLLSNGGRAAWYAGVMALAVYAIFGLTLFLLPPGAPS"
     misc_feature    42455..43540
                     /locus_tag="NGR_b00420"
                     /note="Ca2+/H+ antiporter [Inorganic ion transport and
                     metabolism]; Region: ChaA; COG0387"
                     /db_xref="CDD:223464"
     misc_feature    42587..43021
                     /locus_tag="NGR_b00420"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     misc_feature    43133..43516
                     /locus_tag="NGR_b00420"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     gene            complement(43585..44037)
                     /locus_tag="NGR_b00430"
                     /db_xref="GeneID:7789582"
     CDS             complement(43585..44037)
                     /locus_tag="NGR_b00430"
                     /note="similar to ion transport 2 domain protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822269.1"
                     /db_xref="GI:227818298"
                     /db_xref="GeneID:7789582"
                     /translation="MILRLAIAGGLIAATVTIQAFFMSAGLRAFRQMEKDRPDFLSHY
                     PTLVTVAWVIYLIIPILFDVCLWAAFYYLAQALPSFEDALYFSTVTFTTVGYGDIVLD
                     RDWRQVATFEAINGWIIFGWATALMMAVIQRLYFRTDPQAMDDGDPKG"
     misc_feature    complement(43657..43860)
                     /locus_tag="NGR_b00430"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:254488"
     gene            complement(44157..45395)
                     /locus_tag="NGR_b00440"
                     /db_xref="GeneID:7789583"
     CDS             complement(44157..45395)
                     /locus_tag="NGR_b00440"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="YP_002822270.1"
                     /db_xref="GI:227818299"
                     /db_xref="GeneID:7789583"
                     /translation="MLLFSATHGFSGMPTRASVAESMINKHRVAASDSQAVHRRAELD
                     ALDAILPFGRRDQLAGLLTDDDVATLKHLAAEGMGENTLRALASDLGYLEAWCRLATG
                     TPLPWPAPEALILKFVAHHLWDPVKRAEDPSHGMPAEVEAELRAERLLKTQGPHAPGT
                     VRRRLTSWSILTRWRGLTGAFGAPSLKSALRLAVKASNRPRQRKSRKAVTVDILAQLL
                     GTCAGERVVDVRDRALLLTAFASGGRRRSEVAGLRVEDLVDEEPVRADPADKNSPPLP
                     CLSIRLGRTKTTTRDDSEHVLLIGRPASALKRWLSEAAIKEGPVFRRIDQWGNVDRRP
                     LTPQSVNLILKRRCRQAGLDPALFSAHGLRSGYLTEAANRGIPLPEAMEQSLHKSVTQ
                     AASYYNYAERKQGRAARLIV"
     misc_feature    complement(44163..45158)
                     /locus_tag="NGR_b00440"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain. The DNA breaking-rejoining enzyme
                     superfamily includes type IB topoisomerases and tyrosine
                     recombinases that share the same fold in their catalytic
                     domain containing six conserved active site...; Region:
                     DNA_BRE_C; cl00213"
                     /db_xref="CDD:260266"
     misc_feature    complement(order(44208..44210,44313..44321,44538..44540,
                     44661..44666))
                     /locus_tag="NGR_b00440"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(44208..44210,44235..44237,44304..44306,
                     44313..44315,44538..44540,44664..44666))
                     /locus_tag="NGR_b00440"
                     /note="Int/Topo IB signature motif; other site"
                     /db_xref="CDD:238231"
     misc_feature    complement(order(44208..44210,44235..44237,44304..44306,
                     44313..44315,44664..44666))
                     /locus_tag="NGR_b00440"
                     /note="active site"
                     /db_xref="CDD:238231"
     gene            45400..45678
                     /locus_tag="NGR_b00450"
                     /db_xref="GeneID:7789584"
     CDS             45400..45678
                     /locus_tag="NGR_b00450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822271.1"
                     /db_xref="GI:227818300"
                     /db_xref="GeneID:7789584"
                     /translation="MASTVTEAAVSKNFPAYQDAAEREPVIITENGRPRTVLIAYEDY
                     LRLSRRDRRVETTADLSDADLAAVEKSEMEPGLEHLNAELLTDKHAAD"
     misc_feature    45409..45615
                     /locus_tag="NGR_b00450"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            complement(45905..46324)
                     /locus_tag="NGR_b00460"
                     /db_xref="GeneID:7789585"
     CDS             complement(45905..46324)
                     /locus_tag="NGR_b00460"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleic acid-binding protein"
                     /protein_id="YP_002822272.1"
                     /db_xref="GI:227818301"
                     /db_xref="GeneID:7789585"
                     /translation="MSFVLDASIAASWFLPDEESEAAETLIAALAVAPGLVPALFWFE
                     VRNLFVMAERRGRVNPGSALAMTLSLRGLPLQDGGFGNDVSVVDLALKHGLSGYDASY
                     VALAKSTELPLATVDRRMAAAARGEGLKIVGPLEHEH"
     misc_feature    complement(45932..46315)
                     /locus_tag="NGR_b00460"
                     /note="PIN domain of the Pyrobaculum aerophilum Pae0151
                     and Pae2754 proteins and homologs; Region: PIN_Pae0151;
                     cd09873"
                     /db_xref="CDD:189043"
     misc_feature    complement(order(45974..45976,46028..46030,46193..46195,
                     46307..46309))
                     /locus_tag="NGR_b00460"
                     /note="putative active site [active]"
                     /db_xref="CDD:189043"
     misc_feature    complement(order(45956..45958,45968..45979,46022..46024,
                     46028..46042,46052..46057,46061..46066,46073..46075,
                     46115..46117,46124..46129,46133..46138,46172..46180,
                     46184..46201,46205..46213,46301..46303))
                     /locus_tag="NGR_b00460"
                     /note="homotetrameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:189043"
     misc_feature    complement(45974..45976)
                     /locus_tag="NGR_b00460"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189043"
     gene            complement(46324..46563)
                     /locus_tag="NGR_b00470"
                     /db_xref="GeneID:7789586"
     CDS             complement(46324..46563)
                     /locus_tag="NGR_b00470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822273.1"
                     /db_xref="GI:227818302"
                     /db_xref="GeneID:7789586"
                     /translation="MTVTVKVAEAKAHLSELLARVEAGEEVIIARGNDPIAVLSRIRK
                     ESSIETAIAEIRAMRALAKPVTQEEIRAWRDEGRA"
     misc_feature    complement(46330..46563)
                     /locus_tag="NGR_b00470"
                     /note="Antitoxin of toxin-antitoxin stability system [Cell
                     division and chromosome partitioning]; Region: Phd;
                     COG4118"
                     /db_xref="CDD:226603"
     gene            46960..47280
                     /locus_tag="NGR_b00480"
                     /db_xref="GeneID:7789587"
     CDS             46960..47280
                     /locus_tag="NGR_b00480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822274.1"
                     /db_xref="GI:227818303"
                     /db_xref="GeneID:7789587"
                     /translation="MHGINLDDLSETELIALHDAVVDRLRFLHQQKTTHALLELAIGE
                     RVMFEDNSGQTQAGIVIRRNRKTVTVHGDNGRQWNVSPQLLRKEKQAVAAQGGKLVPF
                     LRKG"
     gene            47326..47586
                     /locus_tag="NGR_b00490"
                     /db_xref="GeneID:7789588"
     CDS             47326..47586
                     /locus_tag="NGR_b00490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822275.1"
                     /db_xref="GI:227818304"
                     /db_xref="GeneID:7789588"
                     /translation="MIRRLRDQDNHRDSGETTYATGLHAAEHDVAGNTAVEAVAPQKI
                     LRLVTKARRSFSEEILNLPFSRGDRVAVNQRTPPTRRRYSIM"
     gene            complement(47571..48434)
                     /locus_tag="NGR_b00500"
                     /db_xref="GeneID:7789589"
     CDS             complement(47571..48434)
                     /locus_tag="NGR_b00500"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822276.1"
                     /db_xref="GI:227818305"
                     /db_xref="GeneID:7789589"
                     /translation="MAGWDETSEEITRIRRRLADLDAERAELELVLEELEQKLASGSR
                     AAERSSFTDAPVTNNSPSIEKIELFRRLFAGRPDVFPVRWENRKAGRSGYSPACSNEW
                     AKGICGKPKVKCGECPHQAFIPPIADIIEKHLRGGDGRFGDFIAGVYPLLQDETCFER
                     KDHLDYLQQRFAPFVKNIAVLRGGMSASDRKLANAALRVSDDEERLIIATGRYIGEGF
                     DDARLDTLFLTMPIAWKGTLAQYVGRLHRLHDGKKDVLVVDYVDDTVPVLARMAAKRR
                     AGYRALGYMIE"
     misc_feature    complement(<47961..48245)
                     /locus_tag="NGR_b00500"
                     /note="AE_Prim_S_like: primase domain similar to that
                     found in the small subunit of archaeal and eukaryotic
                     (A/E) DNA primases. The replication machineries of A/Es
                     are distinct from that of bacteria. Primases are
                     DNA-dependent RNA polymerases which synthesis...; Region:
                     AE_Prim_S_like; cl01287"
                     /db_xref="CDD:260873"
     gene            49066..49578
                     /locus_tag="NGR_b00510"
                     /db_xref="GeneID:7789590"
     CDS             49066..49578
                     /locus_tag="NGR_b00510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822277.1"
                     /db_xref="GI:227818306"
                     /db_xref="GeneID:7789590"
                     /translation="MSRMERDGEVLRLARGLYQLPDAELDANHSLAETAKRVPKAVVC
                     LVSALAFHGLTDQLPRHVWLAIGRKDWAPKPDGTPIRIVRFTESLLHDGVETHLVEGV
                     PVKVFRVAKTIADCFRYRSKIGLSVAIEGLQEALRQRKATPGDIANQAERGGVGTVIR
                     PYLEALTANG"
     misc_feature    49069..49416
                     /locus_tag="NGR_b00510"
                     /note="Domain of unknown function (DUF4095); Region:
                     DUF4095; pfam13338"
                     /db_xref="CDD:257668"
     gene            49571..50284
                     /locus_tag="NGR_b00520"
                     /db_xref="GeneID:7789591"
     CDS             49571..50284
                     /locus_tag="NGR_b00520"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822278.1"
                     /db_xref="GI:227818307"
                     /db_xref="GeneID:7789591"
                     /translation="MAKEIRNVGASVRARPLQLSKASGQSFDLVLTRFALERLLFRLS
                     QSPHAGRFVLKGAMLMMSWFEDPHRGTRDLDLLGFGSPEPDLMLGTFREILAQQVDDG
                     VMFDADTLRVDRIREELEYGGLRLRAVASISGARINLTIDIGFGDALEPGAEMLDYPS
                     MLDFPAPRLRAYARETVIAEKFQAMVMLGRVNSRMKDFYDIWILSRSFDFDDDRLARA
                     ITATFERRETPIPEDLPDA"
     misc_feature    49682..50278
                     /locus_tag="NGR_b00520"
                     /note="Nucleotidyl transferase of unknown function
                     (DUF1814); Region: DUF1814; pfam08843"
                     /db_xref="CDD:255068"
     gene            50293..50439
                     /locus_tag="NGR_b00530"
                     /db_xref="GeneID:7789592"
     CDS             50293..50439
                     /locus_tag="NGR_b00530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822279.1"
                     /db_xref="GI:227818308"
                     /db_xref="GeneID:7789592"
                     /translation="MAKDEQKQRQWRAFVEGVAHDPGDLTNVIAEIAAFLMPHAIAAA
                     KLGK"
     gene            complement(50825..51094)
                     /locus_tag="NGR_b00540"
                     /db_xref="GeneID:7789593"
     CDS             complement(50825..51094)
                     /locus_tag="NGR_b00540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822280.1"
                     /db_xref="GI:227818309"
                     /db_xref="GeneID:7789593"
                     /translation="MIEHPASRWGDLFEQAGRIFDQANSELTLIDGWTFGGGTALMLQ
                     IDHRESFDVDIFLDDPQVLPYLNPKTQATRSTSALSAMSPTDRGH"
     misc_feature    complement(<50912..51004)
                     /locus_tag="NGR_b00540"
                     /note="Nucleotidyl transferase of unknown function
                     (DUF1814); Region: DUF1814; pfam08843"
                     /db_xref="CDD:255068"
     gene            complement(51095..51487)
                     /locus_tag="NGR_b00550"
                     /db_xref="GeneID:7789594"
     CDS             complement(51095..51487)
                     /locus_tag="NGR_b00550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822281.1"
                     /db_xref="GI:227818310"
                     /db_xref="GeneID:7789594"
                     /translation="MPVGGRRSSTDTVELTSPTRDPCFAVIVAVYKDLRSSAVGKMSV
                     VAVKVLSTVNAPYGTALSAEQLASKISDPASAVDFDPSAFSFFSEVDEDLQNSFLDEM
                     HVDPSIAANLAREFSALAGYLLPLARAA"
     gene            complement(51671..51808)
                     /locus_tag="NGR_b00560"
                     /pseudo
                     /db_xref="GeneID:7789595"
     gene            complement(51872..52498)
                     /locus_tag="NGR_b00570"
                     /pseudo
                     /db_xref="GeneID:7789596"
     gene            complement(52495..52815)
                     /locus_tag="NGR_b00580"
                     /db_xref="GeneID:7789597"
     CDS             complement(52495..52815)
                     /locus_tag="NGR_b00580"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822282.1"
                     /db_xref="GI:227818311"
                     /db_xref="GeneID:7789597"
                     /translation="MKILIEVDEAAERLEELIDLAFRQDVCVPGRAAYSSARRLSQSE
                     DLLSNESAETLPHTGPASKLVEGGKLGSIDDVWILAAEGKPGREHDMTSAHDDLYDVD
                     GLPR"
     gene            complement(52824..53201)
                     /locus_tag="NGR_b00590"
                     /db_xref="GeneID:7789598"
     CDS             complement(52824..53201)
                     /locus_tag="NGR_b00590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822283.1"
                     /db_xref="GI:227818312"
                     /db_xref="GeneID:7789598"
                     /translation="MKMLLDSHAVYWWTIGSDRLSLRARSLIEDKANTILVSAVSFYE
                     LDNKMRLKKLDLKPQELRAAVTASGLQTLAITDLHAELAASFDWDHRDPWDRLLAAQT
                     RLEHCTFVSLDSAFDGVLHERVW"
     misc_feature    complement(52851..53192)
                     /locus_tag="NGR_b00590"
                     /note="PIN domain of the VapC-like Sll0205 protein and
                     homologs; Region: PIN_Sll0205; cd09872"
                     /db_xref="CDD:189042"
     misc_feature    complement(order(52863..52865,52917..52919,53070..53072,
                     53184..53186))
                     /locus_tag="NGR_b00590"
                     /note="putative active site [active]"
                     /db_xref="CDD:189042"
     gene            complement(53198..53488)
                     /locus_tag="NGR_b00600"
                     /db_xref="GeneID:7789599"
     CDS             complement(53198..53488)
                     /locus_tag="NGR_b00600"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822284.1"
                     /db_xref="GI:227818313"
                     /db_xref="GeneID:7789599"
                     /translation="MPQITYKISEARKHFAEVLERANHGEEIIIMRGNEVYARIGPAD
                     GGKRPFGLLRQRGLPDDLFDEIDAEQAAIDAGDWNDDVGVWQGKSNDRDPSK"
     misc_feature    complement(<53285..53488)
                     /locus_tag="NGR_b00600"
                     /note="Antitoxin of toxin-antitoxin stability system [Cell
                     division and chromosome partitioning]; Region: Phd;
                     COG4118"
                     /db_xref="CDD:226603"
     gene            54242..54841
                     /locus_tag="NGR_b00610"
                     /db_xref="GeneID:7789600"
     CDS             54242..54841
                     /locus_tag="NGR_b00610"
                     /codon_start=1
                     /transl_table=11
                     /product="osmotically inducible protein Y"
                     /protein_id="YP_002822285.1"
                     /db_xref="GI:227818314"
                     /db_xref="GeneID:7789600"
                     /translation="MRTDIDIKQDVEGELHMNPDIDATDVAVAVKDGVVTLTGYVRSY
                     SQKWEAERTGKLAIGVAGVVNDIEVRLPVFAQRPDPEIVCDAVAAIQAELPYSSEHIR
                     VVVRDGWLTLEGRVDWDYARERAESAVRRVRGVKGVSSLIQVTRVAPSEVKRKIEEAF
                     RRNAELDANRIKVETDGGVVTLRGTVRSWAEREEAQAQN"
     misc_feature    54296..54826
                     /locus_tag="NGR_b00610"
                     /note="Predicted periplasmic or secreted lipoprotein
                     [General function prediction only]; Region: OsmY; COG2823"
                     /db_xref="CDD:225379"
     misc_feature    54296..54451
                     /locus_tag="NGR_b00610"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    54530..54673
                     /locus_tag="NGR_b00610"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    54731..>54826
                     /locus_tag="NGR_b00610"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     gene            55220..55714
                     /locus_tag="NGR_b00620"
                     /db_xref="GeneID:7789601"
     CDS             55220..55714
                     /locus_tag="NGR_b00620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822286.1"
                     /db_xref="GI:227818315"
                     /db_xref="GeneID:7789601"
                     /translation="MTSLPRVTELTRELVSRQFDDLGPEACLAEITECLMRENPELLD
                     MARKCAADVGDAPKIMVGFGMFYQLLISASLDAADKQIMHPLPCVTAKTRDALVREID
                     DDGSEAFTLRAIEDLERTNPELMQMAHGFASRYKDYLHVMQGFALLYRSLDVQATTDR
                     KYLH"
     gene            complement(56382..56657)
                     /locus_tag="NGR_b00630"
                     /db_xref="GeneID:7789602"
     CDS             complement(56382..56657)
                     /locus_tag="NGR_b00630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822287.1"
                     /db_xref="GI:227818316"
                     /db_xref="GeneID:7789602"
                     /translation="MILGAGLAGMTAAPELSAAGYLVVALEYPEQAGGRNWTLAARTP
                     ELGGPEGSGSLKATISILLGGESLITTTACSITVAAECGARTLHQGQ"
     misc_feature    complement(<56556..56654)
                     /locus_tag="NGR_b00630"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(56993..57424)
                     /locus_tag="NGR_b00640"
                     /db_xref="GeneID:7789603"
     CDS             complement(56993..57424)
                     /locus_tag="NGR_b00640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822288.1"
                     /db_xref="GI:227818317"
                     /db_xref="GeneID:7789603"
                     /translation="MQQNSASEKYRNFRLALAIGGSMLLMIAILLSSATRPAFSQNVV
                     VIDVDVKEVAKGYRASELAGADVENNTGEKIGSIDDLIVDREKVLFAILEVGGFLGIG
                     GFLVAIPYNSLELNENGSKIVLAQGSKEELQKLPEFKYEKK"
     misc_feature    complement(57029..57256)
                     /locus_tag="NGR_b00640"
                     /note="PRC-barrel domain; Region: PRC; pfam05239"
                     /db_xref="CDD:253112"
     gene            complement(57563..58105)
                     /locus_tag="NGR_b00650"
                     /db_xref="GeneID:7789604"
     CDS             complement(57563..58105)
                     /locus_tag="NGR_b00650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822289.1"
                     /db_xref="GI:227818318"
                     /db_xref="GeneID:7789604"
                     /translation="MSTLKVPINPRDHRRGGTNATVTLVEYGDYQCPVCAIANPVVRS
                     LENRYGQALSVVFRHFPMIEVHPFAGTAAETAEFAGDHGLFWEMHDAIFSNQHRLSIQ
                     LLFAIASTLQLSQIGLRDSIARSLHADKIQADFIGGVRSGVNGTPTFFVNGLRHEGGF
                     TAPELAASIQTAMDVLAPVR"
     misc_feature    complement(57584..>58060)
                     /locus_tag="NGR_b00650"
                     /note="Protein-disulfide isomerase [Posttranslational
                     modification, protein turnover, chaperones]; Region: DsbG;
                     COG1651"
                     /db_xref="CDD:224565"
     misc_feature    complement(57632..58036)
                     /locus_tag="NGR_b00650"
                     /note="DsbA family; consists of DsbA and DsbA-like
                     proteins, including DsbC, DsbG, glutathione (GSH)
                     S-transferase kappa (GSTK),
                     2-hydroxychromene-2-carboxylate (HCCA) isomerase, an
                     oxidoreductase (FrnE) presumed to be involved in
                     frenolicin biosynthesis, a...; Region: DsbA_family;
                     cd02972"
                     /db_xref="CDD:239270"
     misc_feature    complement(order(58001..58003,58010..58012))
                     /locus_tag="NGR_b00650"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239270"
     gene            complement(58071..58583)
                     /locus_tag="NGR_b00660"
                     /db_xref="GeneID:7789605"
     CDS             complement(58071..58583)
                     /locus_tag="NGR_b00660"
                     /note="Thioredoxin-dependent peroxide reductase; TPx-Eg"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin peroxidase"
                     /protein_id="YP_002822290.1"
                     /db_xref="GI:227818319"
                     /db_xref="GeneID:7789605"
                     /translation="MSAILASGTKAPSFTLRVTPDQTLSLSEFAGRRVILAFYPADWS
                     PVCGDQMTLYNHVLSEFRKKGAELVGISVDGAWCHQAFARDRNLHFPLLADFHPKGEV
                     SRAYGAYRDDVGESARALFIIDENGTIAWSHLSPVAVNPGADGILDALDQMPNLEQKN
                     VDAQSSHQSA"
     misc_feature    complement(58125..58562)
                     /locus_tag="NGR_b00660"
                     /note="Peroxiredoxin [Posttranslational modification,
                     protein turnover, chaperones]; Region: AhpC; COG0450"
                     /db_xref="CDD:223527"
     misc_feature    complement(58131..58562)
                     /locus_tag="NGR_b00660"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:260398"
     gene            complement(58605..59216)
                     /locus_tag="NGR_b00670"
                     /db_xref="GeneID:7789606"
     CDS             complement(58605..59216)
                     /locus_tag="NGR_b00670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822291.1"
                     /db_xref="GI:227818320"
                     /db_xref="GeneID:7789606"
                     /translation="MTSIQSTDSPKTEAMNDMLANNWWAVALRGVVAILFGIAAFAMP
                     LLMMVSLVVVFAAFSFVDGVFGIIMSVRGARKGERWIWLLLSGILSIVASAVAILWPG
                     ITVLAFVILVAAWALVSGTFMLISAFRLKIDHGRVWLVIGGIASVVFGILLVISPFIG
                     ALVLTFWTGAHAVVLGATLLVLAYKLRSHKTGMPSDLATSGTA"
     misc_feature    complement(58656..59177)
                     /locus_tag="NGR_b00670"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: HdeD; COG3247"
                     /db_xref="CDD:225786"
     gene            complement(59250..59900)
                     /locus_tag="NGR_b00680"
                     /db_xref="GeneID:7789607"
     CDS             complement(59250..59900)
                     /locus_tag="NGR_b00680"
                     /codon_start=1
                     /transl_table=11
                     /product="osmotically inducible protein Y
                     domain-containing protein"
                     /protein_id="YP_002822292.1"
                     /db_xref="GI:227818321"
                     /db_xref="GeneID:7789607"
                     /translation="MKSDEDIRTDVESELQWDPALDANDIVPTVKDGAVTLTGFVKSF
                     NEKWEAEDVAKRVAGVLGVANDLDVRLPSIGQRPDPDIARDAVTTLLYELPDLVDIRV
                     VVKDGLVRLEGEVETHRQSRHVTRAVRRVRGIKGVINTIKVRSPVSPEDIHQTIAEAL
                     KRNALLEAANIVVEANGDEVVLKGTVRSWAERKEADEAAWRAPGVLKVDNRITIAS"
     misc_feature    complement(59256..59849)
                     /locus_tag="NGR_b00680"
                     /note="Predicted periplasmic or secreted lipoprotein
                     [General function prediction only]; Region: OsmY; COG2823"
                     /db_xref="CDD:225379"
     misc_feature    complement(59691..59846)
                     /locus_tag="NGR_b00680"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    complement(59466..59606)
                     /locus_tag="NGR_b00680"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    complement(59253..59405)
                     /locus_tag="NGR_b00680"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     gene            60073..60918
                     /locus_tag="NGR_b00690"
                     /db_xref="GeneID:7789608"
     CDS             60073..60918
                     /locus_tag="NGR_b00690"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_002822293.1"
                     /db_xref="GI:227818322"
                     /db_xref="GeneID:7789608"
                     /translation="MPSTIRTTRLPAGDQVPVLGQGTWGMGEKPIRRTDEVAALRLGL
                     DLGMTLIDTAEMYGDGGAEEVVGEAVCGRRDEVFIVSKVLPIHASRLGVTTACNQSLR
                     RLRTDRIDLYLLHWRLGTPLAETIAGFEALKAAGKIRHWGVSNFDTADMVEVAGVAEG
                     KNVQTDQLLYNLRRRGIEYDLLPWCRERGIPVMAYSPVEQGVLADDGRLARVADRYGV
                     SRSQIALAWVLRQDGVIAIPKASKQDHVRENRAAHDIRLIPADLQELDRSFPPPTAKR
                     PLEMI"
     misc_feature    60106..60873
                     /locus_tag="NGR_b00690"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    60109..60873
                     /locus_tag="NGR_b00690"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(60136..60144,60226..60228,60241..60243,60316..60318,
                     60415..60420,60502..60507,60571..60573,60655..60672,
                     60733..60735,60781..60792,60805..60807,60814..60819)
                     /locus_tag="NGR_b00690"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(60226..60228,60241..60243,60316..60318,60415..60417)
                     /locus_tag="NGR_b00690"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            complement(61285..62970)
                     /locus_tag="NGR_b00700"
                     /db_xref="GeneID:7789609"
     CDS             complement(61285..62970)
                     /locus_tag="NGR_b00700"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione-regulated potassium-efflux system
                     protein"
                     /protein_id="YP_002822294.1"
                     /db_xref="GI:227818323"
                     /db_xref="GeneID:7789609"
                     /translation="MNDFLLARTLILVAASGLTVGILTALRMPAVMGYLVVGVALGPH
                     GFDLIESAEDTRFLAELGLIFLMFMVGLEFSIPTILGARWDVLVAGSLQVSMTVALVA
                     TGLVLTGAQAQPAIIMGGAIAMSSTAVTLKQLAEQGEITNRHGRLALGILLFQDVATL
                     PLLILADAWSSAGAAAPIAILKQMAMAAAALAAAAIIARPLIHFGFSWVLGTRSPDLF
                     LLWVLITALGTAYAVHLAGLAPPIGAFVAGMVIGESEFRHRVEEDIRPFRDVLVGLFF
                     ISVGMSIDLSAIARFPGAIILWVLVFVPVKALLVFMTGLLAGAHREASARTAIILAHG
                     GEFGLLLITLALQSGLVSPDLGQPALIALALTMGLAPLVIQRNHWAEWPFGHRDRRIA
                     ATEVSIRALSGGLHDHVILCGCGRVGRLVATVLESADIAYIAIELDLTRFRAARRQGH
                     EVVFGDARHHRILEAAGLDRAQLVILTFDRHGAVERILHQIKTLDPAPASLVSTADDL
                     NMARFSQLDATAVFPENLAAGLSLADRALLFCGKTQDEAACIVSTVRAELIKR"
     misc_feature    complement(61852..62970)
                     /locus_tag="NGR_b00700"
                     /note="Kef-type K+ transport systems, membrane components
                     [Inorganic ion transport and metabolism]; Region: KefB;
                     COG0475"
                     /db_xref="CDD:223551"
     misc_feature    complement(61405..61746)
                     /locus_tag="NGR_b00700"
                     /note="TrkA-N domain; Region: TrkA_N; pfam02254"
                     /db_xref="CDD:251184"
     gene            complement(63331..63984)
                     /locus_tag="NGR_b00710"
                     /db_xref="GeneID:7789610"
     CDS             complement(63331..63984)
                     /locus_tag="NGR_b00710"
                     /codon_start=1
                     /transl_table=11
                     /product="osmotically inducible protein Y"
                     /protein_id="YP_002822295.1"
                     /db_xref="GI:227818324"
                     /db_xref="GeneID:7789610"
                     /translation="MRIDSDIKRDVESELKWDPDIDASDIGVAVKNGVVTLSGFVRSY
                     SQKYEAEKATKRVKGVLGVANDIEVRLPSLHEKPDPEIARAAVEAIKSELPYSHENIK
                     VVVKNGWVTLEGNAEWEYQRYRAEAAVRKVRSVKGISNLVMLKPRVAPSEIKSKIEEA
                     LKRMAEVDAGRVTVTASGGEVTLTGTVRSWAERQEAERAAWRAPGVTKVENRITISP"
     misc_feature    complement(63334..63933)
                     /locus_tag="NGR_b00710"
                     /note="Predicted periplasmic or secreted lipoprotein
                     [General function prediction only]; Region: OsmY; COG2823"
                     /db_xref="CDD:225379"
     misc_feature    complement(63775..63930)
                     /locus_tag="NGR_b00710"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    complement(63547..63690)
                     /locus_tag="NGR_b00710"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    complement(63334..63492)
                     /locus_tag="NGR_b00710"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     gene            complement(64177..64680)
                     /locus_tag="NGR_b00720"
                     /db_xref="GeneID:7789611"
     CDS             complement(64177..64680)
                     /locus_tag="NGR_b00720"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein"
                     /protein_id="YP_002822296.1"
                     /db_xref="GI:227818325"
                     /db_xref="GeneID:7789611"
                     /translation="MKIKDLVPWRGSGRDIASRTAPIDPMRALQLDVDRAFDHFWRAV
                     PYPFAALGRLEETDTVRVDVVDNDKEVTVTAELPGMSDADVDVSISDGRLTIRGEKKS
                     DREAEENGVLVRERIYGAVERTVPLPDGVDPDAAKATFRNGVLTIAIPKSEKFQANTK
                     HVPVQVG"
     misc_feature    complement(64186..64617)
                     /locus_tag="NGR_b00720"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(64228..64494)
                     /locus_tag="NGR_b00720"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    complement(order(64249..64254,64312..64314,64444..64449,
                     64453..64455,64459..64461,64480..64494))
                     /locus_tag="NGR_b00720"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            complement(64694..65074)
                     /locus_tag="NGR_b00730"
                     /db_xref="GeneID:7789612"
     CDS             complement(64694..65074)
                     /locus_tag="NGR_b00730"
                     /codon_start=1
                     /transl_table=11
                     /product="small class I heat shock protein"
                     /protein_id="YP_002822297.1"
                     /db_xref="GI:227818326"
                     /db_xref="GeneID:7789612"
                     /translation="MTDHETNGTAQAEATRTAPVYTPPTDIIETTSAVQMVLDMPGAN
                     PDSLDVTLDNRVLRISAQSASSAPEGYSLLHAEYRDGTYERSFMVSEPIEMDKIEAVF
                     KDGVLRLTLPKAAPSLAKISVKAA"
     misc_feature    complement(64700..>65038)
                     /locus_tag="NGR_b00730"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(64736..64999)
                     /locus_tag="NGR_b00730"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    complement(order(64757..64762,64820..64822,64949..64954,
                     64958..64960,64964..64966,64985..64999))
                     /locus_tag="NGR_b00730"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            complement(65088..65528)
                     /locus_tag="NGR_b00740"
                     /db_xref="GeneID:7789613"
     CDS             complement(65088..65528)
                     /locus_tag="NGR_b00740"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein, Hsp20 family"
                     /protein_id="YP_002822298.1"
                     /db_xref="GI:227818327"
                     /db_xref="GeneID:7789613"
                     /translation="MLHHLENTGRWLDPLRQMRFAQRDMSRLLDNLRLAAPPEFPLMN
                     IWAGTDGAVVTAEIPGVAPEELDIAVHQNMVTLRGSRPAEPLAEDAVIHRQERATGAF
                     ARNLILPFRVDGDHATAKFRNGLLRLDLPRPKADRPHKINVSRS"
     misc_feature    complement(65097..65516)
                     /locus_tag="NGR_b00740"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(65133..65381)
                     /locus_tag="NGR_b00740"
                     /note="Alpha-crystallin domain (ACD) of
                     alpha-crystallin-type small(s) heat shock proteins (Hsps).
                     sHsps are small stress induced proteins with monomeric
                     masses between 12 -43 kDa, whose common feature is the
                     Alpha-crystallin domain  (ACD). sHsps are generally...;
                     Region: ACD_sHsps-like; cd06464"
                     /db_xref="CDD:107221"
     misc_feature    complement(order(65154..65159,65217..65219,65349..65354,
                     65358..65360,65364..65366))
                     /locus_tag="NGR_b00740"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107221"
     gene            65717..66631
                     /locus_tag="NGR_b00750"
                     /db_xref="GeneID:7789614"
     CDS             65717..66631
                     /locus_tag="NGR_b00750"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ/CbpA-type protein"
                     /protein_id="YP_002822299.1"
                     /db_xref="GI:227818328"
                     /db_xref="GeneID:7789614"
                     /translation="MPMNNGDPYEILGIKRDASQKDIQAAYRRRAKKLHPDLNPGNKQ
                     AEQDFKDLSAAYEILRDEEKRSRFDRGEIDATGAQKPERRYYRDFADAGAGSAYENGA
                     GFADFGADDIFAEFFSHRGRKGSRMRGTDVRYSMEIDFLEAVNGGTRQVTLSDGETLE
                     IRIPPGARDGQTLRLRGKGGAGEGGAETGDALIELHVRPHPFYRREGDDIHLNLPISL
                     AEAVLGGKVTVPTPAGPVMASVPENSSSGRRLRVKGKGVARRNGTRGDVYATLKIVLP
                     ERPDPELKAFMTNWSAGKRYNPRQGMGV"
     misc_feature    65723..66568
                     /locus_tag="NGR_b00750"
                     /note="DnaJ-class molecular chaperone with C-terminal Zn
                     finger domain [Posttranslational modification, protein
                     turnover, chaperones]; Region: DnaJ; COG0484"
                     /db_xref="CDD:223560"
     misc_feature    65735..65899
                     /locus_tag="NGR_b00750"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    order(65819..65827,65852..65854,65861..65866,65873..65878)
                     /locus_tag="NGR_b00750"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    66107..66550
                     /locus_tag="NGR_b00750"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    order(66116..66118,66161..66178,66182..66184,66254..66256)
                     /locus_tag="NGR_b00750"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    order(66368..66373,66380..66385,66443..66454,66539..66550)
                     /locus_tag="NGR_b00750"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            66635..66985
                     /locus_tag="NGR_b00760"
                     /db_xref="GeneID:7789615"
     CDS             66635..66985
                     /locus_tag="NGR_b00760"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822300.1"
                     /db_xref="GI:227818329"
                     /db_xref="GeneID:7789615"
                     /translation="MDYQEFARDLRIDMERLQVFIDRGWISPAMPEGRPMFRDVDLAR
                     AALIADLANEMGVNDEGVDLVLDLLDQLYSLRFAFSNLIDALEVQPRDVRRHVVNDAQ
                     KLNRLTRRGLRSLR"
     gene            complement(67054..67650)
                     /locus_tag="NGR_b00770"
                     /db_xref="GeneID:7789616"
     CDS             complement(67054..67650)
                     /locus_tag="NGR_b00770"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein GrpE-like protein"
                     /protein_id="YP_002822301.1"
                     /db_xref="GI:227818330"
                     /db_xref="GeneID:7789616"
                     /translation="MADERHRQKPGPKAAESGPDAEMPAAETVADQASLTALQAELAE
                     TKDRLLRAVAEQQNIRLQMQRQCEDAVKFAASQLMGDLLDTLDNLRRAIESVPSEASG
                     HDVVNPLLKGVEATESNLLATLARHGVQRIDPLGQAFDPHHHHAIFQRPDATAAEGTV
                     VEVLQPGYMLHGRVLRPAMVGVAVRGSQHGGPPRDDLA"
     misc_feature    complement(67105..67527)
                     /locus_tag="NGR_b00770"
                     /note="GrpE is the adenine nucleotide exchange factor of
                     DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the
                     ATPase domain of Hsp70 catalyzing the dissociation of ADP,
                     which enables rebinding of ATP, one step in the Hsp70
                     reaction cycle in protein folding; Region: GrpE; cd00446"
                     /db_xref="CDD:238252"
     misc_feature    complement(order(67270..67272,67303..67305,67312..67314,
                     67375..67377,67387..67389,67408..67410,67417..67419,
                     67429..67431,67471..67476,67483..67485,67495..67497,
                     67504..67509,67516..67521))
                     /locus_tag="NGR_b00770"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238252"
     misc_feature    complement(order(67120..67122,67132..67134,67159..67161,
                     67207..67221,67228..67230,67468..67470))
                     /locus_tag="NGR_b00770"
                     /note="hsp70 (ATPase domain) interactions [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238252"
     gene            complement(67643..69559)
                     /gene="dnaK1"
                     /locus_tag="NGR_b00780"
                     /db_xref="GeneID:7789617"
     CDS             complement(67643..69559)
                     /gene="dnaK1"
                     /locus_tag="NGR_b00780"
                     /note="Heat shock protein 70"
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein DnaK"
                     /protein_id="YP_002822302.1"
                     /db_xref="GI:227818331"
                     /db_xref="GeneID:7789617"
                     /translation="MASKVIGIDLGTTNSCVAVIEGTQAKIIENAEGGRTTPSVVAFT
                     KDGEILVGQPAKRQAVTNPENTIFAIKRLIGRRYDDPIVEKDKKLVPYKIVKGNNGDA
                     WIEVAGKKYSPSQISSHILVKMKETAEAYLGGKVSQAVITVPAYFNDSQRQATKDAGK
                     IAGLDVLRIINEPTAAALAYGLDKKTAAKIAVYDLGGGTFDISLLDIGDGVFEVKATN
                     GDTFLGGEDFDKRIVDWLADEFQKDQRIDLRNDRLALQRLREAAEKAKIELSSALETT
                     VSLPFITADQNGPKHLEIKLRRAKLEDLVDDLIRRTEKPCKAAMKDARVKPGDIDETV
                     LVGGMTRMPKVQEVVVEIFGKEPNKSVNPDEVVAIGAAIQAGVLRGDVKDVLLLDVTP
                     LSLGIETLGGVFTRLIERNTTIPAKKSQIFSTAEDNQNAVTIRVFQGEREMAADNKLL
                     GQFDLVGIPPAPRGVPQIEVTFDIDANGIVNVTAKDKATGKEQQIKIQTSGGLSQSDI
                     DRMVKEAEANAEADKRRRALVEARNQADAQIAASQKALDEAKDKAPSADRAPVEKAID
                     ELKSAMTGDSVDEIEAKTKALQIASVNFGAKVHEASGASTSGAGDSSGTSSGDDVVDA
                     DFEEVDDKDGQRHG"
     misc_feature    complement(67661..69553)
                     /gene="dnaK1"
                     /locus_tag="NGR_b00780"
                     /note="molecular chaperone DnaK; Provisional; Region:
                     dnaK; PRK00290"
                     /db_xref="CDD:234715"
     misc_feature    complement(68426..69553)
                     /gene="dnaK1"
                     /locus_tag="NGR_b00780"
                     /note="Nucleotide-Binding Domain of the sugar
                     kinase/HSP70/actin superfamily; Region:
                     NBD_sugar-kinase_HSP70_actin; cl17037"
                     /db_xref="CDD:266502"
     misc_feature    complement(order(68549..68551,68969..68980,69044..69046,
                     69512..69514,69518..69520,69524..69535))
                     /gene="dnaK1"
                     /locus_tag="NGR_b00780"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:212657"
     gene            complement(69701..70330)
                     /locus_tag="NGR_b00790"
                     /db_xref="GeneID:7789618"
     CDS             complement(69701..70330)
                     /locus_tag="NGR_b00790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822303.1"
                     /db_xref="GI:227818332"
                     /db_xref="GeneID:7789618"
                     /translation="MAEGDDVLERLVVREVAAVFHGKEILEDAIQALLHAGFDRGDID
                     IMGDIETVRQRLGTLYVPSEEIADVPGTPRGAYIARDDIATATAGVAGMLFYLGAATA
                     AMTVVASGGSLALVAAAAVAAGAVGAGIGASAIRLLGKKQAEELELQLMSGGIVVWVR
                     TRDPDKEAQAQEILARFGGEAIRVHEIEIDKRLDDLPLSKVKPDPWLGG"
     gene            complement(70421..71077)
                     /locus_tag="NGR_b00800"
                     /db_xref="GeneID:7789619"
     CDS             complement(70421..71077)
                     /locus_tag="NGR_b00800"
                     /codon_start=1
                     /transl_table=11
                     /product="FixK family transcriptional regulator"
                     /protein_id="YP_002822304.1"
                     /db_xref="GI:227818333"
                     /db_xref="GeneID:7789619"
                     /translation="MVDAPAVPFPSQRLSRAPAEPPRLRSIAHLRRFRRDQDIYGQEE
                     RNDTWYRVISGSARKYLTRADGRRQLVDIYLPGDLFGFTSRVHHRFAVQAVADQTLIA
                     CYPRWRVEALAEEDSATAREIIVQSFEALERLQEQMLVIGTVTAQEKVRHFLVYFHDR
                     VSAGKDDSLALPISRYDIADMLGISAETVCRAFTDLRESGVISLQGPRHIKIMRRPSR
                     "
     misc_feature    complement(70706..71026)
                     /locus_tag="NGR_b00800"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(70433..71011)
                     /locus_tag="NGR_b00800"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    complement(order(70808..70816,70835..70837))
                     /locus_tag="NGR_b00800"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(70721..70729,70739..70747))
                     /locus_tag="NGR_b00800"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(70436..70642)
                     /locus_tag="NGR_b00800"
                     /note="helix_turn_helix, cAMP Regulatory protein
                     C-terminus; DNA binding domain of prokaryotic regulatory
                     proteins belonging to the catabolite activator protein
                     family; Region: HTH_CRP; cd00092"
                     /db_xref="CDD:238044"
     misc_feature    complement(70628..70633)
                     /locus_tag="NGR_b00800"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(70523..70525,70550..70558,70562..70564))
                     /locus_tag="NGR_b00800"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(70505..70525)
                     /locus_tag="NGR_b00800"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(70505..70507,70517..70522))
                     /locus_tag="NGR_b00800"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(70517..70522)
                     /locus_tag="NGR_b00800"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            complement(72524..72856)
                     /locus_tag="NGR_b00810"
                     /db_xref="GeneID:7789620"
     CDS             complement(72524..72856)
                     /locus_tag="NGR_b00810"
                     /note="cytochrome c554"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c-554"
                     /protein_id="YP_002822305.1"
                     /db_xref="GI:227818334"
                     /db_xref="GeneID:7789620"
                     /translation="MLRIVVCTLTVMLALETTPPAIAGDPAAGKKIVGQCATCHGQDG
                     VGRMPDVPNLAGESTIYLTKELNAYRSGERDHPQMSIIAKGLSDEQIADLAAWYAALK
                     VTVEMPDL"
     misc_feature    complement(72545..72856)
                     /locus_tag="NGR_b00810"
                     /note="Cytochrome c553 [Energy production and conversion];
                     Region: COG2863"
                     /db_xref="CDD:225418"
     misc_feature    complement(72566..>72832)
                     /locus_tag="NGR_b00810"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     gene            complement(72868..74133)
                     /locus_tag="NGR_b00820"
                     /db_xref="GeneID:7789621"
     CDS             complement(72868..74133)
                     /locus_tag="NGR_b00820"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose/sorbosone dehydrogenase"
                     /protein_id="YP_002822306.1"
                     /db_xref="GI:227818335"
                     /db_xref="GeneID:7789621"
                     /translation="MTRRFLSSVAIMALGAGPAFGQSDSIGTLRQFGKTGTSSEAFQP
                     VDQHGDYAGQLKMNLEQITLPPGFAIDLFAVVPDARHIAIGPQGVAVFVGTRKEEVWV
                     ATDRDKDRQADEVKRFAPSIRFNVPNGPCFSRNGVLYIAEQNRVLAFPAAEFFYESPD
                     VAVEIVVPQRELIPPEEESFNHTARVCDIGPDDKLYIALGQPYNVPPPEKLETYDRVG
                     MAGIIRLDRNGANREVYARGIRNSVGMDFRPETTELWFTDNQVDGMGDDTPPGELNRS
                     TQPGQHFGFPWYGGGLVRTREYQDTEPPADAVPPVLEFEAHAADLGMMFYTGAQFPQK
                     YRGGIFSAQHGSWNRTVPVGARVMFTPVEADGNAGEPEVFAAGWLMPSGEYMGRPVDV
                     AQLSDGSILVSDDLAGAVYRISYQPPPAE"
     misc_feature    complement(72889..73935)
                     /locus_tag="NGR_b00820"
                     /note="dehydrogenase, PQQ-dependent, s-GDH family; Region:
                     non_repeat_PQQ; cl19645"
                     /db_xref="CDD:267998"
     gene            complement(74251..74730)
                     /locus_tag="NGR_b00830"
                     /db_xref="GeneID:7789622"
     CDS             complement(74251..74730)
                     /locus_tag="NGR_b00830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822307.1"
                     /db_xref="GI:227818336"
                     /db_xref="GeneID:7789622"
                     /translation="MLIRNGLRTTRAELLPLSFYERFEYVVVVILTALIAVVVVAAVW
                     NLTLKILVGLVLSGSLDPSDYTAFQDVFGMIFTVIIALEFKKSLLVVAARRDTVVAIR
                     SVVVIALLAICRKVIILDLTETDALHILALAAAILALGIVYWLVSDRDRRPVKDSQG"
     misc_feature    complement(<74356..74517)
                     /locus_tag="NGR_b00830"
                     /note="Phosphate-starvation-inducible E; Region: PsiE;
                     cl01264"
                     /db_xref="CDD:242403"
     gene            complement(74875..75972)
                     /locus_tag="NGR_b00840"
                     /db_xref="GeneID:7789623"
     CDS             complement(74875..75972)
                     /locus_tag="NGR_b00840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822308.1"
                     /db_xref="GI:227818337"
                     /db_xref="GeneID:7789623"
                     /translation="MPQTERTEIRRLLRALVRLSALPLLWKEMGDEAIAGNLASVLVK
                     ILDADFAYLFVDADPHTVELAFGPEGRIPAALIPAIRASLHGSSVRRLSRIQSALSGD
                     LVTVFSTTLGFKAEAILFVASKRSDYPTGFERLVLRMAANEATAAMEQAEGPVVATHL
                     TTLVSLSSNFIGVANLQGVPLFVNPAGLRLVGMASIQEAQELHVVDFLEFRDRDRARY
                     EVWPRVLSEGRWAGQLSFLNAKTGMTTPLLVESFRIDARTTEPVAVGTISVDIRKWNR
                     AERISNDSPALATTREIMLAVARVESLSERERQVLHALVAGCSHKVIAHELGISVRTI
                     EVHRARMMRRLGVRTLAEAIKLAIISGAVKP"
     misc_feature    complement(75313..75498)
                     /locus_tag="NGR_b00840"
                     /note="PAS domain; Region: PAS; smart00091"
                     /db_xref="CDD:214512"
     misc_feature    complement(75160..75456)
                     /locus_tag="NGR_b00840"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(74887..>75237)
                     /locus_tag="NGR_b00840"
                     /note="response regulator FixJ; Provisional; Region: fixJ;
                     PRK09390"
                     /db_xref="CDD:181815"
     misc_feature    complement(74896..75066)
                     /locus_tag="NGR_b00840"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(74923..74925,74956..74970,74974..74979,
                     74983..74988,75010..75018,75055..75063))
                     /locus_tag="NGR_b00840"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(74896..74901,74908..74910,74917..74925,
                     75016..75018,75022..75024,75028..75030))
                     /locus_tag="NGR_b00840"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            76128..76433
                     /locus_tag="NGR_b00850"
                     /db_xref="GeneID:7789624"
     CDS             76128..76433
                     /locus_tag="NGR_b00850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822309.1"
                     /db_xref="GI:227818338"
                     /db_xref="GeneID:7789624"
                     /translation="MVPIDRRRYTVLDDPNSAIENEVIVTVFDWHGKAPVRATVGWNA
                     HSRKGRDVGSDEGAERDVEAALAQAHRLVERYGFQCIVIVLEHEDLWDPKWGTLIRR"
     gene            77059..77892
                     /locus_tag="NGR_b00860"
                     /db_xref="GeneID:7789625"
     CDS             77059..77892
                     /locus_tag="NGR_b00860"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA-like protein"
                     /protein_id="YP_002822310.1"
                     /db_xref="GI:227818339"
                     /db_xref="GeneID:7789625"
                     /translation="MIKVVLVRLDGTSGDEFRLAASESLAKLFDSHLVGLILNTLPEP
                     ALAESGVSVEFWTRLLQQARERGKELESDLRSRLRAISPSAELRRFDVYAHEQARVAS
                     RESRAADVFLALRLSDADKTVELHDVVEEILFESGRHLFLVADQKAFGQGFEHAIIAW
                     NRSREAARAVAEALPYLAKSRAVTVVVIDQGAMSDLPAKEGDELVDYLRHHGISASIH
                     VARGRGLDTSSALLEVIAEQKADLIVMGGYGHSRLREWLLGGVTFNLLRKSPVSLVIA
                     H"
     misc_feature    77587..77886
                     /locus_tag="NGR_b00860"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(77791..77796,77800..77805,77833..77844)
                     /locus_tag="NGR_b00860"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            77944..78252
                     /locus_tag="NGR_b00870"
                     /note="partial transposase/integrase"
                     /pseudo
                     /db_xref="GeneID:7789626"
     gene            78243..78512
                     /locus_tag="NGR_b00880"
                     /db_xref="GeneID:7789627"
     CDS             78243..78512
                     /locus_tag="NGR_b00880"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 1 for insertion sequence
                     NGRIS-4d"
                     /protein_id="YP_002822311.1"
                     /db_xref="GI:227818340"
                     /db_xref="GeneID:7789627"
                     /translation="MRIEFEVTHPFHPWRGQRFVLSTRKQNWGEDRVMFYDADGRLRS
                     LLASWTDVAAPDVFIQIAAGRSFVRPDDLATLAALIEQIERSHGG"
     gene            78703..79152
                     /locus_tag="NGR_b00890"
                     /db_xref="GeneID:7789628"
     CDS             78703..79152
                     /locus_tag="NGR_b00890"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 2 for insertion sequence
                     NGRIS-4d"
                     /protein_id="YP_002822312.1"
                     /db_xref="GI:227818341"
                     /db_xref="GeneID:7789628"
                     /translation="MPNETKRERLRELGALNARPEAVRAPWFRESTFFDPLDLVQVKY
                     EMLRHVQEDGVNKADAAALFGLSRPTYYQAEAAFERDGIAGLLPRTRGPKSAHKLTDE
                     VMQLIEQNQHAGAPLQARSLAELLHSTLGISVHPRSIERAIARKKKR"
     misc_feature    78829..78984
                     /locus_tag="NGR_b00890"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    78835..79137
                     /locus_tag="NGR_b00890"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    78910..79131
                     /locus_tag="NGR_b00890"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     gene            79428..81512
                     /locus_tag="NGR_b00900"
                     /db_xref="GeneID:7789629"
     CDS             79428..81512
                     /locus_tag="NGR_b00900"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 4 for insertion sequence
                     NGRIS-4d"
                     /protein_id="YP_002822313.1"
                     /db_xref="GI:227818342"
                     /db_xref="GeneID:7789629"
                     /translation="MSTDIAIKVDADHLRRDAFLYVRQSSLRQVFENTESTKRQYALR
                     DRAVALGWPIERVHVIDSDLGLSGAQSQDRDGFQHLVSEVAMGHAGIVLGLEVSRLAR
                     NNADWHRLLELAALSRTLIMDEDGVYDPAYFNDRMLLGLKGTMSEAELHILKSRLQGG
                     ILNKARRGELEMPLPIGLVYTPDARVVLDPDRQIQDTVRLLFDTFRQTGSACAVVRRL
                     RGEKILFPRRIRRGIGKGDVLWNEIDHSRVLQILHNPRYAGAFAYGRTRTAYNAKLKP
                     VQLRVARSDWQVLIPDAHDGYISWAEYERNQAALEQNATGFSPGLRGRMPRQGSGLLQ
                     GRLLCGRCGARMRVHYEPFEGRLRPYYVCNEAVVRHAGKHCQWVRGAPVDEAVSALLL
                     EVMAPAAIDVALAVQQEITQRVEQAAALRGTQLQRARYEAELARRRYLKVDPDNRLVA
                     DALEADWNARLRDLDALQREHERQNEADHSLLDEPAQQRIRALTADFPRIWNDERTGA
                     VERKRMLGLLIEDVTLLVDDEVNINIRWRGGRTQSLSVARPRPMSVIRKTPAQVVALI
                     NELLEATNDRQIAARLNELGHRNWRGEPFTPKKVMLVRRTYGLKSRYERLREGGMLTG
                     EEVAQQLGVCESTVHQLGRKGTLKRHRYASNHRYLYEPPGNVRLEKGAGSRYGGRQPR
                     LIVAQPLQQGAS"
     misc_feature    79473..80186
                     /locus_tag="NGR_b00900"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    79485..79907
                     /locus_tag="NGR_b00900"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    order(79494..79496,79500..79502,79719..79724,79731..79733)
                     /locus_tag="NGR_b00900"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    79500..79502
                     /locus_tag="NGR_b00900"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     misc_feature    80016..80366
                     /locus_tag="NGR_b00900"
                     /note="Recombinase; Region: Recombinase; pfam07508"
                     /db_xref="CDD:254248"
     misc_feature    80421..80603
                     /locus_tag="NGR_b00900"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; pfam13408"
                     /db_xref="CDD:257733"
     gene            complement(81747..81926)
                     /locus_tag="NGR_b00910"
                     /note="partial transposase/integrase"
                     /pseudo
                     /db_xref="GeneID:7789630"
     gene            82920..83684
                     /locus_tag="NGR_b00920"
                     /db_xref="GeneID:7789631"
     CDS             82920..83684
                     /locus_tag="NGR_b00920"
                     /codon_start=1
                     /transl_table=11
                     /product="rhomboid family protein"
                     /protein_id="YP_002822314.1"
                     /db_xref="GI:227818343"
                     /db_xref="GeneID:7789631"
                     /translation="MLPVRDAIPTRYPPTVVWTLIAANILVFLFQISLPPRAEEVFLF
                     SYGLIPSRYFGELKLSYPPQDLSDYLPFVSNMFLHGGWLHLILNMWTLWVFGPAVEDR
                     VGLARFAMFYLVCGLVASSVHAIANPNSVIPAVGASGAIAGVIGCYARMFPFARLVMI
                     VPILFIPLFFEIPALGFAAIWFLMQVIPGVFSLGQLSDVGGVAWWAHIGGFIAGWILA
                     PVLRRARRTYRKYYPDEGVYGFLPDGRRQEGRGPWG"
     misc_feature    82920..83612
                     /locus_tag="NGR_b00920"
                     /note="Membrane associated serine protease [Amino acid
                     transport and metabolism]; Region: COG0705"
                     /db_xref="CDD:223777"
     gene            83675..84502
                     /locus_tag="NGR_b00930"
                     /db_xref="GeneID:7789632"
     CDS             83675..84502
                     /locus_tag="NGR_b00930"
                     /codon_start=1
                     /transl_table=11
                     /product="serine protease"
                     /protein_id="YP_002822315.1"
                     /db_xref="GI:227818344"
                     /db_xref="GeneID:7789632"
                     /translation="MGVMDLLWIFLMITAMQPVLHRRYLEAMRIRKIAQVEKKRESRV
                     ILLVHRQETMGFLGFPLMRYIDINDSEEVLRAVQMTDDDVPLDLVLHTPGGLVLAALQ
                     IARAVRNHKGKVTVFVPHYAMSGGTLIALAADEIVMCRHSVLGPIDPQLGQMPAASII
                     KVAEQKPLAEVDDHTLIMADIGRKAIRQVEAAAAALLSRHMDEDASRTLAAKLASGTW
                     THDYPISPEEAKVMGLLVSTDIPNEVLELMTLYPQPVRQQRGVEYLPFPRQRELRHR"
     misc_feature    83678..84475
                     /locus_tag="NGR_b00930"
                     /note="Serine dehydrogenase proteinase; Region: SDH_sah;
                     pfam01972"
                     /db_xref="CDD:110924"
     misc_feature    83936..>84121
                     /locus_tag="NGR_b00930"
                     /note="Caseinolytic protease (ClpP) is an ATP-dependent
                     protease; Region: Clp_protease_like; cl15763"
                     /db_xref="CDD:265774"
     misc_feature    84044..84046
                     /locus_tag="NGR_b00930"
                     /note="active site"
                     /db_xref="CDD:132923"
     gene            84653..85711
                     /locus_tag="NGR_b00940"
                     /db_xref="GeneID:7789633"
     CDS             84653..85711
                     /locus_tag="NGR_b00940"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="YP_002822316.1"
                     /db_xref="GI:227818345"
                     /db_xref="GeneID:7789633"
                     /translation="MANGKCDICGMPATVRAQVVSSGRRQNMELCDEHYRQLARQSRG
                     RSASPLEELFGRSGSLFEDFFGDSLFPGAGFGSEEEGGRTSAPVHRGGRKGPAALADR
                     LSEQAEKILQEAAHKSVEFGRREVDTEHLLWALADSEVVRTILNQFKVSSDDLRQQIE
                     KEARRGQAKPDEEESEIGVSPRVKDALSRAFVTSNELGHTYVGPEHLLIGLTEEGEGL
                     AADLLKRYGLTPQALRQQVTKVVGRGAEEGRVEAPSTTPDLDKYSRDLTKMAREGKLD
                     PVIGRAKEIETTIEVLARRKKNNPVLIGEPGVGKTAIVEGLAQRIVTGEVPEALREKC
                     ALRKNWTLIPLNPGQQFH"
     misc_feature    84956..>85651
                     /locus_tag="NGR_b00940"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    84986..85138
                     /locus_tag="NGR_b00940"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    85238..85378
                     /locus_tag="NGR_b00940"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    85487..>85633
                     /locus_tag="NGR_b00940"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    85562..85585
                     /locus_tag="NGR_b00940"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    85565..85588
                     /locus_tag="NGR_b00940"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     gene            complement(85758..86549)
                     /locus_tag="NGR_b00950"
                     /db_xref="GeneID:7789634"
     CDS             complement(85758..86549)
                     /locus_tag="NGR_b00950"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 2 for insertion sequence
                     NGRIS-3d"
                     /protein_id="YP_002822317.1"
                     /db_xref="GI:227818346"
                     /db_xref="GeneID:7789634"
                     /translation="MKEARMLTNPTLDQMQALGLTGMAAAWRELTEQSGTNELSRDEW
                     LGLMLDREVTLRADKRIRNRLASAKLRFAQACIEDIDFAAARGLDRRNTMALAQGQWL
                     TAHEGLIITGHTGTGKSWLACAFGRQAARLGHSVLYVRVPRMFEELALARLDGSFPRL
                     IDRLTRVQLLILDDFGTHTLSDQQRFHLFEIVEERYQRKSTLITAQVPVASWHDLIAD
                     STVADAILDRIVHNAHRITLRGESMRKQKSAPLLTGAENGEINQP"
     misc_feature    complement(85806..86534)
                     /locus_tag="NGR_b00950"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    complement(86382..86468)
                     /locus_tag="NGR_b00950"
                     /note="IstB-like ATP binding N-terminal; Region:
                     IstB_IS21_ATP; pfam08483"
                     /db_xref="CDD:117060"
     misc_feature    complement(85941..86267)
                     /locus_tag="NGR_b00950"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(86193..86216)
                     /locus_tag="NGR_b00950"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(86031..86033,86190..86213))
                     /locus_tag="NGR_b00950"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(86028..86045)
                     /locus_tag="NGR_b00950"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            complement(86546..88096)
                     /locus_tag="NGR_b00960"
                     /db_xref="GeneID:7789635"
     CDS             complement(86546..88096)
                     /locus_tag="NGR_b00960"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 1 for insertion sequence
                     NGRIS-3d"
                     /protein_id="YP_002822318.1"
                     /db_xref="GI:227818347"
                     /db_xref="GeneID:7789635"
                     /translation="MPRRKQARRTTVRDIRTILRLTHEEGLSVREIAERLKIGKSSVS
                     TYLLRSREAGLSWPLPIGADEDAKLERRLFGRAGRPPRDLSEPDWALVVRELKRKGVT
                     LTLLWQEYRASHPDGYGFTWFCEQVAAFRQRTSVAFRNRHAAGAVMQTDYAGPTVPVI
                     DPATGVIHPAQIFVAVLGASNLTFAHASFSQQLPDWIDGQVRALTFYGGVTKAIVCDN
                     LKSGVAKALWFEPTLTATFAAMAEHYDTTILPTRSRKPRDKGRVEGAVLIVERWILAR
                     LRNRTFFSLAALNTAIAELLEDLNNRTMRHVGKSRRELFEEIERPALKPLPAIPFEYA
                     EWKSAKVHPDYHVEVDKTFYSVPHRLIGCTLQVRLTHRVVEIFHDHQRVASHVRRSQR
                     SGHVTVNDHMPKAHQRYANTTPANLIGRATQIGPNAAILVERMMRDRPHPEQGYRSAM
                     GILSLAPRYGSQRLEAACERALTINAITYSSVASILKSGLDRERPQAEHAAPTPAHTN
                     IRGRSYYQ"
     misc_feature    complement(<87932..88045)
                     /locus_tag="NGR_b00960"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(87941..87946,87950..87955,87962..87967,
                     87971..87982,88007..88015))
                     /locus_tag="NGR_b00960"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(88004..88006,88013..88015))
                     /locus_tag="NGR_b00960"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(87146..88003)
                     /locus_tag="NGR_b00960"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    complement(87278..>87583)
                     /locus_tag="NGR_b00960"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(86552..>87166)
                     /locus_tag="NGR_b00960"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     gene            88309..90096
                     /locus_tag="NGR_b00970"
                     /db_xref="GeneID:7789636"
     CDS             88309..90096
                     /locus_tag="NGR_b00970"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="YP_002822319.1"
                     /db_xref="GI:227818348"
                     /db_xref="GeneID:7789636"
                     /translation="MVAGSKYRGEFEERVQQILKEVTDNRNDLVLFIDEIHTIVGAGQ
                     GGGEGGLDIANVFKPALARGELNLIGATTLNEYQKHIEKDAALERRFQPVLVPEPTVA
                     QAIMILRGLRDTLEAHHKVTITDEAIIAAVELSDRYVTGRFLPDKGIDLIDQAAARVK
                     ISATARPVDLQELEAEVQQLKREQDYASSRKHFDKASELKAQVETKQGELDALTETWK
                     RDRATGSAEVRSEHVAQVVSKLTGIPVTELTVEERERLVRMEEKLHERVIGQEEAIKA
                     VSDAVRLARAGLREGRKPVATFLFLGPTGVGKTELAKALAEIVYGDEDAMVRLDMSEY
                     MERHTVARLVGAPPGYVGYEEGGQLTERVRRRPYTVVLLDEIEKAHPDVYNVLLQVFD
                     DGRLTDGKGRMVDFTNTIIIATSNLGSDIIQRNLRLRGSAAEDPGKLKRELMEVLRGH
                     FRPEFINRIDEIIVFQSLSREEIKAIVELQLERVKRTAHGQGIELEIDASLIDYLASE
                     GYRPEFGARELRRLIRSELETELARAMLAGEATDGAKVIARWDSTHDKIAFKIEPAKD
                     TAAPKSILPETKRRTRTKPESEGSRPSVH"
     misc_feature    <88309..90000
                     /locus_tag="NGR_b00970"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    <88309..88605
                     /locus_tag="NGR_b00970"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    88396..88413
                     /locus_tag="NGR_b00970"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    88576..88578
                     /locus_tag="NGR_b00970"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    89110..89595
                     /locus_tag="NGR_b00970"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    89212..89235
                     /locus_tag="NGR_b00970"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(89215..89238,89428..89430,89554..89556)
                     /locus_tag="NGR_b00970"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    89416..89433
                     /locus_tag="NGR_b00970"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    89710..89949
                     /locus_tag="NGR_b00970"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            90349..90996
                     /locus_tag="NGR_b00980"
                     /db_xref="GeneID:7789637"
     CDS             90349..90996
                     /locus_tag="NGR_b00980"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822320.1"
                     /db_xref="GI:227818349"
                     /db_xref="GeneID:7789637"
                     /translation="MVARSMGGWGAGGFPNRRREAWHPDQEEENDSLSAPGRNGASSS
                     GVNAPSAISCSASSLTAIFVLSSPGPSASRERPASRCRCKRQRKPVRQNLLTVEDEKQ
                     IHRCTSCGFPSDRALEVSTLDLPFERKQRLLDLVETGGPVVLRHAFVGCLVGQVFDPG
                     PVHQDRALGFEREPQVKDHVHGRGPTFRAGRIVAGCRCVEGAPVAFLKRHEPEPF"
     gene            complement(90670..91413)
                     /locus_tag="NGR_b00990"
                     /db_xref="GeneID:7789638"
     CDS             complement(90670..91413)
                     /locus_tag="NGR_b00990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822321.1"
                     /db_xref="GI:227818350"
                     /db_xref="GeneID:7789638"
                     /translation="MEIVKQVEEARKPQVPGAQPSNDNRHKPLSMMRSFFPSDAVARI
                     FKPSRSVMTSGKARTNGWRLVFDRRSAPFIEPLMGYTGDRDTLTQVELDFPTRESAIR
                     YAERQGLTYVVQAPAGQVADQVGRQAGSATHAFSDATLERLGLMSLQESYGRALDTAA
                     TGNDPSSPESWASPMDVVFDLGLSLEAKRSILMNWAWIEYLPDQATNEGMPENNRPSR
                     LDEVEQALLALEREVEGRDLQGTIARKAA"
     misc_feature    complement(<91066..91290)
                     /locus_tag="NGR_b00990"
                     /note="ETC complex I subunit conserved region; Region:
                     ETC_C1_NDUFA4; pfam04800"
                     /db_xref="CDD:252810"
     gene            complement(91417..91680)
                     /locus_tag="NGR_b01000"
                     /note="truncated heat shock protein"
                     /pseudo
                     /db_xref="GeneID:7789639"
     gene            complement(91905..92423)
                     /locus_tag="NGR_b01010"
                     /db_xref="GeneID:7789640"
     CDS             complement(91905..92423)
                     /locus_tag="NGR_b01010"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein, hsp20 family"
                     /protein_id="YP_002822322.1"
                     /db_xref="GI:227818351"
                     /db_xref="GeneID:7789640"
                     /translation="MRTTFNFTPLFRSSIGFDRMLNALEAASRVESIYSWPPYDIAKT
                     GEDDYRITMAVAGFSQDEMAITQEQYMLMVSGQNADADDGQYLHRGIASRAFQRRFQL
                     ADHVKVVGASLANGLLTIGLKRELPEEMKPRRIEITTRKALPKVETKQIEAEKQVACT
                     FPTAQFAHGAGR"
     misc_feature    complement(92013..92423)
                     /locus_tag="NGR_b01010"
                     /note="Molecular chaperone (small heat shock protein)
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: IbpA; COG0071"
                     /db_xref="CDD:223149"
     misc_feature    complement(92052..92315)
                     /locus_tag="NGR_b01010"
                     /note="Alpha-crystallin domain (ACD) found in Escherichia
                     coli inclusion body-associated proteins IbpA and IbpB, and
                     similar proteins.  IbpA and IbpB are 16 kDa small heat
                     shock proteins (sHsps). sHsps are molecular chaperones
                     that suppress protein aggregation...; Region:
                     ACD_IbpA-B_like; cd06470"
                     /db_xref="CDD:107227"
     misc_feature    complement(order(92073..92078,92130..92132,92253..92258,
                     92262..92264,92268..92270,92295..92309))
                     /locus_tag="NGR_b01010"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     misc_feature    92417..92493
                     /note="NGR_b01020; temperature sensor, ROSE, RF00435"
     gene            complement(92633..93439)
                     /locus_tag="NGR_b01030"
                     /db_xref="GeneID:7789641"
     CDS             complement(92633..93439)
                     /locus_tag="NGR_b01030"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002822323.1"
                     /db_xref="GI:227818352"
                     /db_xref="GeneID:7789641"
                     /translation="MGGNGLNKSLLDTVISSTPKWTSHARVVDQLGKAIVSGEFPVGS
                     ILPGDPELALRFRVSRTVLREAMKTLAARGMVVPRARIGTRVTPRKEWNLFDADILTW
                     HFACGVDEDFLYHLIEVRLAFETHAAALAARNATEAEIATMMRLAVAMGDANHTAEAL
                     AVADLKFHLAVLEASGNSFLRTVGGLIEAALVGVFKLSPPTDEKGGIDEVARNHIRIV
                     EEIGRRDEVGARQAMEYLIKSGGSACCERSTVHQQHGRRSACHEHSGVRS"
     misc_feature    complement(92720..93400)
                     /locus_tag="NGR_b01030"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(93179..93370)
                     /locus_tag="NGR_b01030"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(93188..93199,93203..93208,93236..93238,
                     93245..93250,93254..93268,93290..93295,93299..93301,
                     93368..93370))
                     /locus_tag="NGR_b01030"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(92729..93094)
                     /locus_tag="NGR_b01030"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(93523..93750)
                     /locus_tag="NGR_b01040"
                     /db_xref="GeneID:7789642"
     CDS             complement(93523..93750)
                     /locus_tag="NGR_b01040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822324.1"
                     /db_xref="GI:227818353"
                     /db_xref="GeneID:7789642"
                     /translation="MLENLARFSHRLDGRGAGRRDACSTLGRSKTNAVGVAAVLGLAM
                     YPLLLAEGFQAGGIFEPRRQFAPTPMLNSRA"
     gene            complement(93781..94194)
                     /locus_tag="NGR_b01050"
                     /db_xref="GeneID:7789643"
     CDS             complement(93781..94194)
                     /locus_tag="NGR_b01050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822325.1"
                     /db_xref="GI:227818354"
                     /db_xref="GeneID:7789643"
                     /translation="MDPLKIAKQVAELVEQEADRRGISVTFCAIDAHGNLILKHRMPG
                     ANLISIEMSERKAYTCAALPVIKTADMTLLARPGESLYTFASVAGGRYTVLGGGVPLR
                     IDGTFVAGIGVSGGTTEQDVEIVEAAVARLGQVNR"
     misc_feature    complement(93799..94188)
                     /locus_tag="NGR_b01050"
                     /note="Domain of unknown function (DUF336); Region:
                     DUF336; pfam03928"
                     /db_xref="CDD:252253"
     gene            94522..95541
                     /gene="rbsB"
                     /locus_tag="NGR_b01060"
                     /db_xref="GeneID:7789644"
     CDS             94522..95541
                     /gene="rbsB"
                     /locus_tag="NGR_b01060"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic ribose-binding protein"
                     /protein_id="YP_002822326.1"
                     /db_xref="GI:227818355"
                     /db_xref="GeneID:7789644"
                     /translation="MYQTSMGRRIVLGLIASVALAGSLAVPAQAQEMKTIGWSVAYFD
                     HPVYQLMMKGAEKVADEAGCKVIFADGKDDPSVQASHIDNFIAQGVDGIILTPTVSDP
                     LIPAVKKVNDAGIPLVMADRRMQTHGQPIKWEALVSWDMVKSGTIGGEQTVKAIGGKG
                     NIVVVEGTPGAGSTIDRGNAFYEVIEKYPDIKILAKIPANFNRAKGQEVTENILQRFK
                     PGEIDAIYYMADEMTFGGLQAIKAAGRLGEFKIISVDGQKEAMDLLRAREIDYEAIFH
                     PDDQAVAVRILCDIVNGRTPDLANQTYEGRKMDLVEFEGMPWVRPTVYAVDKSNAHLP
                     ENQGW"
     misc_feature    94624..95412
                     /gene="rbsB"
                     /locus_tag="NGR_b01060"
                     /note="Periplasmic sugar-binding domain of active
                     transport systems that are members of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_ABC_sugar_binding_like; cd01536"
                     /db_xref="CDD:107249"
     misc_feature    94627..95406
                     /gene="rbsB"
                     /locus_tag="NGR_b01060"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    order(94660..94662,94882..94884,95050..95052,95284..95286,
                     95344..95346)
                     /gene="rbsB"
                     /locus_tag="NGR_b01060"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107249"
     gene            95716..97209
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /db_xref="GeneID:7789645"
     CDS             95716..97209
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /EC_number="3.6.3.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose/galactose/methyl galactoside import
                     ATP-bindingprotein"
                     /protein_id="YP_002822327.1"
                     /db_xref="GI:227818356"
                     /db_xref="GeneID:7789645"
                     /translation="MPAILEMQDIEKNFPGVKALRGVTFTIESGEVHALLGENGAGKS
                     TLMKILAGAQGKDAGQIRIDGRDVDISGPLHARQLGIAIIYQELSILPHLSVAENIFL
                     GRLPRMASMPWIVDWKLCCARARELLKQVGLDIDPLIPASRLKVADQQMVEIAKAVSE
                     NAKIVIMDEPTTSLTNREVETLFKTVRRLQEHGVSIVYVSHRLAEVKEICDRATVLRD
                     GMKIGTVNVAETTSKDWVKMMVGRDLDQLFPKMPVKRGKEALRVEGVSSQKLKNVSFS
                     AYEGEILGIAGLIGSGRSTLARTIFGAEARVAGSVNIGGKEAAIASPLEAISQGIALV
                     PEDRKLQGLVLPMTVRENITLAKLGGISRVGQLNLRRESKVAAEYVQALQISTPHIDQ
                     KTINLSGGNQQKVVLAKWLYSDARILIIDEPTRGIDVGARAEIYGLLQQFVEKGKSVI
                     IISSDLPELIGMSDRIIVMHEGRITAELAPSQFNEELIMTYASGMSH"
     misc_feature    95716..97197
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    95728..96387
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    95824..95847
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(95833..95838,95842..95850,95971..95973,96217..96222,
                     96316..96318)
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    95962..95973
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(95995..96009,96160..96174)
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    96205..96222
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    96229..96240
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    96304..96324
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    96481..97137
                     /gene="rbsA3"
                     /locus_tag="NGR_b01070"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            97333..98379
                     /locus_tag="NGR_b01080"
                     /db_xref="GeneID:7789646"
     CDS             97333..98379
                     /locus_tag="NGR_b01080"
                     /note="permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter"
                     /protein_id="YP_002822328.1"
                     /db_xref="GI:227818357"
                     /db_xref="GeneID:7789646"
                     /translation="MNKREIHAKGGAADRLSAPAGASHLMGRFGDQLVPAIFLIALVI
                     TLSLVSPNFLSVGNFLDIARVVSIIGIMAVGMTIVILTGGIDLSVGSTFALASVVAAS
                     LIPGSFSDAPRILAFVLPVPFAILAGLLVGAAVGFINGFIIAKSRVEPFIVTLATMAF
                     VRGLTYLFTGGFPTIFRPMPPLFEWFGQGYVFGLPTPTIFFALVVLIGVWITRRTTFG
                     RSIYAIGGNEEASRLSGIKVQSIKIWAYTLMGALAALSGIILASRVGAAQPTAGLTYE
                     LDVIAGVVIGGTSLLGGRGSIMSTVLGVFILGVISNGLNIAGVPTYYQYVVKGLLLIS
                     AVGFDSYLRKMQRN"
     misc_feature    97528..98349
                     /locus_tag="NGR_b01080"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    98017..98073
                     /locus_tag="NGR_b01080"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            98417..99475
                     /locus_tag="NGR_b01090"
                     /db_xref="GeneID:7789647"
     CDS             98417..99475
                     /locus_tag="NGR_b01090"
                     /note="permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter"
                     /protein_id="YP_002822329.1"
                     /db_xref="GI:227818358"
                     /db_xref="GeneID:7789647"
                     /translation="MQAQSKAAAPLAVPQFNGLRSTLLARGGHQLIIIALIIIVGLAI
                     YWIQPRFLSAYSIDNILRTASIYGIVALGMTLVIITGGIDLSAGSMMALGGALAAGLL
                     GTAFGAANPLSFPPMVAILIALAVAASIGMLNGLAISALGMAPFVVTLGMMTVVRGLT
                     FIFADFTVGSVPGSPITFMDSLFSWLGSGSFGPIPTAAALFLTLAVILSIVLRFTPFG
                     RSIYAIGGDAEIARLAGINVPLVIVGVYALMGMLAGLGGVVQAGRLSSVSPLMGVGYE
                     LDIITIVVVGGASLAGGRGTVFGTVLAAILISLIDNGLTMMNVPSFYQYLVKGSVLLA
                     AVILDQWYQRHRAAMATA"
     misc_feature    98606..99433
                     /locus_tag="NGR_b01090"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    99101..99157
                     /locus_tag="NGR_b01090"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            99512..101203
                     /locus_tag="NGR_b01100"
                     /db_xref="GeneID:7789648"
     CDS             99512..101203
                     /locus_tag="NGR_b01100"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate dehydrogenase"
                     /protein_id="YP_002822330.1"
                     /db_xref="GI:227818359"
                     /db_xref="GeneID:7789648"
                     /translation="MGSGTPSPVDVVIVGTGATGGTAAKVLSERGLNVVGIDRGPYLT
                     PKDFSGDEIKYVNRNFLVPDVLLNPRTYRQDESETAELSAFSLLPQVVGGGTVHWAGW
                     FPRPKPSDFIQHSLHGDVPGASLADWPYSYEDLEPFLTKVEWAFGCAGLDAADRNAPY
                     RSRPYPNPPMPPTKFGRAFYRACQKLDINAHPIPQALVTQPFKGRKPKHLTGFWNLYG
                     DPSGMRSGTATTFIPEALATGNYELRTDCYVQRIVADRYGNAEGVIYLDADGAQVEQK
                     ASIVILAAGAIESARLLLLSATERHPDGLANSSGMLGKNATFHEYVYATGVFDREVCE
                     PFDGYAGHYLSGGSMQFYETDEKRGHICGSIIGASQVGHPINWMLPGRPVWGEAAKRA
                     DHDYFRHSMKIGMCLHDLAVESNRVDLDPTVKDAWGMPVARITHRSHSNDLALAKWQL
                     AKNAEILDAAGAKQVTSVSHQRCTGNTFHQHGTARMGFDPSKTVLNEWGEAHDVQNLY
                     VIDGSGFPTALGVNPTLTMMAHAWRACEFIADYHAKGRKFRLDRRPAARNNAGGA"
     misc_feature    99539..101140
                     /locus_tag="NGR_b01100"
                     /note="Choline dehydrogenase and related flavoproteins
                     [Amino acid transport and metabolism]; Region: BetA;
                     COG2303"
                     /db_xref="CDD:225186"
     misc_feature    99764..100468
                     /locus_tag="NGR_b01100"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    100754..101104
                     /locus_tag="NGR_b01100"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            101205..101900
                     /locus_tag="NGR_b01110"
                     /db_xref="GeneID:7789649"
     CDS             101205..101900
                     /locus_tag="NGR_b01110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822331.1"
                     /db_xref="GI:227818360"
                     /db_xref="GeneID:7789649"
                     /translation="MASRAEWQRITRSVTGGPENRLFFTAHEWATIEAATARIYPTDE
                     TPGAREAMAVRFIDRYLSGLDYIFASADGDAFLQISGKDRDAWRIRIEKLQRRYRDGI
                     RRLDDVALTEFKTEFRHLDAAQQDRALEILSGSPKPTRIQVAEEGEAHVQNISDDDLD
                     FFAALTLHTRQGTFCDPVYGGNAGRVGWDAIGFPGPPTLASTQDCSYGHADKFLTDFD
                     WEDLIPHLKNRVR"
     misc_feature    101277..101789
                     /locus_tag="NGR_b01110"
                     /note="Gluconate 2-dehydrogenase subunit 3; Region:
                     Gluconate_2-dh3; pfam13618"
                     /db_xref="CDD:257931"
     gene            101948..102565
                     /locus_tag="NGR_b01120"
                     /db_xref="GeneID:7789650"
     CDS             101948..102565
                     /locus_tag="NGR_b01120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822332.1"
                     /db_xref="GI:227818361"
                     /db_xref="GeneID:7789650"
                     /translation="MTNHSPGNASPPTTGINPDGFMFFNATEARTLDAMTARIMPSEP
                     DGLGAREAGVVTYLDHAVAGYFRDLQSIYRVGLQRLDSYCLAKAGAVFAGLSVSRQDE
                     ILRELDAGIDVSAAGADTEGLEGDSVEPILTRFFAIVREHTIQGMFCDPIYGGNRDFV
                     GWKLIGFPGAQWEYTEEQMRPGFDATTIPILSLADLQRSRVFCHD"
     misc_feature    102020..102454
                     /locus_tag="NGR_b01120"
                     /note="Gluconate 2-dehydrogenase subunit 3; Region:
                     Gluconate_2-dh3; pfam13618"
                     /db_xref="CDD:257931"
     gene            102558..104249
                     /locus_tag="NGR_b01130"
                     /db_xref="GeneID:7789651"
     CDS             102558..104249
                     /locus_tag="NGR_b01130"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate dehydrogenase"
                     /protein_id="YP_002822333.1"
                     /db_xref="GI:227818362"
                     /db_xref="GeneID:7789651"
                     /translation="MTKKKEAIVVGLGASGGIIAAALAKAGVKVTALEKGPHYPEDHF
                     RDKQDEIRYYTRGALVPHLSNNPITWRARGSQIARLLPWATGPLGTTEPLHLPPSIGT
                     GGGTLHWGGAVWRHREADFRMRSALIARYGEAAIPEGTSIVDWPFGYDELEPYYDRVE
                     WELGVSGQAGNINGELVAGGNPFEAPRKRGYPMPPLRSAAANSRFVEAARRLGLHPFP
                     QAAAIASEDYKNLKGCVYCGFCHGYPCHVNAKQTSHVTSVPEGLASGNLDIIPFARVI
                     QVNRDGGRVKGVSYIDAVGKVHDIEADIVVLATYSLENTRLLLQSGINANGQVGKHFM
                     THCFGWSTGVVPEFTNSFMGPLVGAHVVDDYTSELIPDNDLGVVWGSPITSFPGDTQP
                     IEASHNTPPGMRKWGSEYKEWFASSYRRIFSMHTQTSSLPYAGGYCDLDPNIKDPFGQ
                     PALRITHDWMPHDINSMKFFTRVKQAIAKEMGMTEFWEEPNPPPYHLSTHEVGTHRMG
                     LDPETSVVDPYGESHECEKLFVVGGGQFPTLPSYNPTMTIQALAFLTADRIAGKI"
     misc_feature    102558..104246
                     /locus_tag="NGR_b01130"
                     /note="Choline dehydrogenase and related flavoproteins
                     [Amino acid transport and metabolism]; Region: BetA;
                     COG2303"
                     /db_xref="CDD:225186"
     misc_feature    102582..102770
                     /locus_tag="NGR_b01130"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; pfam13450"
                     /db_xref="CDD:257775"
     misc_feature    <102996..103565
                     /locus_tag="NGR_b01130"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    103851..104213
                     /locus_tag="NGR_b01130"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            104279..105001
                     /locus_tag="NGR_b01140"
                     /db_xref="GeneID:7789652"
     CDS             104279..105001
                     /locus_tag="NGR_b01140"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase/reductase SDR"
                     /protein_id="YP_002822334.1"
                     /db_xref="GI:227818363"
                     /db_xref="GeneID:7789652"
                     /translation="MVTTSSVSLKGKVAFVTGASGGIGAAVAQALAAQGAKLGLASRT
                     GNDLGLADVVALRCDVRDPAQVKAAVAATVERFGRLDIVIANAGLGSYRPVIDTSTEE
                     IDEMVDVNVKGLIYTAQATIPYLCERGGDFVTLASEAGRRGLPGEAVYVASKFAQVGF
                     TRSLDHELRGFGIRCSNICPGGVATNFGMGRGLRTPDMPQLSEMMRSEDVAEVVLFNL
                     TRPPTFRILETAFRSMHEQSWG"
     misc_feature    104300..104944
                     /locus_tag="NGR_b01140"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK07326"
                     /db_xref="CDD:235990"
     misc_feature    104318..104926
                     /locus_tag="NGR_b01140"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(104330..104332,104336..104347,104402..104410,
                     104450..104458,104534..104542,104603..104605,
                     104681..104689,104726..104728,104738..104740,
                     104816..104827,104831..104836)
                     /locus_tag="NGR_b01140"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(104606..104608,104687..104689,104726..104728,
                     104738..104740)
                     /locus_tag="NGR_b01140"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            105042..106007
                     /locus_tag="NGR_b01150"
                     /db_xref="GeneID:7789653"
     CDS             105042..106007
                     /locus_tag="NGR_b01150"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar kinase"
                     /protein_id="YP_002822335.1"
                     /db_xref="GI:227818364"
                     /db_xref="GeneID:7789653"
                     /translation="MKKIVTIGEILVEIMAVDRGEGFTQPMSLVGPFPSGAPAIFIDQ
                     AARFGQPCGMVGCVGADHFGRVNLDRLKRDGVDISGIAVDSEYATGSAFVRYRHDGSR
                     DFVFNIKHSASGRMSLTDNARALIDGSDHLHVMGTSLFSPRIVEVVLKAVGMIKAKGG
                     TVSFDPNVRSEMLALPGLREALETILGQCDLFLPSGPELFLFAPGNSEVEAIGQILKK
                     EIKAVVVKNGSQGANYHDLGSTIRQPAFNVHEVDPTGAGDCFGATFVSCWLRGMTPGD
                     ALRYAAASGARAVERQGPMEGVSTLAELDTFIADTSAPLIFRSHQ"
     misc_feature    105048..105926
                     /locus_tag="NGR_b01150"
                     /note="2-keto-3-deoxygluconate kinase (KdgK)
                     phosphorylates 2-keto-3-deoxygluconate (KDG) to form
                     2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the
                     common intermediate product, that allows organisms to
                     channel D-glucuronate and/or D-galacturinate into the...;
                     Region: KdgK; cd01166"
                     /db_xref="CDD:238571"
     misc_feature    order(105147..105152,105159..105161,105315..105317,
                     105357..105359,105363..105365,105450..105452,
                     105546..105548,105804..105806,105813..105815,
                     105921..105923)
                     /locus_tag="NGR_b01150"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    order(105717..105719,105732..105734,105777..105779,
                     105804..105812,105819..105821,105885..105887,
                     105897..105899)
                     /locus_tag="NGR_b01150"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     gene            106004..107287
                     /locus_tag="NGR_b01160"
                     /db_xref="GeneID:7789654"
     CDS             106004..107287
                     /locus_tag="NGR_b01160"
                     /codon_start=1
                     /transl_table=11
                     /product="tagatose 6-phosphate kinase agaz"
                     /protein_id="YP_002822336.1"
                     /db_xref="GI:227818365"
                     /db_xref="GeneID:7789654"
                     /translation="MSKLRIATIARDRIAGDRSGITSVCTAHPIVIEAALLQGKAEGT
                     EVLIEATCNQVNQEGGYTGMTPAHFRRFVSGIAERVGFDPRRLILGGDHLGPNPWKHL
                     PAQEAMVRAEAMVDAYVRAGFTKIHLDTSMGCAGESLALANETTAERAARLASVAEAA
                     SGNTGSSPFYVIGTEVPVPGGALESIDNLEVTGPEAALETVDVHRKSFAAAGVSHAFE
                     RAVGVVVQPGVEFGNANVITYDREKAADLSAVLSKMPQFVFEAHSTDYQPAEALRALV
                     EDGFAILKVGPWLTFALRQALYGLDQIAQVLDAKFSEHSLCAAMERLMLREPANWQKY
                     YHGDATELRIQRHFSYSDRIRYYWPHPEAQAAIKRLLSFLQGRTIPETLISQYLEGLY
                     PAVASGQVSADAISLQLASVRRVLGIYARACRRSS"
     misc_feature    106016..107275
                     /locus_tag="NGR_b01160"
                     /note="Tagatose 6 phosphate kinase; Region:
                     Tagatose_6_P_K; pfam08013"
                     /db_xref="CDD:203838"
     gene            107549..108634
                     /locus_tag="NGR_b01170"
                     /db_xref="GeneID:7789655"
     CDS             107549..108634
                     /locus_tag="NGR_b01170"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="YP_002822337.1"
                     /db_xref="GI:227818366"
                     /db_xref="GeneID:7789655"
                     /translation="MIAPYTAVALSTRNYAVKTTKESLENIKRINDFMDVAVMVAATD
                     GAPVRLIVLPEMAIQGMPMDFRAGNKEQHESAATTIPGPETEALAVKAKQFNAYIAAE
                     LLWVRDDDFPGHLFNVGFIINPQGEIIYRRAKATSDAYEGGALGTTNPHDIWEEWVEK
                     KGNGSKLDAFFPVARTEIGNIGYLICHEGAYPETARGLAMNGCEIMIRATLIEPQVMQ
                     GMWELQNRAHAMFNQMMVISPNLGPQVGKDGGFFDVFGGQSMIVDHKGHVLVKQPGMA
                     NGDSFVSTVVDVEALRRARIANGVTNWFKDLRTEQYAAIYEQPIYEKNQYLKELPQED
                     WLAREAKRRAGNIEKLVERGVLVRPTK"
     misc_feature    107561..108475
                     /locus_tag="NGR_b01170"
                     /note="Uncharacterized subgroup of the nitrilase
                     superfamily (putative class 13 nitrilases); Region:
                     nitrilase_4; cd07582"
                     /db_xref="CDD:143606"
     misc_feature    order(107711..107713,107948..107950,107960..107962,
                     108011..108013,108104..108109,108113..108118,
                     108179..108181)
                     /locus_tag="NGR_b01170"
                     /note="putative active site [active]"
                     /db_xref="CDD:143606"
     misc_feature    order(107711..107713,107948..107950,108104..108106)
                     /locus_tag="NGR_b01170"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:143606"
     misc_feature    order(107951..107962,108008..108010,108029..108037,
                     108107..108109,108113..108127,108134..108139,
                     108215..108220,108224..108232,108236..108241,
                     108317..108322,108461..108475)
                     /locus_tag="NGR_b01170"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143606"
     gene            108744..109787
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /db_xref="GeneID:7789656"
     CDS             108744..109787
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /EC_number="1.1.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent alcohol dehydrogenase C"
                     /protein_id="YP_002822338.1"
                     /db_xref="GI:227818367"
                     /db_xref="GeneID:7789656"
                     /translation="MFHCYGYAATSSDTPLAPFSFERRDPGPKDVQIEILYCGVCHSD
                     LHRVRNEWGGTIYPCVPGHEMVGRVTAVGTEVTKYKVGDIAGVGVMVDSCRQCANCRD
                     GLEQFCDNGNTETYNSYDKHTGGHTLGGYSSHIVVDEHFVLRIPEGLDPAAVAPLLCA
                     GITTYSPLRRWKVGPGQKVGIVGLGGLGHMGVKIAKALGAHVVLFTTSSGKAKDAERL
                     GAAEVVLSTDSNAMAQQANSFDFILDTISARHDVAAYLELLRRDGTLTQVGVPVEPQP
                     IHAGTLVGKRRNYAGSAIGGIAETQEMLDFCAKHNIVSDVELISIDQVNEAFERMLRS
                     DVKYRFVIDMKTR"
     misc_feature    108759..109781
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /note="Zn-dependent alcohol dehydrogenases [General
                     function prediction only]; Region: AdhP; COG1064"
                     /db_xref="CDD:223992"
     misc_feature    108759..109772
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /note="Cinnamyl alcohol dehydrogenases (CAD); Region:
                     CAD1; cd05283"
                     /db_xref="CDD:176186"
     misc_feature    order(108864..108872,108879..108881,109218..109220,
                     109230..109232,109359..109364,109374..109376,
                     109419..109421,109476..109481,109485..109487,
                     109545..109550,109617..109625)
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    order(108864..108866,108870..108872,108930..108932,
                     109008..109010,109218..109220,109623..109625)
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176186"
     misc_feature    order(108864..108866,108930..108932,109218..109220)
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    order(109023..109025,109032..109034,109041..109043,
                     109065..109067)
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /note="structural Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176186"
     misc_feature    order(109062..109064,109239..109241,109251..109253,
                     109527..109529,109542..109550,109554..109556,
                     109581..109583,109587..109592,109599..109622)
                     /gene="adhC1"
                     /locus_tag="NGR_b01180"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:176186"
     gene            complement(109989..110852)
                     /locus_tag="NGR_b01190"
                     /db_xref="GeneID:7789657"
     CDS             complement(109989..110852)
                     /locus_tag="NGR_b01190"
                     /note="IclR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_002822339.1"
                     /db_xref="GI:227818368"
                     /db_xref="GeneID:7789657"
                     /translation="MNLRSDSAAARRQPRARKNHKAEPASPGGNKRPAGLNRSVSRAL
                     DLLLDIAHNPYPQSFVDLQHQHRVPKATLHKLLFTLEALHFIRRDQETGKYSVGLAAL
                     EVAAAGAASPADLPFLLKPILEKLVEENNETCHLGILQGGEEIILKRLDPLEQVVRLA
                     LTVGRRHPAYASSGGLASMALSMTDADLEAFPEALPQLTENTIKSREELRERLAEVRA
                     KGYSLDMEEAYIGVRCVGVAVAVPNWPVVHISFSLPLQRAPVERLRALAKPLLAAAKE
                     IEKILSVTPRA"
     misc_feature    complement(<110562..110744)
                     /locus_tag="NGR_b01190"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(110067..110741)
                     /locus_tag="NGR_b01190"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    complement(<110136..110390)
                     /locus_tag="NGR_b01190"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     gene            111363..111914
                     /locus_tag="NGR_b01200"
                     /db_xref="GeneID:7789658"
     CDS             111363..111914
                     /locus_tag="NGR_b01200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822340.1"
                     /db_xref="GI:227818369"
                     /db_xref="GeneID:7789658"
                     /translation="MGSHSTVSQCLRASSAASEALLRWMGPLADIESAHWDLYWRLFC
                     AWEKVIGEDELRERLAKVRAAAHIKADLGDRPWILTDEPVNVSQVLHETIFPGPATKT
                     VEYHEATGRAMVWWTSAASGAFQIVQRRQSGWVNWGSNGENECPELPVGVDIKTAYGA
                     FAERWETVADQLETPPLVRVAAG"
     gene            complement(111998..113008)
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /db_xref="GeneID:7789659"
     CDS             complement(111998..113008)
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine-fructose-6-phosphate transaminase"
                     /protein_id="YP_002822341.1"
                     /db_xref="GI:227818370"
                     /db_xref="GeneID:7789659"
                     /translation="MLGEIKEIPAVVERQIREGAEAYRDEGLRLRRESPRFLVSCARG
                     SSDQAVTYFKYLVETGVGIPVASVGPSIASVYNATLDFAGGVCLTVSQSGGSPDLVSL
                     QKRAGDGGARTVALLNVTDSPVGNGAGSVLPMLAGPEKAVAATKSFVASLVALASVAA
                     NWTEDRALIDALVSLPESLAEALECDWSAAALPIAASQSLFTIGRGPSLGIAGEAALK
                     FKETCRLHAEAYSAAEVRHGPIALARDRFAALVFVNGDDADTSIRGAVQNLEAAGAKA
                     FVAGAQMDGGKSLPTVAVRHALLNPICRVVSFYRFVEALAVSLGENPDAPALLRKVTK
                     TV"
     misc_feature    complement(112004..113008)
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /note="Predicted phosphosugar isomerases [Cell envelope
                     biogenesis, outer membrane]; Region: AgaS; COG2222"
                     /db_xref="CDD:225132"
     misc_feature    complement(112523..112900)
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /note="SIS (Sugar ISomerase) domain repeat 1 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_1; cd05008"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(112715..112717,112781..112783,
                     112790..112792,112805..112807,112811..112813,
                     112832..112837,112844..112849,112877..112882))
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240141"
     misc_feature    complement(order(112730..112738,112871..112876))
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /note="active site"
                     /db_xref="CDD:240141"
     misc_feature    complement(112007..112453)
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /note="SIS (Sugar ISomerase) domain repeat 2 found in
                     Glucosamine 6-phosphate synthase (GlmS) and
                     Glucosamine-6-phosphate deaminase (GlmD). The SIS domain
                     is found in many phosphosugar isomerases and phosphosugar
                     binding proteins. GlmS contains a N-terminal...; Region:
                     SIS_GlmS_GlmD_2; cd05009"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(112010..112012,112025..112030,
                     112205..112210,112214..112216,112226..112231,
                     112280..112291,112295..112303,112307..112309,
                     112319..112321,112325..112327,112331..112333,
                     112337..112339,112349..112351,112391..112393))
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240142"
     misc_feature    complement(order(112346..112348,112355..112357))
                     /gene="glmS1"
                     /locus_tag="NGR_b01210"
                     /note="active site"
                     /db_xref="CDD:240142"
     gene            complement(113080..113841)
                     /locus_tag="NGR_b01220"
                     /db_xref="GeneID:7789660"
     CDS             complement(113080..113841)
                     /locus_tag="NGR_b01220"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_002822342.1"
                     /db_xref="GI:227818371"
                     /db_xref="GeneID:7789660"
                     /translation="MTANVEINRNAPVLELRDIRKTFGGITAIENFSLEVYPGEIVAL
                     VGDNGAGKSTLIKIISGVHPLTSGAITIEGETVAMSNATMARAHGIEVVYQDLALADQ
                     QTVYMNMFLGREPVNRFGLLDRRRMIDETEKLVKDLDVRIPSAHATIRDLSGGQRQGV
                     AIARATHWASKLILLDEPTAALGVAETAKVEEIVQSLKQRNIGVLIISHSLDQVFKLS
                     DRICVLRRGNQIGIRETAKTDKNEIIAMITGLQQH"
     misc_feature    complement(113152..113811)
                     /locus_tag="NGR_b01220"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(113149..113802)
                     /locus_tag="NGR_b01220"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(113683..113706)
                     /locus_tag="NGR_b01220"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(113215..113217,113311..113316,
                     113557..113559,113680..113688,113692..113697))
                     /locus_tag="NGR_b01220"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(113557..113568)
                     /locus_tag="NGR_b01220"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(113359..113388)
                     /locus_tag="NGR_b01220"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(113311..113328)
                     /locus_tag="NGR_b01220"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(113293..113304)
                     /locus_tag="NGR_b01220"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(113209..113229)
                     /locus_tag="NGR_b01220"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     gene            complement(113852..115048)
                     /locus_tag="NGR_b01230"
                     /db_xref="GeneID:7789661"
     CDS             complement(113852..115048)
                     /locus_tag="NGR_b01230"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid racemase"
                     /protein_id="YP_002822343.1"
                     /db_xref="GI:227818372"
                     /db_xref="GeneID:7789661"
                     /translation="MFLDVLRRRNPAFIEAAMALHQQGKIPANAYVLDLDTVERNART
                     LSEEAHRLGLKIFAMTKQVGRSSSFCQAVKRGGIDRSVAVDMACARATHNAGLKVAHL
                     GHLQQIARHEAAAAARTFEPEFWTVFNDTKAAEAAAGAKQAGYRQDLLARIRAEGDTF
                     YRGHEGGFDANDVVAVADRLDALDGGRFAGITTFPALLFDHETRKVLPTHNLATLTKA
                     AEALARAGRRGVEVNAPGTNSSVMLASLAQAGATQCEPGNGLHGTTALHVMEDLPELP
                     AILYLTEVSHLSGGKAYCFGGGFYIDPIFPDYHVRAIVGAEPTTTAALRSVEIPPPSA
                     IDYYAMIDATGPNAPKPGDTAVFGFRGQAFVTRAYVVGVSGISKGTPKVKTIENGFGE
                     TASWPV"
     misc_feature    complement(113876..115048)
                     /locus_tag="NGR_b01230"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzymes; Region: PLPDE_III; cl00261"
                     /db_xref="CDD:260308"
     misc_feature    complement(113885..114952)
                     /locus_tag="NGR_b01230"
                     /note="Predicted amino acid racemase [Amino acid transport
                     and metabolism]; Region: COG3457"
                     /db_xref="CDD:225988"
     misc_feature    complement(order(114275..114286,114467..114469,
                     114473..114475,114593..114595,114728..114730,
                     114866..114868,114872..114874))
                     /locus_tag="NGR_b01230"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143484"
     misc_feature    complement(114866..114868)
                     /locus_tag="NGR_b01230"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:143484"
     gene            complement(115061..115360)
                     /locus_tag="NGR_b01240"
                     /db_xref="GeneID:7789662"
     CDS             complement(115061..115360)
                     /locus_tag="NGR_b01240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822344.1"
                     /db_xref="GI:227818373"
                     /db_xref="GeneID:7789662"
                     /translation="MISGGLAGLAGLLYAGRLQAAKYTLGETDLMTVIAAVIVGGTLL
                     NGGKGSIVGALVGSLMMGMLNNGLILMGLSVSDQMIVRGLIILAAVAVSLREKSR"
     misc_feature    complement(115082..>115312)
                     /locus_tag="NGR_b01240"
                     /note="Transmembrane subunit (TM) of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which are involved in the uptake of
                     branched-chain amino acids (AAs), as well as TMs of
                     transporters involved in the uptake of...; Region:
                     TM_PBP1_branched-chain-AA_like; cl00454"
                     /db_xref="CDD:260432"
     gene            115523..117187
                     /locus_tag="NGR_b01250"
                     /db_xref="GeneID:7789663"
     CDS             115523..117187
                     /locus_tag="NGR_b01250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822345.1"
                     /db_xref="GI:227818374"
                     /db_xref="GeneID:7789663"
                     /translation="MLDIERPQMKKVVLGGGVITCEDGSRPDWQGVVISGDRIERLVR
                     RDDVAGLDGYQVEDLGDATLMPGFVDVHAHAEVVCRTAFRTIDCRAPECSSVEDVSDA
                     LIAGATDLDPGEWLVGQANLFFDRKLKEGRLPTRAELDRVSRDRPIALRAGGHITVLN
                     SEALERAGIGRGFRPPEHSITGKPEVIFGDDGEPTGVIKEMDSLLPLPRPNADELRAC
                     IASGLRDFFTDFGVTTIGEISETVAGIECMNDLAESGELPTSMRVYLWSPGTLDGLDK
                     VRNWRHHIRLTTSEKDLRIQGLKLFSDGGFSAKSAAVNCCYVGHPGSSGSIAFDQYFL
                     RRAFLMTREAGLQLAVHANGDRAQDWLCDMVIKLGGTEPGRSRMRIEHAGNLLPTSET
                     AHRWARAGIIPVPQPVFLYTFGEYFPDYLGAYGRRGRFPFRSLIEQGWRLSGSSDVWI
                     GSEREATNPFFSIWCCMKRQTYSGLTIDEDEALDFDTALRMHTIDAAAVLGEEDDKGS
                     LAPGKMADVIALECDPRKKPVDEIRRLKPTYVMSRGRTEKHAAPRH"
     misc_feature    115541..117142
                     /locus_tag="NGR_b01250"
                     /note="Predicted metal-dependent hydrolase with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1574"
                     /db_xref="CDD:224490"
     misc_feature    115613..117076
                     /locus_tag="NGR_b01250"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(115736..115738,115742..115744,116573..116575,
                     116666..116668,116861..116863)
                     /locus_tag="NGR_b01250"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            117290..118366
                     /locus_tag="NGR_b01260"
                     /db_xref="GeneID:7789664"
     CDS             117290..118366
                     /locus_tag="NGR_b01260"
                     /note="periplasmic sensory protein associated with the
                     TorRS two-component regulatory system"
                     /codon_start=1
                     /transl_table=11
                     /product="TMAO reductase system periplasmic protein TorT"
                     /protein_id="YP_002822346.1"
                     /db_xref="GI:227818375"
                     /db_xref="GeneID:7789664"
                     /translation="MKLNNTLACVAAIACLFAGSALATDKSWFPVDVESWNPPFDMNS
                     ARTTVQYTPTGKPAAPLNICVSVPHMKDAYWVAVDYGVTQEAKRQSVQMTVLEAGGYT
                     NLAKQISQIEDCVASGAQAVILGAISADGLNNLIKELSSQGIPVIDFMNGVTSKDVAA
                     KSLVSFREMGAGAGTYIARKHPTGSGKVKVAWFPGPAGAGWVEAGNQGFLKAVDGSDV
                     DVVDTRYGDTGKEVQLKLVEDALQANSDLTYIVGTAPTAEAAIEVLKQRGLTDKVKVI
                     SYYITPSIYEGIVKKEILAAPSDLAVIQARIAVDQAIRILEDKDYIRHAGPKLAVVDQ
                     ENAASFDLYSSVAPADFKPVFTVE"
     misc_feature    117323..118363
                     /locus_tag="NGR_b01260"
                     /note="TMAO reductase system periplasmic protein TorT;
                     Provisional; Region: PRK10936"
                     /db_xref="CDD:236801"
     misc_feature    117476..118276
                     /locus_tag="NGR_b01260"
                     /note="TorT-like proteins, a periplasmic binding protein
                     family that activates induction of the Tor respiratory
                     system upon trimethylamine N-oxide (TMAO)
                     electron-acceptor binding in bacteria; Region:
                     PBP1_TorT-like; cd06306"
                     /db_xref="CDD:107301"
     misc_feature    order(117509..117511,117737..117739,117902..117904,
                     118124..118126,118184..118186)
                     /locus_tag="NGR_b01260"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107301"
     gene            118370..119920
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /db_xref="GeneID:7789665"
     CDS             118370..119920
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /EC_number="3.6.3.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose import ATP-binding protein rbsA"
                     /protein_id="YP_002822347.1"
                     /db_xref="GI:227818376"
                     /db_xref="GeneID:7789665"
                     /translation="MAHQLVATHDPVALAAGPPSLLTTEGLTKRYPGVTALASIDFEL
                     RHGEVHVLFGENGAGKSTLISLLAGAQQPTEGRIRMCGQEVSFQSVHDARAHGVRAVF
                     QEFSLVPQLTVEENMFLGQEFRRGPFLDKAMLRRQAREILDRLEFELRPEALVATLSR
                     ADQQMVEIAKAFTEGVSVLILDEPTASLTERETDRLFALIETAKRNGTGIVYITHRMA
                     EIRRIGDRITVLRDGRKVASLRADEANDDQLIELMTGRVIDQIYPRIAHRPERVLLEL
                     DRVTLANRLLRSVSLNVRAGEVVGVAGLVGSGKSNIGRAAFGLEKIEDGRIRFKGRDV
                     TGFSVSTMMQEGLFYVPSDRRDEGLVMMRGARENMALSALDSPSFARFGILRRSAEVK
                     RASDLAKHLKLRPMDLERGVEQFSGGNQQKVMIAKALAREIDLFIFDEPTVGVDVATR
                     TSIYELIGKLCEAGAGILLISSDLPEILNLSNRAYVMYRGELRAELSGAEITQENVLG
                     HFFERDAK"
     misc_feature    118421..119890
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    118433..119083
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    118529..118552
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(118538..118543,118547..118555,118676..118678,
                     118913..118918,119012..119014)
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    118667..118678
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    118841..118870
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    118901..118918
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    118925..118936
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    119000..119020
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    119180..119845
                     /gene="rbsA2"
                     /locus_tag="NGR_b01270"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            119917..120954
                     /locus_tag="NGR_b01280"
                     /db_xref="GeneID:7789666"
     CDS             119917..120954
                     /locus_tag="NGR_b01280"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822348.1"
                     /db_xref="GI:227818377"
                     /db_xref="GeneID:7789666"
                     /translation="MTSIELTHLDRRTTATAAREVMKRLFVGLGVLPFLMLAAMITFS
                     LMSDNFLTSRNLINVARQSSYLTIVSLGQMLALISGGIDLSVGTTLAVTSVVSAMAMV
                     ASLAAMPDMVGLAILIGVFAGLAAGVAMGAINGLGISLFGVNPFMMTLGMSSVGFGLA
                     LYLTSGIPVQGMPEAFGAILGFGTLFGVPVPIYATAVLIALVYLLLNWTRLGRYIYAV
                     GGNIKASRLSGIEPKRTLFKTYVLCSALTTIAGLMLTARLATGEANIGGSMPLESIAA
                     CVIGGVSLSGGSGRVGGVVLGAVFIGLVQNGMNLAHVDSYLQIVAIGAILILAVIADR
                     VRLRLASEMTN"
     misc_feature    120103..120915
                     /locus_tag="NGR_b01280"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    120583..120639
                     /locus_tag="NGR_b01280"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            121054..122178
                     /locus_tag="NGR_b01290"
                     /db_xref="GeneID:7789667"
     CDS             121054..122178
                     /locus_tag="NGR_b01290"
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="YP_002822349.1"
                     /db_xref="GI:227818378"
                     /db_xref="GeneID:7789667"
                     /translation="MTINGRHAEIAGAGIAGLTTAAALAQKGWSVRVHERGEELREIG
                     AGIFMWENALRVLEAIGAYDEAIDGGERNQYWEIRDERERLLQSGWMMQGTRLYTILR
                     SQLHKALANAATRAGVEIVVNSRVSGATEDGQLLLENGQKLKADLIVGADGVNSAVRN
                     SLGLAKRVVDLQDGCGRYLIPRIPEDAAGRSLEYWNGGRRVGVVPASRDTVYLYVCCP
                     ASDHVGRLSPPDRKSWTKSFPALASYIDRLTDNGRWASFSDVTCHSWRKGNVAILGDA
                     AHAMSPNLGQGAGVSMQTGFVLADELSRTPEIRAALASWEARQRPVVDATQKFSRLYG
                     RVGTRWPRPLLDLRSAFVWGVGKSTRIQRRVNVAAHSDVT"
     misc_feature    121081..122142
                     /locus_tag="NGR_b01290"
                     /note="2-polyprenyl-6-methoxyphenol hydroxylase and
                     related FAD-dependent oxidoreductases [Coenzyme metabolism
                     / Energy production and conversion]; Region: UbiH;
                     COG0654"
                     /db_xref="CDD:223727"
     misc_feature    121081..122103
                     /locus_tag="NGR_b01290"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            122240..123277
                     /locus_tag="NGR_b01300"
                     /db_xref="GeneID:7789668"
     CDS             122240..123277
                     /locus_tag="NGR_b01300"
                     /codon_start=1
                     /transl_table=11
                     /product="HTH-type transcriptional regulator"
                     /protein_id="YP_002822350.1"
                     /db_xref="GI:227818379"
                     /db_xref="GeneID:7789668"
                     /translation="MPPLRCVSMRSGMSAIKRSPQTRHASLLRAGSGCEISTSDIELI
                     RLLQADGRISFVDLAEKLGLTEKTVRRRVGELRALELIEITTVASPRAIGYSSVALVG
                     IRIVGGSNRLDIAEQLFELNAVDYAVTTFGAYDILVELVCRDNRELGDLLDGAIRGMD
                     GVREIDIFPYLSLHYQQPAWDRTQVKEGGSRFSSNIVLDKVDREIVRCLSQDGRMPFL
                     EISRHIGISESQIRKRYARLLEQGAVQVLAMTNPRSIGYRTIAWVCLTVASGASITAV
                     GDQVSALPSVAYIALCAGKFDIMAEVMCRDPDDLFELLDKRIKSLPGISSVQTILCED
                     FLYRRITPIEE"
     misc_feature    122354..>122488
                     /locus_tag="NGR_b01300"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(122354..122359,122399..122407,122432..122443,
                     122447..122452,122459..122464,122468..122473)
                     /locus_tag="NGR_b01300"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    122357..122755
                     /locus_tag="NGR_b01300"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     misc_feature    order(122399..122401,122408..122410)
                     /locus_tag="NGR_b01300"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    122540..122755
                     /locus_tag="NGR_b01300"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     misc_feature    122831..123265
                     /locus_tag="NGR_b01300"
                     /note="DNA-binding transcriptional regulator AsnC;
                     Provisional; Region: PRK11179"
                     /db_xref="CDD:183019"
     misc_feature    122831..123151
                     /locus_tag="NGR_b01300"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     gene            123277..123789
                     /locus_tag="NGR_b01310"
                     /pseudo
                     /db_xref="GeneID:7789669"
     gene            complement(123959..126235)
                     /locus_tag="NGR_b01320"
                     /db_xref="GeneID:7789670"
     CDS             complement(123959..126235)
                     /locus_tag="NGR_b01320"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_002822351.1"
                     /db_xref="GI:227818380"
                     /db_xref="GeneID:7789670"
                     /translation="MTETMENRSSENGLVGQSIARIDGPLKVTGRATYAYEHAVNGAA
                     YGYILGAAIAKGRIVEIDSRKAEQAPGVLHVMTHRNAPAQPEFGPAVTPTVPEVFSRA
                     RPMLNSDRVRFHDEPVALVLAETFEAARAAAALIDVRYEEERGAFDLPARLADAYAPR
                     RTNAGFETDSAVGDFDRAFAAASVTVDATYRTPYEHHNPMEPHATLAVWSGDEVTVYT
                     SAQTLANFQAGLASTLSIPREHVRTVSPFIGGGFGSKLIVHADTVLAALAARVLRRPV
                     KVALTRQQMFANAGHRAEMVQRVRLGAERDGRLTSIGHVVWSATSGFEEFCEQTAVFG
                     RSLYAAPNRLTRHQLVPVDLNRGEWMRSPGEAPGMLAFESAMDELAEKLGLDPIELRI
                     RNEPTADPEQGVPFSTRNLVACMQEGARRFGWERRNPAPGRIREDRKLIGYGMAAAIR
                     PNYIGAGTARVAIDANGRVTAQLDMTDIGTGTYTILAQIAAESLGVPVAAVKVELGDS
                     RFPRTAGSGGSWGAASAGSALHHACNALRERIMAASRTSDRSPLRGANDVAPSFADGK
                     VRVGNRSVSLTDLIARIAPDGIAATGSVAAARDTESYRAYSQHSYGAHFAEVAVDGDT
                     GEIRMRRMLSVIGAGRILNARTARSQILGGMTWGIGAALMEEAVLDPRSGHFVNHDLA
                     EYHVPVNGDVAEMEVVFLEEFDDKANPLGAKGLGELGVCGSGAAIANAVYNATGVRVR
                     EFPITLDRLLPGLPLTAI"
     misc_feature    complement(123974..126196)
                     /locus_tag="NGR_b01320"
                     /note="Aerobic-type carbon monoxide dehydrogenase, large
                     subunit CoxL/CutL homologs [Energy production and
                     conversion]; Region: CoxL; COG1529"
                     /db_xref="CDD:224446"
     misc_feature    complement(125807..126151)
                     /locus_tag="NGR_b01320"
                     /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
                     hammerhead domain; Region: Ald_Xan_dh_C; smart01008"
                     /db_xref="CDD:214971"
     misc_feature    complement(124160..125749)
                     /locus_tag="NGR_b01320"
                     /note="Molybdopterin-binding domain of aldehyde
                     dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
                     /db_xref="CDD:251506"
     misc_feature    complement(126245..127142)
                     /note="potential frameshift: common BLAST hit:
                     gi|150376868|ref|YP_001313464.1| molybdopterin
                     dehydrogenase FAD-binding"
     gene            complement(126245..126850)
                     /locus_tag="NGR_b01330"
                     /db_xref="GeneID:7789671"
     CDS             complement(126245..126850)
                     /locus_tag="NGR_b01330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822352.1"
                     /db_xref="GI:227818381"
                     /db_xref="GeneID:7789671"
                     /translation="MPCNKRAPGSGCAALQGFNRMHAVLGASETCIAVHPSDMAVAMA
                     ALDAQIETTLPDGTTRTIAIGDLRRLPSATPHVETALGHGEMITAVTLPPPPPGRQLY
                     RKVRDRASYAFVLVSVATVVETSGDRIRSARIAIGGVAPKPWRPREAEYVLAGAAAAD
                     AAFSGAETALAGAVGRGGNDFKIPLAKRTLRQTLAAAAEGA"
     misc_feature    complement(126566..>126760)
                     /locus_tag="NGR_b01330"
                     /note="FAD binding domain; Region: FAD_binding_4; cl19922"
                     /db_xref="CDD:268275"
     misc_feature    complement(126260..126547)
                     /locus_tag="NGR_b01330"
                     /note="CO dehydrogenase flavoprotein C-terminal domain;
                     Region: CO_deh_flav_C; smart01092"
                     /db_xref="CDD:215021"
     gene            complement(126858..127142)
                     /locus_tag="NGR_b01340"
                     /db_xref="GeneID:7789672"
     CDS             complement(126858..127142)
                     /locus_tag="NGR_b01340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822353.1"
                     /db_xref="GI:227818382"
                     /db_xref="GeneID:7789672"
                     /translation="MQPFTYVRPGNVNEAAAAVAAVPEAMFISGGTNLLDLMKLEIER
                     PTHLVDISRLPLDRIEETPEGGLRIGAQVRNGDLAADPRVRSRYPLPLFL"
     misc_feature    complement(<126873..127067)
                     /locus_tag="NGR_b01340"
                     /note="FAD binding domain; Region: FAD_binding_4; cl19922"
                     /db_xref="CDD:268275"
     misc_feature    complement(127147..127801)
                     /note="potential frameshift: common BLAST hit:
                     gi|16264661|ref|NP_437453.1| iron-sulfur-binding protein"
     gene            complement(127147..127500)
                     /gene="yagT"
                     /locus_tag="NGR_b01350"
                     /db_xref="GeneID:7789673"
     CDS             complement(127147..127500)
                     /gene="yagT"
                     /locus_tag="NGR_b01350"
                     /EC_number="1.1.1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="xanthine dehydrogenase"
                     /protein_id="YP_002822354.1"
                     /db_xref="GI:227818383"
                     /db_xref="GeneID:7789673"
                     /translation="MNGRRINSCLSLAAQHEGDEITTIEGLADGDRLHPVQAAFVAHD
                     GFQCGYCTPGQICSAVGMLKEIRAGWPSHASSDVAGPAALTEAEIRERMSGNFCRCAA
                     YPNIVAAIRDASEEA"
     misc_feature    complement(127165..127434)
                     /gene="yagT"
                     /locus_tag="NGR_b01350"
                     /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
                     /db_xref="CDD:250876"
     gene            complement(127532..127801)
                     /locus_tag="NGR_b01360"
                     /db_xref="GeneID:7789674"
     CDS             complement(127532..127801)
                     /locus_tag="NGR_b01360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822355.1"
                     /db_xref="GI:227818384"
                     /db_xref="GeneID:7789674"
                     /translation="MAVTDYRITRRAVLESGAATCLVLASGLPAGAAVTGGPMTAGPV
                     APPIPRTPMRFRINATEHALELDPRTTLLDALRNHLGLTGSKKRL"
     misc_feature    complement(<127670..127780)
                     /locus_tag="NGR_b01360"
                     /note="PsbP; Region: PsbP; cl03356"
                     /db_xref="CDD:261702"
     misc_feature    complement(127935..128818)
                     /note="potential frameshift: common BLAST hit:
                     gi|150376866|ref|YP_001313462.1| helix-turn-helix
                     domain-containing protein"
     gene            complement(127935..128120)
                     /locus_tag="NGR_b01370"
                     /db_xref="GeneID:7789675"
     CDS             complement(127935..128120)
                     /locus_tag="NGR_b01370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822356.1"
                     /db_xref="GI:227818385"
                     /db_xref="GeneID:7789675"
                     /translation="MPISSRNAWGGAELLLRETDLAIGAIAFRLGFSSQSRFTTTFRR
                     LKGITPRAYRLQFSPES"
     misc_feature    complement(127956..128069)
                     /locus_tag="NGR_b01370"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            complement(128228..128818)
                     /locus_tag="NGR_b01380"
                     /db_xref="GeneID:7789676"
     CDS             complement(128228..128818)
                     /locus_tag="NGR_b01380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822357.1"
                     /db_xref="GI:227818386"
                     /db_xref="GeneID:7789676"
                     /translation="MSFKPLLGDGRIRTREEESAPLQTASWIDSSVMFDSRRWACQEA
                     ELHWTAPHHLIVLTDGGSTSRTSSRTERKIIYDGQDRPGILTFVPAGAERIGFYRDVD
                     LSYSALWIDPDLALPGLERLRDIPILVNESDAVIGTLLRSLCTEMLFGHRPDTVYVEH
                     LVSLVGLRTAGLGAATSGRERRPPWPSHVRARPQLH"
     gene            complement(129408..130121)
                     /locus_tag="NGR_b01390"
                     /db_xref="GeneID:7789677"
     CDS             complement(129408..130121)
                     /locus_tag="NGR_b01390"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_002822358.1"
                     /db_xref="GI:227818387"
                     /db_xref="GeneID:7789677"
                     /translation="MNDFTGKNVLVLGGSRGIGAAIVRRFAKAGGNVAFTYAGSKDAA
                     ETLAAETGAEAIQADSANRDRLISTVADRGALDVIVINAGTLVMGDPLTLNSDDIDRM
                     IDVNVRAPYHASVEAARQMNDDGRIIVIGSVNGDRMPFAGGAAYALTKSAMQGMVRGL
                     ARDFGGRGITVNSIQPGPTDSDMNPAGGPMADTMHGFMAIKRHARGDEIAELTAYLAG
                     PHGAMITGSMQTIDGGFGA"
     misc_feature    complement(129411..130121)
                     /locus_tag="NGR_b01390"
                     /note="oxidoreductase; Provisional; Region: PRK12742"
                     /db_xref="CDD:183714"
     misc_feature    complement(129426..130097)
                     /locus_tag="NGR_b01390"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(129576..129581,129585..129596,
                     129672..129674,129684..129686,129726..129734,
                     129807..129809,129870..129878,129942..129950,
                     130005..130013,130068..130079,130083..130085))
                     /locus_tag="NGR_b01390"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(129672..129674,129684..129686,
                     129726..129728,129804..129806))
                     /locus_tag="NGR_b01390"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            130354..131259
                     /locus_tag="NGR_b01400"
                     /db_xref="GeneID:7789678"
     CDS             130354..131259
                     /locus_tag="NGR_b01400"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_002822359.1"
                     /db_xref="GI:227818388"
                     /db_xref="GeneID:7789678"
                     /translation="MIKFDGIAAFVATAEAGSISAASRRLGLAKSVVSERLAELERIL
                     GTKLIQRTTRKLSLTENGQTFLPRAQRILREADEAAAELAARSGKLAGPLRLSAPVSF
                     GILHLAPALTKFIQEHPQIEVSVELDDRFVDAAAGGFDAVLRHGAIGDSRLIARRLAT
                     SRRLLVASPAYLEREGHPASIDELQHHCGILYSMREGDWRFSTEHGWQVVRPKAALRA
                     NNGLVMREAAMAGLGITLLPTFFIHEAVKSGVLVPIDVGARAEGAELFITYPRDHGAS
                     AKIRALADSLQRSFGNPPYWDRLAS"
     misc_feature    130357..131241
                     /locus_tag="NGR_b01400"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    130363..130542
                     /locus_tag="NGR_b01400"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    130627..131211
                     /locus_tag="NGR_b01400"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    order(130657..130659,130669..130671,130786..130788,
                     130828..130830,130834..130836,131014..131016,
                     131065..131067,131146..131148)
                     /locus_tag="NGR_b01400"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    order(130660..130665,130675..130680,130684..130689,
                     130696..130698,130708..130710,130714..130734,
                     130915..130917,130996..131010,131029..131034,
                     131041..131043)
                     /locus_tag="NGR_b01400"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            131548..133332
                     /locus_tag="NGR_b01410"
                     /db_xref="GeneID:7789679"
     CDS             131548..133332
                     /locus_tag="NGR_b01410"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate class-3/4/guanylyl cyclase"
                     /protein_id="YP_002822360.1"
                     /db_xref="GI:227818389"
                     /db_xref="GeneID:7789679"
                     /translation="MGENRKLAAILAADVVGYSRLASADEDRILARLRALRSDLIDPT
                     IAVHNGRVIKRTGDGALVEFRSVVDAVRCAVEVQNAMVERNAGVPHDRRIEFRIGIHL
                     GDVVEESDGDLMGDGVNIASRLEGVAAPGAICMSEDAYRQVKARLDLSVTDLGSTQLK
                     NIVEPIRIYSLQVGAAAPSKSTAVTYAAAGRAPAASPPALSIAVLPFANMSGDAEQEY
                     FADGISEDIITALSKLSQLFVIARNSSFTFKGRNVNVQEVGRGLGVRYVLEGSVRKSG
                     SRVRITAQLIDATSGGHLWAERFDRDLTDIFAVQDDVTQQIVDALALNLREGDQQRLA
                     AEQTESLEAYDCFLRGREHMWRLTREQNTQARELLQRAIELDAKFVPAYAFLAVTHGL
                     AYINQWSQSPSKSRELAIEAATRAVALDDQYPYAHWALGVVKLHLRQHDVAIAEAERV
                     IALAPNLVEGYENLGNALHYAGRSAEALAYFERAMALNPYYPDLFLHFYAQAMFQLGR
                     YEEAVVILKRRLVRNPDTDVSRVLLAASYGHLGRFEEARGEWVEVFRINPDYSLEHRR
                     KVLPYKNPADFERIVDGLRKAGLTDCRL"
     misc_feature    131548..132102
                     /locus_tag="NGR_b01410"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    131569..132060
                     /locus_tag="NGR_b01410"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    order(131581..131583,131587..131604,131707..131709,
                     131713..131721,131728..131730,131881..131889,
                     131899..131904,131911..131916,132025..132027)
                     /locus_tag="NGR_b01410"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    order(131587..131589,131719..131721)
                     /locus_tag="NGR_b01410"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    order(131602..131604,131635..131637,131644..131649,
                     131656..131658,131671..131673,131707..131712,
                     131863..131865,131884..131895,131902..131904,
                     132025..132027)
                     /locus_tag="NGR_b01410"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     misc_feature    132148..132528
                     /locus_tag="NGR_b01410"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5616"
                     /db_xref="CDD:227903"
     misc_feature    132697..132912
                     /locus_tag="NGR_b01410"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    132766..133014
                     /locus_tag="NGR_b01410"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(132772..132774,132784..132786,132793..132795,
                     132838..132840,132874..132876,132886..132888,
                     132895..132897,132940..132942,132976..132978,
                     132988..132990,132997..132999)
                     /locus_tag="NGR_b01410"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(132829..132834,132838..132843,132850..132855,
                     132931..132936,132943..132948,132955..132960)
                     /locus_tag="NGR_b01410"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    132922..133224
                     /locus_tag="NGR_b01410"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(132922..132927,132931..132936,132943..132948,
                     133033..133038,133045..133050,133057..133062,
                     133138..133143,133150..133155,133162..133167)
                     /locus_tag="NGR_b01410"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(132940..132942,132976..132978,132988..132990,
                     132997..132999,133045..133047,133081..133083,
                     133093..133095,133102..133104,133147..133149,
                     133183..133185,133195..133197,133204..133206)
                     /locus_tag="NGR_b01410"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    132958..133152
                     /locus_tag="NGR_b01410"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     gene            133490..133645
                     /locus_tag="NGR_b01420"
                     /db_xref="GeneID:7789680"
     CDS             133490..133645
                     /locus_tag="NGR_b01420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822361.1"
                     /db_xref="GI:227818390"
                     /db_xref="GeneID:7789680"
                     /translation="MALKRKAAVFIRPVLVAETEYRAWTQDGKLRHPSFKGIRERVDD
                     ATIFAMP"
     misc_feature    <133493..133609
                     /locus_tag="NGR_b01420"
                     /note="The Oligonucleotide/oligosaccharide binding
                     (OB)-fold domain is a DNA-binding module that is part of
                     the catalytic core unit of ATP dependent DNA ligases;
                     Region: OBF_DNA_ligase_family; cl08424"
                     /db_xref="CDD:263645"
     gene            133718..133900
                     /locus_tag="NGR_b01430"
                     /db_xref="GeneID:7789681"
     CDS             133718..133900
                     /locus_tag="NGR_b01430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822362.1"
                     /db_xref="GI:227818391"
                     /db_xref="GeneID:7789681"
                     /translation="MEASAGGLNRGDPTADRDDNVYIADLWGAAWGIGGRPAQTEQLA
                     GGSRSRFPLRLSAAPC"
     gene            complement(133980..134198)
                     /locus_tag="NGR_b01440"
                     /db_xref="GeneID:7789682"
     CDS             complement(133980..134198)
                     /locus_tag="NGR_b01440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822363.1"
                     /db_xref="GI:227818392"
                     /db_xref="GeneID:7789682"
                     /translation="MHTVDAHGGFPPSSAATAVPLWRFIPSNSRAAVFPAALFSSALI
                     LMGGSMRPAVHFGNAQGGRRTLVRHQQG"
     gene            complement(134349..136811)
                     /locus_tag="NGR_b01450"
                     /db_xref="GeneID:7789683"
     CDS             complement(134349..136811)
                     /locus_tag="NGR_b01450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822364.1"
                     /db_xref="GI:227818393"
                     /db_xref="GeneID:7789683"
                     /translation="MTVGADFEAILNAIPVPIIVKDEQFRFSFLNEAACALVGRRPGD
                     LIGCTDYDIHPTAEADRIREMDKRVLCTGEEVSIEAEIVVTGGELRTLLTRTCRAELT
                     RGNTSENVIVATILDFTERRRAESELHASEEHYRSLVELHPQVPWTADPSGQVLEIGP
                     RWENTGFAPNEALGEGWAKATHPDDLDPVQQAWAKSLETGEPLDIEFRLAAAEGGYSW
                     YRSRAATRRAEDGSILRWYGTVENIDDRRKALEAAKESEARFRAIADDAPVMIWVTGE
                     DGADDYHSRLWLETTGQTAEQAAGKGWLNAVHPEDRNAVERAFYQAFERRKSVRMEYR
                     LKRAGGGSAWVIDIGQPRFATDGKFLGFVGIALDITERRNAEQERLLAQKQIHHMARH
                     DALTGLPNRQFLREEFERLSDQIAAGTRIAILCLDLDGFKAVNDAYGRATGDLLLRRV
                     AERLQNCLRQSDILCRLGGDEFVVLRVGINSNAEARLLAQQLIDVIEAPYELAGTHVD
                     LGVIVGLAAAPKGDQPVDELIKAADVALDRAKSGGRGTYVQYEPEMDAHLQAVQQMRV
                     SLRQALANGDLEVHYQPLVDLHTGKITTFEALARWPHPERDQVSPAEFIPVAEETGLI
                     GSLGEWILRQACTEALKWPPHVSVAVNLSPLQFRNQGLAATVGDILEETGLEASRLQL
                     EITESVLLDDCDGNLQILKAIRRLGVKIAIDDFGTGFSSLGYLRTFPFDKIKVDRSFI
                     TDLPDGRESLAIVRAVAAIGRSLGIVTTVEGVERQRQFDVIKAEGFDEAQGYLIARPL
                     PAEQATKLAHSAHVETSTTERG"
     misc_feature    complement(136443..136781)
                     /locus_tag="NGR_b01450"
                     /note="PAS fold; Region: PAS_4; pfam08448"
                     /db_xref="CDD:254806"
     misc_feature    complement(136461..136772)
                     /locus_tag="NGR_b01450"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(136551..136553,136566..136568,
                     136644..136655,136692..136694,136710..136712,
                     136722..136724))
                     /locus_tag="NGR_b01450"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(136518..136520,136530..136532,
                     136614..136619,136626..136628,136650..136652,
                     136662..136664))
                     /locus_tag="NGR_b01450"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(136083..136373)
                     /locus_tag="NGR_b01450"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(136092..136349)
                     /locus_tag="NGR_b01450"
                     /note="PAS fold; Region: PAS_3; pfam08447"
                     /db_xref="CDD:254805"
     misc_feature    complement(order(136170..136172,136185..136187,
                     136263..136274,136311..136313,136326..136328,
                     136338..136340))
                     /locus_tag="NGR_b01450"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(136143..136145,136149..136151,
                     136233..136238,136245..136247,136269..136271,
                     136281..136283))
                     /locus_tag="NGR_b01450"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(135678..136046)
                     /locus_tag="NGR_b01450"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    complement(135705..136013)
                     /locus_tag="NGR_b01450"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(135792..135794,135807..135809,
                     135885..135896,135933..135935,135951..135953,
                     135963..135965))
                     /locus_tag="NGR_b01450"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(135765..135767,135771..135773,
                     135855..135860,135867..135869,135891..135893,
                     135903..135905))
                     /locus_tag="NGR_b01450"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    complement(135168..135641)
                     /locus_tag="NGR_b01450"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(135402..135404,135531..135533))
                     /locus_tag="NGR_b01450"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(135399..135410,135414..135416,
                     135480..135482,135492..135494,135504..135509,
                     135516..135518))
                     /locus_tag="NGR_b01450"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(135339..135341,135426..135428))
                     /locus_tag="NGR_b01450"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    complement(134406..135110)
                     /locus_tag="NGR_b01450"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            137048..137311
                     /locus_tag="NGR_b01460"
                     /db_xref="GeneID:7789684"
     CDS             137048..137311
                     /locus_tag="NGR_b01460"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822365.1"
                     /db_xref="GI:227818394"
                     /db_xref="GeneID:7789684"
                     /translation="MTHGFRSRHGKVLKGASADEGGFVNCVFRSVRTCRSRITKMTGR
                     VQCSTGSPSGLLKVERYENTVEIPCPTDVAAAIDESAGEFDQA"
     gene            137229..137831
                     /locus_tag="NGR_b01470"
                     /db_xref="GeneID:7789685"
     CDS             137229..137831
                     /locus_tag="NGR_b01470"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822366.1"
                     /db_xref="GI:227818395"
                     /db_xref="GeneID:7789685"
                     /translation="MKTPWKFLAQLTSRRPSTKAQESSIRRDTDPKAHESDEKHRSAL
                     RLSLKVAASPPAHEDDVPVDQVSVVSDQAQGEGDVAQALRSPIDAEKAQATTGSEADT
                     SGGEANCLAPKSVAGTKSQSKPRIKRRERRNRANPQAAAQSAVAPKHQRLQPLSSRDL
                     FFREATTLDEDIKMLRIQLAQKLHLQNGQLTKMLERFDVP"
     gene            complement(137988..138140)
                     /locus_tag="NGR_b01480"
                     /db_xref="GeneID:7789686"
     CDS             complement(137988..138140)
                     /locus_tag="NGR_b01480"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822367.1"
                     /db_xref="GI:227818396"
                     /db_xref="GeneID:7789686"
                     /translation="MIGRAFQDELQRRALSRQTEEAEALAAKLINACQAGVRDDLGLS
                     IVAGLS"
     gene            complement(138298..138528)
                     /locus_tag="NGR_b01490"
                     /db_xref="GeneID:7789687"
     CDS             complement(138298..138528)
                     /locus_tag="NGR_b01490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822368.1"
                     /db_xref="GI:227818397"
                     /db_xref="GeneID:7789687"
                     /translation="MKIGSTSRSFSGSILASVSGCKGVAMTYDWDGKRTRRLQMLTSV
                     GALAIAALLFGSAMAALQSTDTDGPAVRTALR"
     gene            138809..139285
                     /locus_tag="NGR_b01500"
                     /db_xref="GeneID:7789688"
     CDS             138809..139285
                     /locus_tag="NGR_b01500"
                     /codon_start=1
                     /transl_table=11
                     /product="SyrB-like regulator"
                     /protein_id="YP_002822369.1"
                     /db_xref="GI:227818398"
                     /db_xref="GeneID:7789688"
                     /translation="MADESNAGPVAADVAADAEVKAPAAKKQRSPRSQKAASEPAQSK
                     TPAAKRRGYSEQEKKEKLKLIETQVSGGSTLKDAIKGAGISEQTYYQWKGAAKPAEPK
                     AAKSESKDTKSTKPLPAGDELADLVQLEEENQRLRKLLAEKLRKENTELRKRLGLD"
     misc_feature    138953..139234
                     /locus_tag="NGR_b01500"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    <139169..>139279
                     /locus_tag="NGR_b01500"
                     /note="rod shape-determining protein MreC; Region: MreC;
                     cl19252"
                     /db_xref="CDD:267605"
     gene            139541..140152
                     /locus_tag="NGR_b01510"
                     /db_xref="GeneID:7789689"
     CDS             139541..140152
                     /locus_tag="NGR_b01510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822370.1"
                     /db_xref="GI:227818399"
                     /db_xref="GeneID:7789689"
                     /translation="MKTPQRRFVVEFKSGRRQPKAQTKSIWGDTDLKALARDVEETAS
                     HLFNSDEALGTPDSVEPRLADPVDAEPVNGLADDAGVALAAIPIADGAEVEISKHHGA
                     DHPAEAVVQGREIQPTAQPRTTGTETPRRRAKRAPAQTIAQNSKPGHKDRDAQIGSVD
                     NPVSRDELAALDADNKRLKRLLAERLREQNLWLNKKLERFNAD"
     gene            complement(140279..140518)
                     /locus_tag="NGR_b01520"
                     /db_xref="GeneID:7789690"
     CDS             complement(140279..140518)
                     /locus_tag="NGR_b01520"
                     /codon_start=1
                     /transl_table=11
                     /product="ExsI family transcriptional regulator"
                     /protein_id="YP_002822371.1"
                     /db_xref="GI:227818400"
                     /db_xref="GeneID:7789690"
                     /translation="MTNAMNNLDVATGRGRVDIGGAVKQSREAMGYSVEDLSLTCGLT
                     GAEITRIELGTDVDPDRLRRIAAALQVSTSTFHLV"
     misc_feature    complement(<140291..140467)
                     /locus_tag="NGR_b01520"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(140291..140461)
                     /locus_tag="NGR_b01520"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(140360..140362,140435..140437,
                     140447..140449))
                     /locus_tag="NGR_b01520"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(140363..140365,140438..140440))
                     /locus_tag="NGR_b01520"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(140357..140362,140372..140374,
                     140381..140383,140414..140419))
                     /locus_tag="NGR_b01520"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            141075..141893
                     /locus_tag="NGR_b01530"
                     /db_xref="GeneID:7789691"
     CDS             141075..141893
                     /locus_tag="NGR_b01530"
                     /codon_start=1
                     /transl_table=11
                     /product="Trm23a-like transposase, amino-terminus"
                     /protein_id="YP_002822372.1"
                     /db_xref="GI:227818401"
                     /db_xref="GeneID:7789691"
                     /translation="MPAERLKMRRVREILRYRFEEGLGHKSIAVRVGAAPSTVRETLR
                     RLERARLSWPLGDDVSDAVLEAALYKAAGTKTGHRRSVEPDWAHVHRELKRKHVTLQI
                     LWDEYIGLHPDGYRYSRYCDLYRAWALKLPVTLRQDHAAGEKLFVDYAGDTVTVVIDR
                     LSGKTRQAHLFVAVLGASSLSFAHARWSETLPDWIECHLLALEAFGGAPALLVPDNAK
                     VAVIKACHFDPQVNRTYAGMAAHYGSAVLPTRPRRPRDKERTSRCTLLEWLSDN"
     misc_feature    <141099..141224
                     /locus_tag="NGR_b01530"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     misc_feature    order(141126..141128,141144..141149,141177..141179,
                     141183..141188,141192..141194,141204..141209,
                     141213..141218,141222..141224)
                     /locus_tag="NGR_b01530"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     misc_feature    141165..141872
                     /locus_tag="NGR_b01530"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    141483..141881
                     /locus_tag="NGR_b01530"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(141855..143939)
                     /locus_tag="NGR_b01540"
                     /db_xref="GeneID:7789692"
     CDS             complement(141855..143939)
                     /locus_tag="NGR_b01540"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 4 for insertion sequence
                     NGRIS-4e"
                     /protein_id="YP_002822373.1"
                     /db_xref="GI:227818402"
                     /db_xref="GeneID:7789692"
                     /translation="MSTDIAIKVDADHLRRDAFLYVRQSSLRQVFENTESTKRQYALR
                     DRAVALGWPIERVHVIDSDLGLSGAQSQDRDGFQHLVSEVAMGHAGIVLGLEVSRLAR
                     NNADWHRLLELAALSRTLIMDEDGVYDPAYFNDRMLLGLKGTMSEAELHILKSRLQGG
                     ILNKARRGELEMPLPIGLVYTPDARVVLDPDRQIQDTVRLLFDTFRQTGSACAVVRRL
                     RGEKILFPRRIRRGIGKGDVLWNEIDHSRVLQILHNPRYAGAFAYGRTRTAYNAKLKP
                     VQLRVARSDWQVLIPDAHDGYISWAEYERNQAALEQNATGFSPGLRGRMPRQGSGLLQ
                     GRLLCGRCGARMRVHYEPFEGRLRPYYVCNEAVVRHAGKHCQWVRGAPVDEAVSALLL
                     EVMAPAAIDVALAVQQEITQRVEQAAALRGTQLQRARYEAELARRRYLKVDPDNRLVA
                     DALEADWNARLRDLDALQREHERQNEADHSLLDEPAQQRIRALTADFPRIWNDERTGA
                     VERKRMLGLLIEDVTLLVDDEVNINIRWRGGRTQSLSVARPRPMSVIRKTPAQVVALI
                     NELLEATNDRQIAARLNELGHRNWRGEPFTPKKVMLVRRTYGLKSRYERLREGGMLTG
                     EEVAQQLGVCESTVHQLGRKGTLKRHRYASNHRYLYEPPGNVRLEKGAGSRYGGRQPR
                     LIVAQPLQQGAS"
     misc_feature    complement(143181..143894)
                     /locus_tag="NGR_b01540"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(143460..143882)
                     /locus_tag="NGR_b01540"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    complement(order(143634..143636,143643..143648,
                     143865..143867,143871..143873))
                     /locus_tag="NGR_b01540"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    complement(143865..143867)
                     /locus_tag="NGR_b01540"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     misc_feature    complement(143001..143351)
                     /locus_tag="NGR_b01540"
                     /note="Recombinase; Region: Recombinase; pfam07508"
                     /db_xref="CDD:254248"
     misc_feature    complement(142764..142946)
                     /locus_tag="NGR_b01540"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; pfam13408"
                     /db_xref="CDD:257733"
     gene            complement(144215..144664)
                     /locus_tag="NGR_b01550"
                     /db_xref="GeneID:7789693"
     CDS             complement(144215..144664)
                     /locus_tag="NGR_b01550"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 2 for insertion sequence
                     NGRIS-4e"
                     /protein_id="YP_002822374.1"
                     /db_xref="GI:227818403"
                     /db_xref="GeneID:7789693"
                     /translation="MPNETKRERLRELGALNARPEAVRAPWFRESTFFDPLDLVQVKY
                     EMLRHVQEDGVNKADAAALFGLSRPTYYQAEAAFERDGIAGLLPRTRGPKSAHKLTDE
                     VMQLIEQNQHAGAPLQARSLAELLHSTLGISVHPRSIERAIARKKKR"
     misc_feature    complement(144383..144538)
                     /locus_tag="NGR_b01550"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    complement(144230..144532)
                     /locus_tag="NGR_b01550"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    complement(144236..144457)
                     /locus_tag="NGR_b01550"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     gene            complement(144855..145124)
                     /locus_tag="NGR_b01560"
                     /db_xref="GeneID:7789694"
     CDS             complement(144855..145124)
                     /locus_tag="NGR_b01560"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase number 1 for insertion sequence
                     NGRIS-4e"
                     /protein_id="YP_002822375.1"
                     /db_xref="GI:227818404"
                     /db_xref="GeneID:7789694"
                     /translation="MRIEFEVTHPFHPWRGQRFVLSTRKQNWGEDRVMFYDADGRLRS
                     LLASWTDVAAPDVFIQIAAGRSFVRPDDLATLAALIEQIERSHGG"
     gene            145271..145945
                     /locus_tag="NGR_b01570"
                     /db_xref="GeneID:7789695"
     CDS             145271..145945
                     /locus_tag="NGR_b01570"
                     /codon_start=1
                     /transl_table=11
                     /product="Trm23a-like transposase, carboxy-terminus"
                     /protein_id="YP_002822376.1"
                     /db_xref="GI:227818405"
                     /db_xref="GeneID:7789695"
                     /translation="MLVDLNDTRVLRRVGRTRRQLFEEIDHPALRPLPAERYVFAEWR
                     IRRAGLDYHVDIDKHYYSVPYRFAREQVEARITANTIEIFHKGERIAAHRRSSGNGKH
                     TTTPEHMPSSHRRFADWTIERISREASAIGSDVALLCERILADRPHPEQGYRACLGII
                     RLVKAFERERVNAACGRALEIGARTYGSVRSILDNNLDRSPASAGTASPEPIHHSNIR
                     GPRYYH"
     misc_feature    <145301..145942
                     /locus_tag="NGR_b01570"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     gene            145957..146694
                     /locus_tag="NGR_b01580"
                     /db_xref="GeneID:7789696"
     CDS             145957..146694
                     /locus_tag="NGR_b01580"
                     /note="y4pL-like"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein of disrupted insertion
                     sequence"
                     /protein_id="YP_002822377.1"
                     /db_xref="GI:227818406"
                     /db_xref="GeneID:7789696"
                     /translation="MLAHPTLDKLNAMGLTGMAKAFNELISNGESEQLSHAEWLGLLL
                     EREWSWRYDRKLAARLRFAKLRHQAVPEDVDYRSERGLDRALFMKLIGGDWIDAHDNL
                     AICGPSGVGKSWLACALGHKACRDDRSVLYQRVPRLFANLALARGDGRYARLQRTLGH
                     VQLLILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQLPVSAWHEIIGNPTYADA
                     ILDRLVHNAHRIDLSGESLRQNQRRKS"
     misc_feature    145957..146688
                     /locus_tag="NGR_b01580"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    146023..146112
                     /locus_tag="NGR_b01580"
                     /note="IstB-like ATP binding N-terminal; Region:
                     IstB_IS21_ATP; pfam08483"
                     /db_xref="CDD:117060"
     misc_feature    146197..146562
                     /locus_tag="NGR_b01580"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    146272..146295
                     /locus_tag="NGR_b01580"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(146275..146298,146455..146457,146554..146556)
                     /locus_tag="NGR_b01580"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    146443..146460
                     /locus_tag="NGR_b01580"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            147159..147347
                     /locus_tag="NGR_b01590"
                     /db_xref="GeneID:7789697"
     CDS             147159..147347
                     /locus_tag="NGR_b01590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822378.1"
                     /db_xref="GI:227818407"
                     /db_xref="GeneID:7789697"
                     /translation="MFRDACEARATLGIQDRALAVLDALLTLYPDNELCEDRSLVVFP
                     SNDQLSVRVHGIAGVRTA"
     misc_feature    147159..>147332
                     /locus_tag="NGR_b01590"
                     /note="Replication protein C N-terminal domain; Region:
                     RP-C; pfam03428"
                     /db_xref="CDD:251945"
     gene            complement(147624..148187)
                     /locus_tag="NGR_b01600"
                     /db_xref="GeneID:7789698"
     CDS             complement(147624..148187)
                     /locus_tag="NGR_b01600"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_002822379.1"
                     /db_xref="GI:227818408"
                     /db_xref="GeneID:7789698"
                     /translation="MPKNRDWAGTELPDHLKPVSAIGPIVSSAHLAEGGSPGLSEVEY
                     GLILASHAFHRWMVRCMAAAGVAGLSPMEIMVLHTIRHRDRGKKLSDICLVLDIEDTH
                     VATYAIRKLEAAGLATTGRQGKEKTVRITPKGAEACGRYAQIRERLLVASTAHARPSE
                     ETLSEIAAVLRFLSGAYEQSARAATTL"
     misc_feature    complement(147627..148157)
                     /locus_tag="NGR_b01600"
                     /note="MarR family; Region: MarR_2; cl17246"
                     /db_xref="CDD:266584"
     misc_feature    complement(<147741..148046)
                     /locus_tag="NGR_b01600"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     gene            148315..151926
                     /locus_tag="NGR_b01610"
                     /db_xref="GeneID:7789699"
     CDS             148315..151926
                     /locus_tag="NGR_b01610"
                     /note="ATP-hydrolyzing"
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxoprolinase"
                     /protein_id="YP_002822380.1"
                     /db_xref="GI:227818409"
                     /db_xref="GeneID:7789699"
                     /translation="MAGTWNFWVDRGGTFTDVIGRDPDGRLHALKVLSENPGAYRDAA
                     VHGIRLHLGLAAGAPVPPGLIGEVRMGTTVATNALLERKGEPMALVTTRGFRDALRIG
                     YQERKKIFATEIIKPEALYSEVVELDERVLADGAVERPLDEDAARSMLEALKAKGYRA
                     VAIVFMHAYRYPDHEAVVARLAREIDFEQVSVSHEVSPLVKYVGRGDTTVIDAYLSPV
                     LGRYVAQVSEELDVARSGARLMFMMSSGGLTAADLFQGKDAILSGPAGGVVGLARTGE
                     AAGFDRVIGFDMGGTSTDVAHFDGEYERAFETEVAGVRVRAPMMLIHTVAAGGGSVLH
                     FDGERFRVGPDSAGANPGPACYRNGGPLAVTDANVMLGKLMPEFFPALFGPGQNLPLD
                     VETVRARFAALAAEIGDGRSPEDVADGYIRIAVANMVEAIKKISVQRGYDVTRYALNC
                     FGGAGGQHACLVADALGMTSILLHPMSGLLSAYGMGLADIRATRQKALGVALDDAAPQ
                     ALAALGAGLQTDCLAELGAQGITRDRIRTHLRAHIRYAGTDTVLAAEASFPEHDSAPR
                     LRAEFEHLHKRRFGFIAENKPLVIDAVEVETVGGGAAEMETDGLATTAGDVAVSRQTR
                     IYSQGAFHDAPVALRSDIKPGQRLTGPAIIVEANQTIIVEDGWQAELTARDHIVLKRI
                     KPLPERTAIGTRADPVMLEIFNNLFMSIAEQMGVTLQNTAYSVNIKERLDFSCAVFDN
                     KGNLVANAPHMPVHLGSMDASVATAIRENPVIHPGDVFLINAPYNGGTHLPDLTVCTP
                     VFDDAGREIRFWVASRGHHADIGGISPGSMSPLATNIEEEGVYIDNFKLIDRGRFSEE
                     GLERLLNGARYPVRNILQNVNDLKAQVAANEKGVAELKKMISQFGEEVVEAYMGHVQD
                     NAAESVRRVLDQLSDGEFSYEMDQGCRIVAKISIDRERREATVDFTGTSAQRADNFNA
                     PEPVTRAAVLYVFRVLVEADIPMNAGCLRPIRIVIPDGTMLTPRYPAAVVAGNVEVSQ
                     AVTNCLFGAVAAQAAAQGTMNNLTFGNANYQYYETICSGAPAGPGYDGADAVHTHMTN
                     SRLTDPEILETRFPVVLEDFHIRKGSGGRGKWSAGDGTKRTIRARERLDFAILSGHRR
                     IRPFGLKGGAPGELGRNRVRRNDGRIEELPGSAHTILEAGEAFTVVTPTGGGYGEAD"
     misc_feature    148315..151923
                     /locus_tag="NGR_b01610"
                     /note="5-oxoprolinase; Region: PLN02666"
                     /db_xref="CDD:215358"
     misc_feature    148333..148869
                     /locus_tag="NGR_b01610"
                     /note="Hydantoinase/oxoprolinase N-terminal region;
                     Region: Hydant_A_N; pfam05378"
                     /db_xref="CDD:253171"
     misc_feature    148927..149796
                     /locus_tag="NGR_b01610"
                     /note="Hydantoinase/oxoprolinase; Region: Hydantoinase_A;
                     pfam01968"
                     /db_xref="CDD:251002"
     misc_feature    150394..151920
                     /locus_tag="NGR_b01610"
                     /note="N-methylhydantoinase B/acetone carboxylase, alpha
                     subunit [Amino acid transport and metabolism / Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: HyuB; COG0146"
                     /db_xref="CDD:223224"
     gene            152250..155591
                     /locus_tag="NGR_b01620"
                     /db_xref="GeneID:7789700"
     CDS             152250..155591
                     /locus_tag="NGR_b01620"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane secretion protein"
                     /protein_id="YP_002822381.1"
                     /db_xref="GI:227818410"
                     /db_xref="GeneID:7789700"
                     /translation="MPNPSQTNDEWWVNDQTPDNPYGKSEDYESFLDYLGALPRSLTP
                     EIAAGTLRINVYELNDHPEYKAAAIGALEMWASVTPLKFEIVDDAPFDSTTDWMEVVS
                     PELGEEDDGSAYSSNRYVSIGQRFHDTEPNKTDIGGYVFDSFIHEFGHEFGLNHPGLY
                     NYSGPGGVQINYLNNATWTYDRQQYSVMSYFDGIDVGETTRWSASTPLMADIEAVIRR
                     FFSTVDANGVRTYQHIELNTGDNVYGFGSTQYGYQLTSSGMQHDIGFVIHDTGGTDTI
                     DFSGSTAGTILDLRAGQFSSVNGHSNNVSIFAGHNADQTDYYVENGIGSSYDDILIGN
                     DGANTLDGRGGGDRMAGNGGDDIYFVDSWDDIVREEANGGNDTVILLSRHLKIRKIAN
                     VENIIYADESTTEPGDGGDETPPSVGDDTMTSIIIGGDGNDTLDGGAGDDTIFGQGGD
                     DLIVGGRDSLASRDINNTIDVEDLEDQTESDDGNDTLYGGGGNDTILGGQGNDILDGG
                     DGDDTLSGQDGVDIFRGGAGVDTVDFSKESPFQLLVNLATNVASGGTASGDTFYSIEN
                     LIGSDDRIDRFIGTAAANHFWGQGGGDYFNGGDGNDILDGGNDGDILYGEAGDDTIIG
                     GAGQDYLDGGSGNDTVVYAGSPDGVTIDLANGTASGGDGDGPVQIVGRGAAIRHDILA
                     GFENAVGSSFEDHLIGNALANELSGGAGDDTLTGGGGADRLNGGAGSDTADYADATSG
                     VRLGLSGGRSGGDRYVSIENLAGSGFNDRLTGNDAANVLTGQGGNDAIDGGRGDDTLL
                     GDFAYQGDAPPRPGMGTGYATLGPDATNNSVATAFDISNNFSLTADPDIFDSTTVLHT
                     TVNATGNGQGGYYKIDLAAGTVITIDIDGIADPNVHDSWVRLLDSAGNIVAQNDDGGG
                     DPGSTSSRDSSLVFVVQESGPYYILEGSWSPTAPGDGWAEAVPAGSTYELNVSVEFPP
                     APAQPGVAGSDTLNGGGGSDLLDGGLAADTLTGGEGEDAFRFSTELGNGNVDWIRDFR
                     VIDDTILLDNLIFESVGADGALALGAFYGSAGGVAHDADDRIIYDTDSGVLSYDADGA
                     GEVAAIQYAQLSTNLRLSAADFIII"
     misc_feature    152433..152891
                     /locus_tag="NGR_b01620"
                     /note="Zinc-dependent metalloprotease. This super-family
                     of metalloproteases contains two major branches, the
                     astacin-like proteases and the adamalysin/reprolysin-like
                     proteases. Both branches have wide phylogenetic
                     distribution, and contain sub-families, which...; Region:
                     ZnMc; cl00064"
                     /db_xref="CDD:260167"
     misc_feature    order(152685..152690,152697..152699,152715..152717)
                     /locus_tag="NGR_b01620"
                     /note="active site"
                     /db_xref="CDD:238124"
     misc_feature    152961..>153320
                     /locus_tag="NGR_b01620"
                     /note="Peptidase M10 serralysin C terminal; Region:
                     Peptidase_M10_C; pfam08548"
                     /db_xref="CDD:117125"
     misc_feature    <153057..154460
                     /locus_tag="NGR_b01620"
                     /note="RTX toxins and related Ca2+-binding proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG2931"
                     /db_xref="CDD:225483"
     misc_feature    154053..155579
                     /locus_tag="NGR_b01620"
                     /note="RTX toxins and related Ca2+-binding proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG2931"
                     /db_xref="CDD:225483"
     misc_feature    154851..155063
                     /locus_tag="NGR_b01620"
                     /note="Bacterial pre-peptidase C-terminal domain; Region:
                     PPC; pfam04151"
                     /db_xref="CDD:252413"
     gene            155718..156119
                     /locus_tag="NGR_b01630"
                     /db_xref="GeneID:7789701"
     CDS             155718..156119
                     /locus_tag="NGR_b01630"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822382.1"
                     /db_xref="GI:227818411"
                     /db_xref="GeneID:7789701"
                     /translation="MKRRTDRRTVLMTVGAAAFAVVAGPAAAQSTDIRGTVTFEGGAV
                     IPEGHLEVYLDEPATQGSTPRRATKTRIKSDGRSKTIAFSLLPPAGSTASPTLRIIAR
                     LERADGWLVARGSTKVEAGSPVYVTLNTVMY"
     gene            complement(156184..156756)
                     /locus_tag="NGR_b01640"
                     /db_xref="GeneID:7789702"
     CDS             complement(156184..156756)
                     /locus_tag="NGR_b01640"
                     /codon_start=1
                     /transl_table=11
                     /product="nuclease inhibitor"
                     /protein_id="YP_002822383.1"
                     /db_xref="GI:227818412"
                     /db_xref="GeneID:7789702"
                     /translation="MDSTTLPADLICRPYRQLARNARLANARLDRACMALRPGEWEAA
                     RTSFFPSLKATMVHLLDADRYYIDTLRGDRPGPVNPAGSRATPAEFATERAEVDDWLV
                     EFCETLTPQALSRQISIPWPDRTLTETVADTLLHVLLHGQHHRGQIHAMLSGTSVPPP
                     QIDEFILTDNGEARVEDLAALGWNEARLTQ"
     misc_feature    complement(156235..156714)
                     /locus_tag="NGR_b01640"
                     /note="DinB family; Region: DinB; cl17821"
                     /db_xref="CDD:266861"
     gene            156755..158662
                     /locus_tag="NGR_b01650"
                     /db_xref="GeneID:7789703"
     CDS             156755..158662
                     /locus_tag="NGR_b01650"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate class-3/4/guanylyl cyclase"
                     /protein_id="YP_002822384.1"
                     /db_xref="GI:227818413"
                     /db_xref="GeneID:7789703"
                     /translation="MARSPRILGLAFCGGCSGSSQRQGAGRTTIAAETCVDSRLAILY
                     ILLWEGRVLERRLAAIMAADVVGYSRLIRVDEDGTLAALKSLRDELIGPKIAEHHGRV
                     VKLMGDGLLAEFPSVVEAVRAASEMQQAIADRNAGLPEGQRIEIRVGINLGDVAIDGD
                     DIYGDGVNVAARLEAMADPGSVYVSGAVHDQVRDRLELRFEDLGRQQVKNIDRPVRVW
                     RWLRDAAAPDRGAVLQEASLPDRPSIIVLPFNNMSRDADQEYFSDGITEDVITDLSKV
                     SGLFVIARNSAFVYKDKTFNVPQVCRELGVKFALEGSIRKAGNRVRVTAQLIDGSSGG
                     HVWAERYDRDLTDIFEVQDDITQQIVAALKVTLSAAEKSRSAEAGTRDVDAHDLFLRG
                     REMLRAVKKDRDMFEQATACFRQALALDPNYAAPCAGLGLAYVLDYQNHWSAAPETSL
                     DAAERFADEAIGKDDQDPFNHFVVSLVAMFRRNYRRWGESADRALALNPNFASALNMR
                     GVLHLYTGEPKLAIPDIERAMRLDPAVQQQYLHFLGTAYFVDGDYEKAATLFRDRIEV
                     NPTTDLSRAFLASALGHLGRLDEARRIWGELKDINPKYEHAKHVARLPFRDPSDAGKF
                     TDGLRKAGLVE"
     misc_feature    156839..157441
                     /locus_tag="NGR_b01650"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    156926..157414
                     /locus_tag="NGR_b01650"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    order(156938..156940,156944..156961,157064..157066,
                     157070..157078,157085..157087,157235..157243,
                     157253..157258,157265..157270,157379..157381)
                     /locus_tag="NGR_b01650"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    order(156944..156946,157076..157078)
                     /locus_tag="NGR_b01650"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    order(156959..156961,156992..156994,157001..157006,
                     157013..157015,157025..157027,157064..157069,
                     157220..157222,157229..157231,157238..157249,
                     157256..157258,157379..157381)
                     /locus_tag="NGR_b01650"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     misc_feature    157409..157861
                     /locus_tag="NGR_b01650"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5616"
                     /db_xref="CDD:227903"
     misc_feature    157757..158572
                     /locus_tag="NGR_b01650"
                     /note="FOG: TPR repeat [General function prediction only];
                     Region: NrfG; COG0457"
                     /db_xref="CDD:223533"
     misc_feature    <158231..158461
                     /locus_tag="NGR_b01650"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(158234..158236,158279..158281,158315..158317,
                     158327..158329,158336..158338,158384..158386,
                     158420..158422,158432..158434,158441..158443)
                     /locus_tag="NGR_b01650"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(158270..158275,158279..158284,158291..158296,
                     158372..158377,158387..158392,158399..158404)
                     /locus_tag="NGR_b01650"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    158372..>158575
                     /locus_tag="NGR_b01650"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(158375..158380,158387..158392,158477..158482,
                     158486..158491,158498..158503)
                     /locus_tag="NGR_b01650"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(158384..158386,158420..158422,158432..158434,
                     158441..158443,158486..158488,158522..158524,
                     158534..158536,158543..158545)
                     /locus_tag="NGR_b01650"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(158787..159461)
                     /locus_tag="NGR_b01660"
                     /db_xref="GeneID:7789704"
     CDS             complement(158787..159461)
                     /locus_tag="NGR_b01660"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_002822385.1"
                     /db_xref="GI:227818414"
                     /db_xref="GeneID:7789704"
                     /translation="MIKLKQRFERPSKEEIEAIARFSPATLHEAQGRRGALSSRLKPI
                     DYRMKLCGPAFTVKCAPRDNIMLQVAINYAQPGDIIVVSAGEYEEAGSFGDVLANACL
                     AKGIGGLVTDTGVRDTLQLRELGFPVFSLSVCIKGTVKETLGATNEPILIGDEIVHPG
                     DIIVGDADGLVVVRRQEAGEVAKLSQAREDAEAGYIAAYKAGKSVVEVSKLEAVLKAK
                     GLVVED"
     misc_feature    complement(158790..159449)
                     /locus_tag="NGR_b01660"
                     /note="Demethylmenaquinone methyltransferase; Region:
                     Methyltransf_6; cl00480"
                     /db_xref="CDD:260452"
     gene            complement(159611..160447)
                     /locus_tag="NGR_b01670"
                     /db_xref="GeneID:7789705"
     CDS             complement(159611..160447)
                     /locus_tag="NGR_b01670"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_002822386.1"
                     /db_xref="GI:227818415"
                     /db_xref="GeneID:7789705"
                     /translation="MKLKSWTLGAALVATAIAGPAKADKLADITAAKVIRCGTFADVP
                     PFAAPDPSTREMAGFDVDLCNAIARELGVKAEIKPLSVEARVPEVKLGHVDIAVANLA
                     YTLSRAEQIQFSHPYYLAKEMLIVKADDPGQKKADFAGVRLASTKGSTSELAIRKNES
                     KPLTFQDTGSAYLAVQQGKARGLVANTMTTTKIVKESKTKGAEMRMIEEPMLFQPIGI
                     GMKKDEPALTAKINEILVALDTSGEINKIWEKWLGPNTEYKMTRTDKVVPITELKFEP
                     IP"
     misc_feature    complement(159692..160345)
                     /locus_tag="NGR_b01670"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(159692..160345)
                     /locus_tag="NGR_b01670"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(159890..159892,159998..160000,
                     160127..160129,160202..160204,160319..160321))
                     /locus_tag="NGR_b01670"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(159911..159913,159929..159931,
                     159941..159943))
                     /locus_tag="NGR_b01670"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(159791..159808)
                     /locus_tag="NGR_b01670"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(160481..161212)
                     /locus_tag="NGR_b01680"
                     /db_xref="GeneID:7789706"
     CDS             complement(160481..161212)
                     /locus_tag="NGR_b01680"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002822387.1"
                     /db_xref="GI:227818416"
                     /db_xref="GeneID:7789706"
                     /translation="MIALAGVHKSYGSYEVLKGIDAEVARGEVVVICGPSGSGKSTLI
                     RTVNRLEEIGSGSITCDGNNIHQPMPAKELNRLRSRIGFVFQSFNLFPHLSAIDNIAM
                     SPIRVKDIQRDVAYAKATKLLERVGLAEKANAYPAQLSGGQQQRVAIARALAMEPPVM
                     LFDEPTSALDPEMVGEVLSVMKGLAADGMTMMCVTHEMGFARDVADRVWFIDQGQIVE
                     SAPPEEFFSRPQTARAQRFLSELRH"
     misc_feature    complement(160487..161212)
                     /locus_tag="NGR_b01680"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(160565..161209)
                     /locus_tag="NGR_b01680"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(161090..161113)
                     /locus_tag="NGR_b01680"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(160625..160627,160721..160726,
                     160955..160957,161087..161095,161099..161104))
                     /locus_tag="NGR_b01680"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(160955..160966)
                     /locus_tag="NGR_b01680"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(160769..160798)
                     /locus_tag="NGR_b01680"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(160721..160738)
                     /locus_tag="NGR_b01680"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(160703..160714)
                     /locus_tag="NGR_b01680"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(160619..160639)
                     /locus_tag="NGR_b01680"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(161209..161913)
                     /locus_tag="NGR_b01690"
                     /db_xref="GeneID:7789707"
     CDS             complement(161209..161913)
                     /locus_tag="NGR_b01690"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822388.1"
                     /db_xref="GI:227818417"
                     /db_xref="GeneID:7789707"
                     /translation="MISDIIAIIRDYWLLLLIGQYPNGPLGGLAATLLLSILAIAFAF
                     PVSIALALARLSKSPFLNWPVTALVYFTRGVPLLMLILWGYFLVPLATGANVPSFLTM
                     LVTLVVYQGAFLSEVVRGGIVALGHGQMEASRALGHSYLGAMRYVILPQALYNVIPSI
                     ISVFVATIKDTTLGYVINVPDLTFAASQINNQLLTQPFQVFFILAAVYYVICWSLSRV
                     AIVTERRITRPRRIRP"
     misc_feature    complement(161245..161883)
                     /locus_tag="NGR_b01690"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(161281..161808)
                     /locus_tag="NGR_b01690"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(161287..161292,161296..161301,
                     161308..161313,161341..161346,161386..161391,
                     161398..161409,161428..161430,161437..161442,
                     161482..161484,161533..161535,161542..161547,
                     161557..161559,161563..161568,161575..161577,
                     161581..161583,161587..161592,161659..161661,
                     161665..161670,161677..161706,161710..161721,
                     161749..161751,161764..161769,161776..161781))
                     /locus_tag="NGR_b01690"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(161392..161409,161659..161703))
                     /locus_tag="NGR_b01690"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(161311..161313,161341..161343,
                     161350..161352,161389..161391,161605..161607,
                     161659..161661))
                     /locus_tag="NGR_b01690"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(161461..161463,161473..161478,
                     161494..161532))
                     /locus_tag="NGR_b01690"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(161910..162617)
                     /locus_tag="NGR_b01700"
                     /db_xref="GeneID:7789708"
     CDS             complement(161910..162617)
                     /locus_tag="NGR_b01700"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822389.1"
                     /db_xref="GI:227818418"
                     /db_xref="GeneID:7789708"
                     /translation="MSSFDLSEILGNPEYVSMLLLGIKMTFVVAIGSWTLAMTLALLL
                     LGLRYAPGPLGNAFVTAYVSYHRNVPTLVQLLLWYFGIFTLMPDPVTFWLNDHNAEAI
                     FAVIGLGLCQAAYFSEDLRSGMRAVSPGQMEAARALGHSYVSAMRFVMVPQGSRNALP
                     ALINHSVSLFKNSSLAVAIGVAELTYAVKEIENLSFRTFESYLLVTVLYLVFSLMIMA
                     LGAYVARRADPVRSGRA"
     misc_feature    complement(161940..162611)
                     /locus_tag="NGR_b01700"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    complement(161967..162464)
                     /locus_tag="NGR_b01700"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(161967..161969,161976..161981,
                     161988..161993,161997..162002,162009..162014,
                     162042..162047,162084..162089,162096..162107,
                     162126..162128,162135..162140,162180..162182,
                     162231..162233,162240..162245,162255..162257,
                     162261..162266,162273..162275,162279..162281,
                     162285..162290,162381..162383,162387..162392,
                     162399..162428,162432..162443))
                     /locus_tag="NGR_b01700"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(162090..162107,162381..162425))
                     /locus_tag="NGR_b01700"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(162012..162014,162042..162044,
                     162051..162053,162087..162089,162303..162305,
                     162381..162383))
                     /locus_tag="NGR_b01700"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(162159..162161,162171..162176,
                     162192..162230))
                     /locus_tag="NGR_b01700"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(162610..163380)
                     /locus_tag="NGR_b01710"
                     /db_xref="GeneID:7789709"
     CDS             complement(162610..163380)
                     /locus_tag="NGR_b01710"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_002822390.1"
                     /db_xref="GI:227818419"
                     /db_xref="GeneID:7789709"
                     /translation="MPFSDYRTALVTGASSGIGAAIVERFSAEGLEVHAVARSAEPLR
                     KLAERTGCVAHAIDVTDRAALADLTRRVEFDILVNNAGVDRPKKFLEAEDGDIDLLVD
                     VNLRAVLHLCRMVVPGMVTRDRGHVINISSIAGIYNFGGNSSYHATKAGVSMLSNQLR
                     IDAFGKRVRVTEICPGRVATDIFAHVHGDSPEIRERFIDGFELPEARDIANAIAFAVA
                     APVAVNIGHIEITPTLQVMGGLQTAKPQSPKSGDESRE"
     misc_feature    complement(162670..163380)
                     /locus_tag="NGR_b01710"
                     /note="Short-chain alcohol dehydrogenase of unknown
                     specificity [General function prediction only]; Region:
                     COG4221"
                     /db_xref="CDD:226674"
     misc_feature    complement(162805..163356)
                     /locus_tag="NGR_b01710"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(162838..162843,162847..162858,
                     162934..162936,162946..162948,162985..162993,
                     163072..163074,163135..163143,163204..163212,
                     163264..163272,163327..163338,163342..163344))
                     /locus_tag="NGR_b01710"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(162934..162936,162946..162948,
                     162985..162987,163069..163071))
                     /locus_tag="NGR_b01710"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            163663..164568
                     /locus_tag="NGR_b01720"
                     /db_xref="GeneID:7789710"
     CDS             163663..164568
                     /locus_tag="NGR_b01720"
                     /note="Nitrogen assimilationcontrol protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Nitrogen assimilation regulatory protein nac"
                     /protein_id="YP_002822391.1"
                     /db_xref="GI:227818420"
                     /db_xref="GeneID:7789710"
                     /translation="MDTRRFKSFVVIVDTGSITRAADILHIAQPALSQQLAALEEHFG
                     TKLLTRSQQGVVMTDAGAEVYRHAQIILRQMDQARADVTAAGKHLAGRVSVGLTPFSS
                     AATLSFELLAETRRRHPGIVLHLTESVGQTYSQMLMNNRLEIALIHGAGPMKGVRFDP
                     LLREDFYLVAHETFGIEAGDTPVPISALEPLPFLMPPAYNFVRRAVEAAFARSRANLT
                     VIGEVEVIRTLTRAVGSGLGATIMPKAVADRIVSEGAGPMICRSISPRIEETLSLCVS
                     EFAPLSEPALAVQELLRELTERLKH"
     misc_feature    163663..164547
                     /locus_tag="NGR_b01720"
                     /note="nitrogen assimilation transcriptional regulator;
                     Provisional; Region: PRK11233"
                     /db_xref="CDD:183045"
     misc_feature    163672..163845
                     /locus_tag="NGR_b01720"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    163936..164538
                     /locus_tag="NGR_b01720"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    order(163984..163989,163993..163998,164005..164007,
                     164017..164019,164023..164043,164320..164337,
                     164353..164358,164362..164367)
                     /locus_tag="NGR_b01720"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(164642..165844)
                     /locus_tag="NGR_b01730"
                     /db_xref="GeneID:7789711"
     CDS             complement(164642..165844)
                     /locus_tag="NGR_b01730"
                     /note="catalyzes the formation of oxalozcetate and
                     L-glutamate from L-aspartate and 2-oxoglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate aminotransferase"
                     /protein_id="YP_002822392.1"
                     /db_xref="GI:227818421"
                     /db_xref="GeneID:7789711"
                     /translation="MPTLADRLKNVSVSASAAMTQRARDLASRGVDVVSLSSGEPDFP
                     TPSHAIEAAHAAALAGDTKYPPLDGTPALKAAIARKFKRDNNLDYEPGQILVSGGGKQ
                     VIFNAVLATCNPGDEVVIPSPAWISYADIVRFAGGVPVPVACSHENGFKLRPEDLEAA
                     ITPRTKWLLLNFPNNPTGAACSRQEMAAIAEVMLRHADVWIMTDDMYEHLVYDDFEFC
                     TIAEVEPRLYDRVLTVNGASKAYAMTGWRLGFCGGPKALISAISNVNGQNSGGTSTIT
                     QAAVVAVLDGPQDLLKERAAIYRKRRDFVLENLDGIDGLTCHKPEGAFYLFPSIAGLI
                     GKTTKAGRRIETDTDFVMALIDEQHVAIVQGAAYGMSPFFRISYATSVEKLADGCARI
                     AEFCSNLR"
     misc_feature    complement(164645..165844)
                     /locus_tag="NGR_b01730"
                     /note="aspartate aminotransferase; Provisional; Region:
                     PRK05764"
                     /db_xref="CDD:235596"
     misc_feature    complement(164663..165745)
                     /locus_tag="NGR_b01730"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(165104..165106,165128..165133,
                     165137..165139,165224..165226,165320..165322,
                     165470..165472,165542..165550))
                     /locus_tag="NGR_b01730"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(165008..165010,165017..165019,
                     165104..165112,165245..165247,165440..165442,
                     165539..165541))
                     /locus_tag="NGR_b01730"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(165128..165130)
                     /locus_tag="NGR_b01730"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(165902..166669)
                     /locus_tag="NGR_b01740"
                     /db_xref="GeneID:7789712"
     CDS             complement(165902..166669)
                     /locus_tag="NGR_b01740"
                     /codon_start=1
                     /transl_table=11
                     /product="LamB/YcsF family protein"
                     /protein_id="YP_002822393.1"
                     /db_xref="GI:227818422"
                     /db_xref="GeneID:7789712"
                     /translation="MKIDLNSDMGEGFGPYRLCDDAALMDVVSSANIACGFHAGDPET
                     MARMVRLAKARGVGVGAHPGFPDRLGFGRREMPVEADELRQQVLYQLGALTAIARGEG
                     VPVAHIGFHAAMGNMINRDPALADLIMQAIRTVDPELIVFAMPDSEIERAATRAGLRS
                     LTLFLADRAYDSKGQLVSRKLPNSVLKDEATVRARVRQFLEYGTVTTIDNRTIEVRAR
                     SILVHSDTPGSLELARIVRSEIEAAGATIAPAREVLA"
     misc_feature    complement(165950..166663)
                     /locus_tag="NGR_b01740"
                     /note="LamB/YcsF family of  lactam utilization protein;
                     Region: LamB_YcsF_like; cd10787"
                     /db_xref="CDD:212099"
     misc_feature    complement(order(166001..166003,166133..166135,
                     166142..166144,166166..166168,166175..166177,
                     166322..166324,166334..166339,166343..166345,
                     166451..166453,166484..166486,166646..166648))
                     /locus_tag="NGR_b01740"
                     /note="putative active site [active]"
                     /db_xref="CDD:212099"
     gene            complement(166709..167707)
                     /locus_tag="NGR_b01750"
                     /db_xref="GeneID:7789713"
     CDS             complement(166709..167707)
                     /locus_tag="NGR_b01750"
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase subunit 2"
                     /protein_id="YP_002822394.1"
                     /db_xref="GI:227818423"
                     /db_xref="GeneID:7789713"
                     /translation="MIEVLQTGPLNTVQDLGRFGFRNAGVTSSGAMDRLALSVGNLLV
                     GNDEGEAALEVQTFPFRLRFGRDMTVAITGADCGARLDGRPLPPWWAIAVSAGQVLEL
                     DTPRRSARAYLSFAGGIDVAPVMGSRSTSLRGGFGGLDGRFLAANDRLDIGGAGTFAL
                     PPHGFGAKPPEAALSEHFPASDDGTLLVRAIPAGEHALFGAEEERFWTQTWKISSQSD
                     RTGYRLSGEPIRLASPVELRSHGVVPGVVQMPPSGEPIVQMSDANTAGGYPKIAGVIE
                     VDLWRLGQARIGSRIRFVQSSVAEARSAERAVEAYLEDIHHTVPMLAQALAAMARR"
     misc_feature    complement(166748..167704)
                     /locus_tag="NGR_b01750"
                     /note="Allophanate hydrolase subunit 2 [Amino acid
                     transport and metabolism]; Region: DUR1; COG1984"
                     /db_xref="CDD:224895"
     gene            complement(167704..168414)
                     /locus_tag="NGR_b01760"
                     /db_xref="GeneID:7789714"
     CDS             complement(167704..168414)
                     /locus_tag="NGR_b01760"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylase"
                     /protein_id="YP_002822395.1"
                     /db_xref="GI:227818424"
                     /db_xref="GeneID:7789714"
                     /translation="MTYAQSKALSTPASISTASAEQPKISVIGTSAYLIEAPGAFDLL
                     AQRRIWALAHAVEPWPEIREVVPGVTNLLVILKQTPEEPAQFEARLRHEWDGARSIDL
                     TGKTVEIPVTYGGEHATDLASVCDYTGLTDREVVRLHWQGNYTVVALGSAPGFGYLHG
                     LDPRIHMPRKTVPSLRMLKGTVTIGGMQTGVSVLTGPNGWNSIGLAELPMFDPMKDPP
                     ALLAPGDKVRFVPERIEL"
     misc_feature    complement(167710..168342)
                     /locus_tag="NGR_b01760"
                     /note="Allophanate hydrolase subunit 1 [Amino acid
                     transport and metabolism]; Region: DUR1; COG2049"
                     /db_xref="CDD:224960"
     gene            complement(168411..168866)
                     /locus_tag="NGR_b01770"
                     /db_xref="GeneID:7789715"
     CDS             complement(168411..168866)
                     /locus_tag="NGR_b01770"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822396.1"
                     /db_xref="GI:227818425"
                     /db_xref="GeneID:7789715"
                     /translation="MTKGRKRKSAITGQIFDPATLEKIAGWLEDAGVDSIEIETEGGR
                     LMRIVAGTGAAADGAGEALDASVTQDDARPAKAPIAGHFLPVHPGRDAAEATIGSTVS
                     PEEIIGFVGIGPLIMPIRAEDAGTLKDCVVEPGSLVGYGDTVFLIEPAQ"
     misc_feature    complement(168426..168641)
                     /locus_tag="NGR_b01770"
                     /note="Biotinyl_lipoyl_domains are present in
                     biotin-dependent carboxylases/decarboxylases, the
                     dihydrolipoyl acyltransferase component (E2) of 2-oxo acid
                     dehydrogenases, and the H-protein of the glycine cleavage
                     system (GCS). These domains transport CO2, acyl; Region:
                     Biotinyl_lipoyl_domains; cl11404"
                     /db_xref="CDD:264355"
     misc_feature    complement(168525..168527)
                     /locus_tag="NGR_b01770"
                     /note="lipoyl-biotinyl attachment site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133456"
     gene            complement(168863..170248)
                     /locus_tag="NGR_b01780"
                     /db_xref="GeneID:7789716"
     CDS             complement(168863..170248)
                     /locus_tag="NGR_b01780"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase"
                     /protein_id="YP_002822397.1"
                     /db_xref="GI:227818426"
                     /db_xref="GeneID:7789716"
                     /translation="MIAAVEKGEIGRRFDTVLIANRGEIALRVQRACRELGLRTVMVC
                     SDADRDAPYRATADAFVCIGPAAPGQSYLNQAAVLLAARSAGAGAIHPGYGFLSENAG
                     FAEAAEAAGLVFVGPPASAIRTMGDKIAAKRAMIETGVPCVPGPDEALPDDIASITAI
                     ADGIGYPVIIKAAGGGGGRGMRVVHDASALKDAVSVTREEARRAFGTPELYMEKFLQH
                     PRHVEIQVLCDDHGNAVWLGHRDCSMQRRHQKVVEEAPAPGIPAEIAAAVGKRCADAC
                     QQIGYRGVGTFEFLFENGEFYFIEMNTRLQVEHPVTEMTSGIDIVCEQLRVAQGLPLT
                     LAQADVRAHGHAFECRINAEDPFTFAASPGRITAAEFPSGPGIRVDTHVTTGYKVSPH
                     YDSLIAKLIVHAPTRDQAIRRMRLALADTRIEGISTNLALHRALFEDPAFCAGETDIH
                     HLEKWLDERKQ"
     misc_feature    complement(168869..170209)
                     /locus_tag="NGR_b01780"
                     /note="acetyl-CoA carboxylase biotin carboxylase subunit;
                     Validated; Region: PRK06111"
                     /db_xref="CDD:180406"
     misc_feature    complement(169886..170209)
                     /locus_tag="NGR_b01780"
                     /note="Carbamoyl-phosphate synthase L chain, N-terminal
                     domain; Region: CPSase_L_chain; pfam00289"
                     /db_xref="CDD:249744"
     misc_feature    complement(169250..169870)
                     /locus_tag="NGR_b01780"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     misc_feature    complement(168890..169207)
                     /locus_tag="NGR_b01780"
                     /note="Biotin carboxylase C-terminal domain; Region:
                     Biotin_carb_C; smart00878"
                     /db_xref="CDD:214878"
     gene            complement(170245..170688)
                     /locus_tag="NGR_b01790"
                     /db_xref="GeneID:7789717"
     CDS             complement(170245..170688)
                     /locus_tag="NGR_b01790"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA carboxylase"
                     /protein_id="YP_002822398.1"
                     /db_xref="GI:227818427"
                     /db_xref="GeneID:7789717"
                     /translation="MDLETIRTLIEFVGRSRVSELVVGENGTIVRISRDRSKRTPADP
                     KPQRGRQAEAPPAVDRSDRPEIQPADGRTVKAPVFGVLHRSPNPGARPFVEVGDTVEV
                     GQSLCIVEAMKVFNTVSAHRAGSITRIFAGDGQEVEAGEPLMEIG"
     misc_feature    complement(170248..170688)
                     /locus_tag="NGR_b01790"
                     /note="acetyl-CoA carboxylase biotin carboxyl carrier
                     protein subunit; Validated; Region: PRK06302"
                     /db_xref="CDD:235777"
     misc_feature    complement(170251..170472)
                     /locus_tag="NGR_b01790"
                     /note="The biotinyl-domain or biotin carboxyl carrier
                     protein (BCCP) domain is present in all biotin-dependent
                     enzymes, such as acetyl-CoA carboxylase, pyruvate
                     carboxylase, propionyl-CoA carboxylase, methylcrotonyl-CoA
                     carboxylase, geranyl-CoA carboxylase; Region:
                     biotinyl_domain; cd06850"
                     /db_xref="CDD:133459"
     misc_feature    complement(order(170326..170328,170347..170355,
                     170380..170382))
                     /locus_tag="NGR_b01790"
                     /note="carboxyltransferase (CT) interaction site; other
                     site"
                     /db_xref="CDD:133459"
     misc_feature    complement(170350..170352)
                     /locus_tag="NGR_b01790"
                     /note="biotinylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:133459"
     gene            170922..172031
                     /locus_tag="NGR_b01800"
                     /db_xref="GeneID:7789718"
     CDS             170922..172031
                     /locus_tag="NGR_b01800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822399.1"
                     /db_xref="GI:227818428"
                     /db_xref="GeneID:7789718"
                     /translation="MSKRSETKSSPEMLEPRTGTPSPRLTQSEFRRRFLSRFPDRAFD
                     GLRSELDKIAAAAWDAYEHQRKAPHTRKAGAAFKDPDYELSVDWLAARDAIHAAQQRH
                     VDPDGPARILLISGSSRSEHTCPGEMSKSYRLTRIAQETMDQTTGVKTTVLELHRLAS
                     EYGRMIHPCKACFSTSPALCHWPCSCYPNYSLGQVDDWMNEIYPMWVEAHGIMIVTPV
                     NWYQVSSPIKLMMDRLVCADGGNPDPTSTEGKDARLAKALELEGWNYPRHLAGRVFSI
                     VVHGDVEGVENVRRSLSDWLRYMHLEPAGPLAELDRYIGYWKPYAQSHAELDADEAVQ
                     EEVRNAARTVVEAVTLKRAGKQVSAGRELSQPRQK"
     misc_feature    171249..171977
                     /locus_tag="NGR_b01800"
                     /note="Multimeric flavodoxin WrbA [General function
                     prediction only]; Region: WrbA; COG0655"
                     /db_xref="CDD:223728"
     gene            complement(172260..173144)
                     /locus_tag="NGR_b01810"
                     /db_xref="GeneID:7789719"
     CDS             complement(172260..173144)
                     /locus_tag="NGR_b01810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822400.1"
                     /db_xref="GI:227818429"
                     /db_xref="GeneID:7789719"
                     /translation="MTSMTETLTIFEPHPGVFAYYDGRVEGRRLYSTEPNWLDDGAYE
                     LGIASYAIVDAGEALVYDTHVSLAHGQAVRRHVEGLGAKSIRVVLSHWHDDHIAGNAV
                     FADCEIIALKLTADALEAHREQLAAGTPPISPLVMPNRLFERRLDLQVGNRRVELHHF
                     DIHSADGNVLWLPDDRILLAGDTLEDTITYVSEAQNTATHIRELARLATWPIDRILPN
                     HGAPDRIAAGGYDTRFIDANRRYLERLMDAVQQGGQTAAVAPLTDFIAPELARGAVSY
                     FEPYEAVHRKNIAALSAI"
     misc_feature    complement(172488..173000)
                     /locus_tag="NGR_b01810"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(173282..173917)
                     /locus_tag="NGR_b01820"
                     /db_xref="GeneID:7789720"
     CDS             complement(173282..173917)
                     /locus_tag="NGR_b01820"
                     /codon_start=1
                     /transl_table=11
                     /product="NADPH-dependent FMN reductase family protein"
                     /protein_id="YP_002822401.1"
                     /db_xref="GI:227818430"
                     /db_xref="GeneID:7789720"
                     /translation="MFGEPTEKNSVAPLIVGLGGTTRDGSSTELALRYALNEAEQAGA
                     RTMLFNGQALMMPMYAPEVPHRTAEAQAFIAALRAADGIIIASPAYHGSISGLVKNAL
                     DYTEDMRNDAAAYLDGRAVGCITCAYGPQAAGTTLVALRSIVHALRGWPTPLGVGINS
                     ATCRFSPEGEPSETAIADQLKIMATQVAKGAFAMRAGLAAARKPDRLIAVA"
     misc_feature    complement(173450..173875)
                     /locus_tag="NGR_b01820"
                     /note="NADPH-dependent FMN reductase; Region: FMN_red;
                     pfam03358"
                     /db_xref="CDD:251896"
     gene            complement(174027..174938)
                     /locus_tag="NGR_b01830"
                     /db_xref="GeneID:7789721"
     CDS             complement(174027..174938)
                     /locus_tag="NGR_b01830"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_002822402.1"
                     /db_xref="GI:227818431"
                     /db_xref="GeneID:7789721"
                     /translation="MIQLRHIKAFLAVADTGSIRTAALRLNVSQPALSKTIQELEEIL
                     SAPLYTRSAHGSMPTEFGRAFLHRARIIDTEFSRAQEEISQMVGAKGGKVAVGLSAIA
                     SMLMASQALERFWKKNPNVNVRISDGLLDRLVGGVRQGEFDFAVGGVPPSSLGHDLTI
                     EPLFENRIVPVVRVGHPLADARSLKDLARANWLYTNDQPAFMALMNQHFVDHGVPPPR
                     VLLTCESFSAVLDILPSTDLVAALPRSCLTHPLVRARMVGLALDGGGSHTMVGLVTRA
                     GVPLTPLAASLAKAFRQIGMRYNNLAR"
     misc_feature    complement(174060..174935)
                     /locus_tag="NGR_b01830"
                     /note="putative DNA-binding transcriptional regulator;
                     Provisional; Region: PRK09791"
                     /db_xref="CDD:182077"
     misc_feature    complement(174750..174929)
                     /locus_tag="NGR_b01830"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(174078..174662)
                     /locus_tag="NGR_b01830"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(174234..174239,174243..174248,
                     174264..174281,174558..174578,174582..174584,
                     174594..174596,174603..174608,174612..174614,
                     174618..174620))
                     /locus_tag="NGR_b01830"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(175025..175897)
                     /locus_tag="NGR_b01840"
                     /db_xref="GeneID:7789722"
     CDS             complement(175025..175897)
                     /locus_tag="NGR_b01840"
                     /note="similar to lipase/esterase; lipQ protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822403.1"
                     /db_xref="GI:227818432"
                     /db_xref="GeneID:7789722"
                     /translation="MNAHTQEQSGRYAVEATALDYVARDGTPLSGTFYRPRAKSELPT
                     LVAVHGGGWRLAPKGNYQHIGPYLAAQGYAVFAPTYRLAKGELPSYPAAVHDVRAAVQ
                     FVRAEAENLGLDANRLALLGDSSGAHLAALVALAGDLPLFKDGSPNGGLDRWSAGVKA
                     CIPVYGIFDLAAQWQHDQAVRFDDHIVERFLGERLVDDRRPYFDASPLSHVSATRKET
                     AFLVAWGINDDVVDPASQSEAFVLALKQAGIFVRSLPVPSAPHYWISDPLDEAGSFSG
                     FFAPRLLRFLEAKL"
     misc_feature    complement(175085..175834)
                     /locus_tag="NGR_b01840"
                     /note="Esterase/lipase [Lipid metabolism]; Region: Aes;
                     COG0657"
                     /db_xref="CDD:223730"
     misc_feature    complement(<175520..>175801)
                     /locus_tag="NGR_b01840"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            176170..176979
                     /locus_tag="NGR_b01850"
                     /db_xref="GeneID:7789723"
     CDS             176170..176979
                     /locus_tag="NGR_b01850"
                     /note="similar to alpha/beta hydrolase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822404.1"
                     /db_xref="GI:227818433"
                     /db_xref="GeneID:7789723"
                     /translation="MKHHFLHTGDVELEWHETGEGAPILYLHGGQGFFPDDAFVAELA
                     RTRRVIVPSHPGFGKSSLPDWLDCVSDIAHVHLALLDYLGLDEVDVVGCSIGGWIAAE
                     MGTMSPERFGRIVLAAPVGIKVGPVDRLDVPDIFALSQEQVTGLFYHDAAKFRFDASA
                     HSDDRLTIIVRNRETLTLLTWEPYMHNPKLRHRLQRVTAPTLILRGGSDGFVSADYAN
                     AYARLIPNASVETIEAAGHNIAEERPEALAARVEAFLADPQTTKTLWRNAG"
     misc_feature    176176..>176523
                     /locus_tag="NGR_b01850"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    176239..176919
                     /locus_tag="NGR_b01850"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    <176377..176940
                     /locus_tag="NGR_b01850"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            176976..178172
                     /locus_tag="NGR_b01860"
                     /db_xref="GeneID:7789724"
     CDS             176976..178172
                     /locus_tag="NGR_b01860"
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="YP_002822405.1"
                     /db_xref="GI:227818434"
                     /db_xref="GeneID:7789724"
                     /translation="MRAWFFSENAYPDLPPETEYDSIRVTLPNSLYDPKKGAALYDRY
                     IDEWLVAEEEGLDIMLNEHHQTPTCVDPAAPLVLAALARLTSKARLLLLGNPISNRRD
                     PVRVAEEMALADILSHGRLEVGFVRGVPYELAAANSNPVRTNERHWEALDLILKAWTT
                     RDGPFSHEGQFFHHRNVNIWPRPYQDPHPPVWVSATSPGGAARVGSRGFVQATFLTGF
                     GGTPRVYESYRQGWREAGRGAVTPVNRLAYAPLLYTSPDPARARAGAEQLLWYLKANK
                     VPVHYKNPPGYVPVDVNVRFLRGAMPQLAASIKDLNVEKAIEAGIMFAGTPDQVFEQV
                     KHFYGKVGGFGHMLLMGQAGFLDHEDTVHGIRTFARDVYPRLKEAFPDDAASGADEER
                     VQAVAG"
     misc_feature    177084..177770
                     /locus_tag="NGR_b01860"
                     /note="Flavin-utilizing monoxygenases; Region:
                     Flavin_utilizing_monoxygenases; cl19096"
                     /db_xref="CDD:267449"
     gene            178215..179186
                     /locus_tag="NGR_b01870"
                     /db_xref="GeneID:7789725"
     CDS             178215..179186
                     /locus_tag="NGR_b01870"
                     /note="similar to ABC transporter substrate-binding
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_002822406.1"
                     /db_xref="GI:227818435"
                     /db_xref="GeneID:7789725"
                     /translation="MKHILRSLAAGVVVLAGIGTADAADAWRHGVVEAKGDAGIQFMP
                     SKFAEKFNLDLETVEFASSTVPVKALLAGEIDSYATTPLTAIAAMAEGASLKFLGCNW
                     PGMTYDLYAKGDIKTIKDLKGRSVGISGPGGAPDLFAREALRWGGLDPSEVTFANAGG
                     GGDRFRAVVAGVVDATATSSEFEPEAAERGVNVIARAPEATPNLLRICVVTSDKVIAE
                     KHDQLVRFLAAQMVGHKYAVENPKETADYAREVAKLPPDDKSPEFIFEEVVKYDAVKP
                     DLPIMADKLQWNVDMMHRNGRIKESYDIKNFIDEGPRQEALKLAATN"
     misc_feature    178215..179183
                     /locus_tag="NGR_b01870"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    178215..>178442
                     /locus_tag="NGR_b01870"
                     /note="NLPA lipoprotein; Region: Lipoprotein_9; cl19159"
                     /db_xref="CDD:267512"
     misc_feature    178353..178943
                     /locus_tag="NGR_b01870"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            179204..179995
                     /locus_tag="NGR_b01880"
                     /db_xref="GeneID:7789726"
     CDS             179204..179995
                     /locus_tag="NGR_b01880"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_002822407.1"
                     /db_xref="GI:227818436"
                     /db_xref="GeneID:7789726"
                     /translation="MGHVELLNVSKTFPLKVKGVQRHARALDNLSFSVNKGEIVALAG
                     PSGCGKTTALRIIMGLESASSGSVTVAGRQINGCGFDRGMVFQHAELLPWRSAVENIK
                     FGLEMKNLAQKEIDERAERFINLVGLGHAKDHRPHQLSGGMKQRVGIARALAIDPEVL
                     LMDEPFGALDSQTRETLQMELLDIHQRTEKTIIFVTHDLDEAVLLADRVVVMVGGHLR
                     EIIPVELERPRSDMRRIRSASEFTRKRTMIWEALHEPAKPHELAA"
     misc_feature    179204..179968
                     /locus_tag="NGR_b01880"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    179213..179878
                     /locus_tag="NGR_b01880"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    179333..179356
                     /locus_tag="NGR_b01880"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    order(179342..179347,179351..179359,179462..179464,
                     179690..179695,179792..179794)
                     /locus_tag="NGR_b01880"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    179453..179464
                     /locus_tag="NGR_b01880"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    179618..179647
                     /locus_tag="NGR_b01880"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    179678..179695
                     /locus_tag="NGR_b01880"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    179702..179713
                     /locus_tag="NGR_b01880"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    179780..179800
                     /locus_tag="NGR_b01880"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            180005..180841
                     /locus_tag="NGR_b01890"
                     /db_xref="GeneID:7789727"
     CDS             180005..180841
                     /locus_tag="NGR_b01890"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter permease"
                     /protein_id="YP_002822408.1"
                     /db_xref="GI:227818437"
                     /db_xref="GeneID:7789727"
                     /translation="MSITETTARAKTGKEQASVAAEKAWSMPDWAITTISLLILVGVW
                     QAAAPFIDPLFGSYPSQIFSSFLVMMESGTLARAFWQSIQPFFAGYLLAAAIGVPAGL
                     LLGRYRVAEAALGIYVMAGYATPLIALVPLLMVWFGLGFAVKMVIIFLLAFFPICINT
                     WVGVKAVPRTLVEVGTAFCAPQSRIMRQIVLPATLPYIMAGLRLAIGKAVIAMIIAEF
                     LTAISGLGGIIINAANSFRTAEMFVPIICVMILAVVLDRLVAWLERKVAPWQSEIAGD
                     HA"
     misc_feature    180083..180811
                     /locus_tag="NGR_b01890"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    180239..180778
                     /locus_tag="NGR_b01890"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(180287..180292,180299..180304,180317..180319,
                     180344..180355,180359..180388,180395..180400,
                     180404..180406,180452..180457,180461..180463,
                     180467..180469,180476..180481,180485..180487,
                     180497..180502,180509..180511,180560..180562,
                     180602..180607,180614..180616,180635..180646,
                     180653..180658,180695..180700,180728..180733,
                     180740..180745,180749..180754,180761..180766,
                     180773..180778)
                     /locus_tag="NGR_b01890"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(180362..180406,180635..180652)
                     /locus_tag="NGR_b01890"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(180404..180406,180437..180439,180653..180655,
                     180689..180691,180698..180700,180728..180730)
                     /locus_tag="NGR_b01890"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(180512..180550,180566..180571,180581..180583)
                     /locus_tag="NGR_b01890"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            180834..181601
                     /locus_tag="NGR_b01900"
                     /db_xref="GeneID:7789728"
     CDS             180834..181601
                     /locus_tag="NGR_b01900"
                     /EC_number="3.5.1.59"
                     /note="N-carbamoylsarcosineamidohydrolase; CSHASE"
                     /codon_start=1
                     /transl_table=11
                     /product="N-carbamoylsarcosine amidase"
                     /protein_id="YP_002822409.1"
                     /db_xref="GI:227818438"
                     /db_xref="GeneID:7789728"
                     /translation="MREGSKAENQGARVWDRFLTERDREVVGIAGYGARQGFGTRPAV
                     LVVDVNYAFCGDRREPVQDSILRWRQSGGEEAWDALPTLSGLIGLARSKGLPLIYTTG
                     AEREDKWDRGSWLWKNSRSRERPKAVELDGNTIMPQIAPAPQDVVIHKQKPSAFHGTN
                     LLDYLFLFKCDSLIVMGTATSGCVRATVVDAFSHNLRVTVVEDGCFERCQASHAMSLF
                     DMNSKYADVLPSGEVRTFMEGLEAGLFDLPAGSRGKA"
     misc_feature    180960..181532
                     /locus_tag="NGR_b01900"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cl00220"
                     /db_xref="CDD:260273"
     misc_feature    order(180975..180977,181281..181283,181380..181382)
                     /locus_tag="NGR_b01900"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    181365..181370
                     /locus_tag="NGR_b01900"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238245"
     gene            181769..182857
                     /locus_tag="NGR_b01910"
                     /db_xref="GeneID:7789729"
     CDS             181769..182857
                     /locus_tag="NGR_b01910"
                     /note="similar to ammonia monooxygenase"
                     /codon_start=1
                     /transl_table=11
                     /product="monooxygenase"
                     /protein_id="YP_002822410.1"
                     /db_xref="GI:227818439"
                     /db_xref="GeneID:7789729"
                     /translation="MRRYLGRFAPSKFPYRKLLLALAIGFIGGCIFFYFHLPLPWMLG
                     SLVACLVASLFNMPVAVPGIVRPPMLMLVGVVLGSGFTPAMAGSMIDWLPGLGILMVF
                     VVLTAGCSYVYFRRVGGFDHWTAFFSGMPGGLVEMTALGDAYGANTRAIALVHSSRIM
                     LVVLTLPFVLTVVGGQTLAGISRSGASVLEAPISAELWLFGTGLCGAVLGRLLSMPSP
                     FLMGPMLASAAVHLTGLSAFHAPWEIIAFAQLVLGSALGCSFAGVKKSSILHILRLSV
                     GSTAFLVAASTSCALLVSHLTGSPILSLLLAYSPGGLTETSLMALSLHVDVAFVATHH
                     VLRVFFVAVSATFLARLLRRGRLANKDG"
     misc_feature    181811..182791
                     /locus_tag="NGR_b01910"
                     /note="Putative ammonia monooxygenase [General function
                     prediction only]; Region: AbrB; COG3180"
                     /db_xref="CDD:225721"
     misc_feature    181823..182278
                     /locus_tag="NGR_b01910"
                     /note="membrane protein AbrB duplication; Region:
                     Gneg_AbrB_dup; TIGR03082"
                     /db_xref="CDD:213773"
     misc_feature    182357..182809
                     /locus_tag="NGR_b01910"
                     /note="membrane protein AbrB duplication; Region:
                     Gneg_AbrB_dup; TIGR03082"
                     /db_xref="CDD:213773"
     gene            183209..183463
                     /locus_tag="NGR_b01920"
                     /db_xref="GeneID:7789730"
     CDS             183209..183463
                     /locus_tag="NGR_b01920"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane protein"
                     /protein_id="YP_002822411.1"
                     /db_xref="GI:227818440"
                     /db_xref="GeneID:7789730"
                     /translation="MRKLVIAVGMIGTLASCTQTERATAIGAGTGAIIGGVVSDSWGG
                     AAIGAVAGGVMGNLIGRSRERDGYCIYRDRYGRRYEARCR"
     gene            complement(183598..184419)
                     /locus_tag="NGR_b01930"
                     /db_xref="GeneID:7789731"
     CDS             complement(183598..184419)
                     /locus_tag="NGR_b01930"
                     /codon_start=1
                     /transl_table=11
                     /product="lactone hydrolase"
                     /protein_id="YP_002822412.1"
                     /db_xref="GI:227818441"
                     /db_xref="GeneID:7789731"
                     /translation="MSDNTDSIAVSRDGTRISYRLVRGNGQGRVVLVHSLAMDKTFWQ
                     PTVSALDGFADALIFDCRGHGASDKPAALYSVELFADDVADLMDHAGWRSAVVAGASM
                     GGCVALAFAANYPERVEALGLFDTTAWYGENAPKAWAERADKALAEGMAALVGFQKTR
                     WFSDGFREANPDVVERAIGVFLENELPAYAATCAMLGNADLRAALPRFDFPCRVAVGT
                     EDYATPPEMARYMADNIPGASLFILEGVRHFTPLEIPSIIAGHLKELVKAGAPGS"
     misc_feature    complement(183631..184374)
                     /locus_tag="NGR_b01930"
                     /note="3-oxoadipate enol-lactonase; Region: protocat_pcaD;
                     TIGR02427"
                     /db_xref="CDD:131480"
     misc_feature    complement(<184045..184257)
                     /locus_tag="NGR_b01930"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     misc_feature    complement(183859..>184005)
                     /locus_tag="NGR_b01930"
                     /note="TIM barrel proteins share a structurally conserved
                     phosphate binding motif and in general share an eight
                     beta/alpha closed barrel structure. Specific for this
                     family is the conserved phosphate binding site at the
                     edges of strands 7 and 8. The phosphate...; Region:
                     TIM_phosphate_binding; cl17186"
                     /db_xref="CDD:266538"
     misc_feature    complement(183940..183945)
                     /locus_tag="NGR_b01930"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:240073"
     gene            complement(184512..185462)
                     /locus_tag="NGR_b01940"
                     /db_xref="GeneID:7789732"
     CDS             complement(184512..185462)
                     /locus_tag="NGR_b01940"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_002822413.1"
                     /db_xref="GI:227818442"
                     /db_xref="GeneID:7789732"
                     /translation="MPMNLANIDLKLLVVFDAMMAEGSVSRAAARLGMSQPALSNALN
                     RLRLLLNDRLFLRTAEGMRPTPRAIEISGPIQSAMRQIEEALEPTAFEPHDPDWTFSL
                     AVSDHASVVLLPLLIEHIARVAPRVTLNIQSRPNEELPALLDNGEIDLAVGVIPNLPR
                     RFKHMAVFEDKYLCMMRQGHPLAGRPITLEEFLAADQLSVKPGISDISRVDRLLAEAG
                     LKRRVATTVHQFLAAPAIVSRSDLIVLVFEKMVPIFDPSRFYFCSVPVPNMQVAATAV
                     WGDVHSELPAHKWLRRQLAAAARQLAAESGGDVRPLSAAG"
     misc_feature    complement(184596..185441)
                     /locus_tag="NGR_b01940"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(<185337..185435)
                     /locus_tag="NGR_b01940"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(184596..185168)
                     /locus_tag="NGR_b01940"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that involved in the
                     catabolism of nitroaromatic/naphthalene compounds and that
                     of related regulators; contains the type 2 periplasmic
                     binding fold; Region: PBP2_Nitroaromatics_like; cd08417"
                     /db_xref="CDD:176109"
     misc_feature    complement(order(184644..184646,184842..184844,
                     184953..184955,185127..185129,185139..185144,
                     185148..185150))
                     /locus_tag="NGR_b01940"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176109"
     misc_feature    complement(order(184746..184748,184755..184760,
                     184767..184772,184779..184793,184875..184877,
                     185064..185066,185070..185084,185088..185093,
                     185100..185105,185109..185114,185121..185126,
                     185133..185138,185145..185147))
                     /locus_tag="NGR_b01940"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176109"
     gene            185664..187739
                     /locus_tag="NGR_b01950"
                     /db_xref="GeneID:7789733"
     CDS             185664..187739
                     /locus_tag="NGR_b01950"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane protein"
                     /protein_id="YP_002822414.1"
                     /db_xref="GI:227818443"
                     /db_xref="GeneID:7789733"
                     /translation="MHLFEQAMMAFTVIFDPIRFMIIMLGCVLGLFIGVIPGIGGLAG
                     MALLLPFTYTMDPYTALAFLIGMWAVTPTADTIPSILIGVPGAAGSAATVMDGYPMAR
                     RGEAGRALGASYTASLIGGIFGAILLGLAIPILRPFMMAFGTPELLALCILGLTLVAA
                     VSQGNMMKGLVAACFGVVIASVGDEAQTGELRWTFDSLYLWEGVPLEALVLGLFAVPE
                     LLELGAARQAVAMHKSESILRDQFRGVKDAIQNIRLVFQSSWLGAILGSVPGLGGPAI
                     DWIAYGSAAKSVKDGTKTFGTGDVRGVIACEAANNSREGGALIPTLAFGIPASATMAI
                     LLGAFMMHGIQPGPKLLTEQLDITYTIVWSLMIANIVGVLICFAFVSQLAKLALVPAA
                     ILVPTVLAIVFIGAYSATRDIGDIIVLLIFSVIGWAMKRFGWARAPVLLGLVLGDLVE
                     QYLFISTSRYGSDWLYRPGVIFILMIPVVFFIYSALRFVMKRRGAVPVAVGAAVSEPA
                     APREPTGPVSAVDRIMLPGMWVLAAILFATALVTSTEWAFAAKLMPQTVSAVGLIVVA
                     CAGVGVFMRQRAGEVIIKPRRAHEADPLEAMSDGALYKRMGGMAAWVLSVYIGTLLIG
                     LLPTLLLFMIAYMRFEGKQPWVRTLVISIVIWVAMVVLFDRLLVMPWPQSYLGDALPQ
                     VRTLVSDLI"
     misc_feature    185721..186977
                     /locus_tag="NGR_b01950"
                     /note="Tripartite tricarboxylate transporter TctA family;
                     Region: TctA; pfam01970"
                     /db_xref="CDD:251004"
     gene            188103..189083
                     /locus_tag="NGR_b01960"
                     /db_xref="GeneID:7789734"
     CDS             188103..189083
                     /locus_tag="NGR_b01960"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002822415.1"
                     /db_xref="GI:227818444"
                     /db_xref="GeneID:7789734"
                     /translation="MLDRSSQSPTHIPTDALSEVLQDFRLSGVNYGRCELRHPWSIAF
                     PQQQLLRFHFVSEGPCWVHTEAQGWQELRDGDLVLLPQGVEHRLASKPDVVGDSLKSC
                     HVTKLGGNVCEVVQQGTGATSTLFCGSMALGANALNPLIALMPPIIRGCDVAGNDPIV
                     GPLLAAMTAEASQPQIGSATVLSRMADVLVARLIRCWVNCSGASTSGWLAAIRDPHIG
                     RALAAMHRDPGHDWTLETLAGVAGQSRSIFAERFSAILGEGAARYLARLRMQLARELL
                     GQNMSVAEVASQLGYESEASFARAFKRITSVSPGVVRRTISGRTDMEFGL"
     misc_feature    188145..188696
                     /locus_tag="NGR_b01960"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    188772..188894
                     /locus_tag="NGR_b01960"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    188793..189041
                     /locus_tag="NGR_b01960"
                     /note="helix_turn_helix, arabinose operon control protein;
                     Region: HTH_ARAC; smart00342"
                     /db_xref="CDD:197666"
     misc_feature    188919..189029
                     /locus_tag="NGR_b01960"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            189143..190351
                     /locus_tag="NGR_b01970"
                     /db_xref="GeneID:7789735"
     CDS             189143..190351
                     /locus_tag="NGR_b01970"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822416.1"
                     /db_xref="GI:227818445"
                     /db_xref="GeneID:7789735"
                     /translation="MTDTTSQLDGPAIGLDSADPSAWSPTTWLAVISMAATSFALVSA
                     EFLPAGLLTPMARDLGISEGTAGQVVTATASVGAVTALLSNVLIGKLNRKTVLVGLSA
                     LAIGSNLLAAFATDFWLLLLGRAGLGVALSGFWALSVAVVARLVGTNATGRGMAIVTL
                     GVSVATIAAPSMGALISDWLGWRAATGMTAGLAAIAMLLQTLSLPSLPASTSNSLSDV
                     FRLTKRRTVQLGMLAILLLMTGHFSGSVYVRPFLEQVTLLGTGPIALALLGFGIAAVI
                     GNVAGGRLADTNIHMALAVTGVLMAFAALALVLWGAHSGIAFALVTLWGLAFGMAPVV
                     LPTNLSRGAGNALEAAGSLMVVSFQVAISMGAVFGGYIVDHHGASGPLIITAVLAAST
                     IVLALLQPRS"
     misc_feature    189194..190348
                     /locus_tag="NGR_b01970"
                     /note="Arabinose efflux permease [Carbohydrate transport
                     and metabolism]; Region: AraJ; COG2814"
                     /db_xref="CDD:225371"
     misc_feature    189233..190336
                     /locus_tag="NGR_b01970"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(189275..189277,189284..189292,189296..189301,
                     189350..189352,189359..189364,189371..189373,
                     189383..189388,189392..189397,189533..189538,
                     189545..189550,189557..189562,189569..189571,
                     189605..189610,189617..189622,189638..189640,
                     189854..189856,189863..189868,189875..189880,
                     189887..189889,189929..189931,189941..189943,
                     189953..189955,189962..189964,189974..189976,
                     190115..190117,190124..190129,190136..190138,
                     190148..190153,190160..190162,190190..190195,
                     190202..190207,190214..190219,190226..190228)
                     /locus_tag="NGR_b01970"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(190779..192548)
                     /locus_tag="NGR_b01980"
                     /db_xref="GeneID:7789736"
     CDS             complement(190779..192548)
                     /locus_tag="NGR_b01980"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate"
                     /protein_id="YP_002822417.1"
                     /db_xref="GI:227818446"
                     /db_xref="GeneID:7789736"
                     /translation="MDHQGTKRFVPVETGAPRYGSDLIAAAIREQGFPYICLNPGASY
                     RHLHDSLVNYLGNEKPKILLCMHEEHAIGIAQGWAKITDRPLAAAVHSNVGLMHATMG
                     IFDAWCDRVPLVVIGATGPLDATKRRPWIEWIHCTIDQGGLVRDFTKWDDEPASPEAA
                     VESIRRAAMLATARPSGPTYVNLDVTVQEMELEEVPALHDISRFRAPADPEPPRRELE
                     AAIEILAKAKRPVILSGRTSRSEDGWAERVKLAELIGAKVLTHVKLATSFPTTHPLFI
                     GETGWKLSKNLLKHLTEADAVLSLDWLDLAGTINQVFPAGGPSAPIISVSNDFNIHRG
                     WNMDYQGLPAVDVNIPTVPETAVSRLLEALETRLSAPRTYERRRLDAEPSRTSGPISL
                     MDLARVFNRVTRDLDVSLTSRPLGWPTNANELEHPHDYLGHNGGGGVGSGPSIGIGAA
                     LALRDMKSPRVPIAIVGDGDFTMGNTALWSAASQGIPLLYVISNNNSYFNDEHHQAQV
                     AVQRGRPPENAWVGQRLQDPVPDLLMLAKAQGIDGEGPITDITELSGALERGIEKVRA
                     GQPWVIDVRVPPEYCRDPMVELA"
     misc_feature    complement(190815..192491)
                     /locus_tag="NGR_b01980"
                     /note="acetolactate synthase catalytic subunit; Validated;
                     Region: PRK08327"
                     /db_xref="CDD:236243"
     misc_feature    complement(192000..192485)
                     /locus_tag="NGR_b01980"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(192222..192227,192234..192236,
                     192246..192248,192267..192269,192303..192311,
                     192315..192320,192327..192332,192339..192341,
                     192348..192368,192402..192404,192414..192416,
                     192426..192431,192444..192446))
                     /locus_tag="NGR_b01980"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(192111..192113,192120..192122,
                     192237..192239,192246..192251,192255..192260,
                     192267..192269,192342..192344,192348..192359,
                     192363..192365,192402..192404,192414..192416,
                     192423..192431))
                     /locus_tag="NGR_b01980"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(192255..192257,192267..192269,
                     192345..192347,192429..192431))
                     /locus_tag="NGR_b01980"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(191565..191900)
                     /locus_tag="NGR_b01980"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(190821..>191210)
                     /locus_tag="NGR_b01980"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cl01629"
                     /db_xref="CDD:261022"
     misc_feature    complement(order(191058..191060,191064..191066,
                     191139..191150))
                     /locus_tag="NGR_b01980"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            complement(192637..193683)
                     /locus_tag="NGR_b01990"
                     /db_xref="GeneID:7789737"
     CDS             complement(192637..193683)
                     /locus_tag="NGR_b01990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822418.1"
                     /db_xref="GI:227818447"
                     /db_xref="GeneID:7789737"
                     /translation="MKLKSIRLLAAAAATACATMSGAATAQADAVSDFYSGKTVTILI
                     GHPPGGSYDLYAQLIAQHFGKHIPGQPTVIVQGMPGGGGSLAAAHFYAKAPRDGTIVA
                     LLPESLAQDQVLEPKKSRWDVSKMRFIGRVSDVTSVMMARKDSPVKSIEDSLRAEANV
                     SCSGRTTSSAQTGAVLKSLIGSKFNMVCGYDSATASALAVFRGEADLTTTVWANWSVN
                     YAQQLSAGDVVPVVQFSEKRLAALPDTPTAVELTNDPAKKQAIEFFGAGGDIGRALMT
                     PPETPEDRVAGLSAAFDGLMKDPEFLADAKARSIPIAPITGKEVDAIVERIISTSPEV
                     VATLKQAINDGFNN"
     misc_feature    complement(192664..193623)
                     /locus_tag="NGR_b01990"
                     /note="Tripartite tricarboxylate transporter family
                     receptor; Region: TctC; cl17792"
                     /db_xref="CDD:266840"
     gene            193900..194403
                     /locus_tag="NGR_b02000"
                     /db_xref="GeneID:7789738"
     CDS             193900..194403
                     /locus_tag="NGR_b02000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822419.1"
                     /db_xref="GI:227818448"
                     /db_xref="GeneID:7789738"
                     /translation="MATGRQGLWDFALRLYGAPGVGDACLVLQDESGVDVPVLLFAAW
                     LSKHSVALTEAELVRIDQIVADWRNEVVKPLRAVRRRLKGGPYPAPAETTETLRNGVK
                     GVELSSEKIELAVLEAEGEALLAVGASAVNATGNLAVVLRHFRGADPDATAAEALATV
                     GKALAAL"
     misc_feature    193921..194250
                     /locus_tag="NGR_b02000"
                     /note="Protein of unknown function (DUF2390); Region:
                     DUF2390; pfam09523"
                     /db_xref="CDD:255411"
     gene            complement(194407..194991)
                     /gene="ubiX"
                     /locus_tag="NGR_b02010"
                     /db_xref="GeneID:7789739"
     CDS             complement(194407..194991)
                     /gene="ubiX"
                     /locus_tag="NGR_b02010"
                     /EC_number="4.1.1.-"
                     /note="polyprenylp-hydroxybenzoate decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
                     /protein_id="YP_002822420.1"
                     /db_xref="GI:227818449"
                     /db_xref="GeneID:7789739"
                     /translation="MRRIIIAITGASGIIYGVRALQLLRELEDVETHAVISPAAFRTA
                     TDEIDMSADEIKGLADVLYNYRDIGAAISSGSFRTAGMLVAPCSVRTLSGIANCYNEE
                     LIVRAADVCLKERRRVVLLFRETPLHAGHIALMDQATRNGAIVMPPVPAFYSKPKTLD
                     DMVTQTVGRALDLFDIHLPMVKRWKEGPGSPGQH"
     misc_feature    complement(194437..194991)
                     /gene="ubiX"
                     /locus_tag="NGR_b02010"
                     /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
                     Provisional; Region: PRK06029"
                     /db_xref="CDD:235677"
     gene            complement(195007..195693)
                     /locus_tag="NGR_b02020"
                     /db_xref="GeneID:7789740"
     CDS             complement(195007..195693)
                     /locus_tag="NGR_b02020"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002822421.1"
                     /db_xref="GI:227818450"
                     /db_xref="GeneID:7789740"
                     /translation="MANSLAESLNPLVHEPAPLRNKIMNSLRRAIETGALEPGTRLVE
                     KDLCEKLNVSRTSLREALRQLQAEGILTDLNNRGLTVVTVTRADAENIYRIRGVLEPL
                     IVEQFIENAPDNEIKALKTQSDVLKKAYLSGNAEEIVATKRDFYDRICTGARNPIAFD
                     LLKKLTLLTSPLRRSSVVRKERRSQSIAEIDAIVAAIVNRDKAAAKAAAEKHVANSAV
                     SAFSNAFDAS"
     misc_feature    complement(195043..195654)
                     /locus_tag="NGR_b02020"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    complement(195445..195642)
                     /locus_tag="NGR_b02020"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    complement(order(195454..195456,195460..195468,
                     195472..195477,195505..195507,195514..195519,
                     195523..195537,195559..195564,195565..195567,
                     195634..195636,195640..195642))
                     /locus_tag="NGR_b02020"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(195049..195420)
                     /locus_tag="NGR_b02020"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(195805..198093)
                     /gene="coxL1"
                     /locus_tag="NGR_b02030"
                     /db_xref="GeneID:7789741"
     CDS             complement(195805..198093)
                     /gene="coxL1"
                     /locus_tag="NGR_b02030"
                     /EC_number="1.2.99.2"
                     /note="COdehydrogenase subunit L; CO-DH L"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase"
                     /protein_id="YP_002822422.1"
                     /db_xref="GI:227818451"
                     /db_xref="GeneID:7789741"
                     /translation="MRFEDDALITGRGRYVNDLTGKGEAAAVFVRSQVASGRIALLDT
                     EAAAAMPEVLAILTGPDLKAAGLAPIEPRGRHPGPDGGAMRVPLFYPLAIDHVRYVGD
                     PVAIVVAETRSAALAAAEAMVVEIDERPVVVDPLEAVSAGAPRVWDEFPDNRCFTYEK
                     GDKAGVDAAIASAHTVVRQRLRISRVVAAPIETRGAIASYDPAADQYRLELGTQAPHR
                     VSGDVAPVLGVAPDKVHVVVSDCGGSFGMKNAGYPEYPALLFAARKTGRTLRWTADRL
                     EAFQSDAHARDMWADAALALDADGMFLALDVHVRANLGAYLGPATVHPPVANLGGIAG
                     VYRTPKIYAKVDGVFTNTQQTAPYRGAGRPEATYIIERMIDLAACEIGLDRAELRRRN
                     LVPKEAMPYASGFIFTYDSGDFPGVLDKALEMADWAGFEARRSEARARGKLRGIGIAN
                     PIEIAGGPVARPNPEFARVEISPAGKVRIHVGSMDSGQGHGTAFRQIIADRLGLGAED
                     MEIVTGDTHAVPQGTGTFGSRTLAAAGGAIWTATETIIDRLKDQAADRLEADRSDILF
                     ERGEYRIAGTDRAVSFAQVISEETAPVAAENFIGNDGATFPNGCHICELEIDPETGHV
                     DLLAYSVVDDVGQMVNPLLVKGQITGGVAQGLGQALTENAVYDPNSGQLLSATFMDYA
                     MPRAHDVPDVDIVDRSVPTRQNPLGVKGVGEAGTVGALSAVMSAVADALRPLGVRHVD
                     MPATPDRIWRCLKMQPAKEPAP"
     misc_feature    complement(195835..198093)
                     /gene="coxL1"
                     /locus_tag="NGR_b02030"
                     /note="Aerobic-type carbon monoxide dehydrogenase, large
                     subunit CoxL/CutL homologs [Energy production and
                     conversion]; Region: CoxL; COG1529"
                     /db_xref="CDD:224446"
     misc_feature    complement(197704..198066)
                     /gene="coxL1"
                     /locus_tag="NGR_b02030"
                     /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
                     hammerhead domain; Region: Ald_Xan_dh_C; smart01008"
                     /db_xref="CDD:214971"
     misc_feature    complement(196024..197652)
                     /gene="coxL1"
                     /locus_tag="NGR_b02030"
                     /note="Molybdopterin-binding domain of aldehyde
                     dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
                     /db_xref="CDD:251506"
     gene            complement(198268..199899)
                     /locus_tag="NGR_b02040"
                     /db_xref="GeneID:7789742"
     CDS             complement(198268..199899)
                     /locus_tag="NGR_b02040"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylase/decarboxylase family protein"
                     /protein_id="YP_002822423.1"
                     /db_xref="GI:227818452"
                     /db_xref="GeneID:7789742"
                     /translation="MTPFARKAPLDLQEHLQRLEELGLLTKIQVPIDKDSELHPLARW
                     QFQGGLPDEQRRGFLFTDVKGAKGETYDIPVAVGVLAASPAIYAAGLGVSEEEIGDVW
                     VRAMEQPIDPVTVTEAPCQEVVVTGDALKQEGKGLGSLPVPISTPGFDSAPYFTATLC
                     VTRDPENGIRNMGTYRAALKAEDRLGVRMASRLSGAGGYQHWLKYQKMGKPMPCAIVI
                     GCAPAVLFTGPQKLPIDQDELGVAGGLIGEPIRIVKCKTIDLEVPADAEIVIEGLIDP
                     VLLEPEGPFGESHGHVALEDFNMSMQVTAITRKRKPVLVSIVSQVTPSESSVLKRVAY
                     EPLFLNHLKKVLNVKGLKRVVMHEPLTNIRKVIFLEFDRSAPQSEVWRGLQGAATLQA
                     QCGKIIIAVSDDIDSRNADAVFWSLAYRANMIDDVHVTPYRSGGHGPKSGSKSAEGTL
                     LIDATLKAPMPPLALPAEPYMVRARQIWEDLQLPRLTPQPPWHGYSLGDWTDRWTEFA
                     DDAVNGDWRRTGENTLARRKGGMKPETPTRDIEKD"
     misc_feature    complement(198607..199854)
                     /locus_tag="NGR_b02040"
                     /note="3-octaprenyl-4-hydroxybenzoate carboxy-lyase;
                     Region: UbiD; pfam01977"
                     /db_xref="CDD:251009"
     gene            200131..202587
                     /gene="coxL2"
                     /locus_tag="NGR_b02050"
                     /db_xref="GeneID:7789743"
     CDS             200131..202587
                     /gene="coxL2"
                     /locus_tag="NGR_b02050"
                     /EC_number="1.2.99.2"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-monoxide dehydrogenase large subunit"
                     /protein_id="YP_002822424.1"
                     /db_xref="GI:227818453"
                     /db_xref="GeneID:7789743"
                     /translation="MFSKRRGVMTSPLKTAATEVIMHPLKQSKSPSAELSPEMKLVQE
                     ALFKHVGKPIPRKEDGRLITGKGRFSDDFSLPGQTYAAIVRSPYPHARILGIDKAEAL
                     ASPGVLLVLTGEDVLADGLKDIPHNPVPSTNFDMKLRAKDGSHAFTGPHHLLPADKAR
                     HVGEAVAIVVAETAAQAADGAEKVLVDWEELPYVTDTAKAAEPGAPTIWDEVPDNVFI
                     DTTFGDREGTDAAFARADHVVKAEFHIHRVTAVTMEPRASLGHYDPETKRYTLYAGSG
                     GAVRQKNELSKVLGIEPKDLRVLSFDVGGNFGARNRVYVEFGLVLWASRKLGRPVKYT
                     ATRSEAFLTDYQGRDLVTKVELALRKDGRFLAMRADNLSNVGGRAVSLSPLSKGSGLI
                     TGSYDIPYATLRARAVFSNTMCTQAYRSSGRPEVTYAIERMVELAADQLGFDKLELRR
                     MNLIPPSAMPYTNAVGSVYDSGEYEKNMDRALEISEWATFDARKAEAAKRGKLLGRGF
                     ANYVESSIGTPKERAEIEIKDDGNIEVVIGTQPSGQGHETSFAQVVADMIQVPVEKVW
                     IVLGDTDIVSVGGGSHSGRSMRHAGTVMAMASADLLAEGRKRAAELLGSAADEIDFEG
                     GVFKLRNTNRTIDIFELGRRTRQTHGALRVVKDNEMHTPVYPNGAAVCEVEVDRETGH
                     VEIVRYATIDDVGRCINPLIVHGQTHGGIAQGVGQAMWELCAIDPGSGQPLAGSLMDY
                     GMPRSDTMPSFKCEIAEVISPTNPLGIKAGGEGGTTPALATVVNAVVDALQEFGVKDI
                     QMPVTPANVWRAMNNGRKAS"
     misc_feature    200278..202566
                     /gene="coxL2"
                     /locus_tag="NGR_b02050"
                     /note="Aerobic-type carbon monoxide dehydrogenase, large
                     subunit CoxL/CutL homologs [Energy production and
                     conversion]; Region: CoxL; COG1529"
                     /db_xref="CDD:224446"
     misc_feature    200320..200706
                     /gene="coxL2"
                     /locus_tag="NGR_b02050"
                     /note="Aldehyde oxidase and xanthine dehydrogenase, a/b
                     hammerhead domain; Region: Ald_Xan_dh_C; smart01008"
                     /db_xref="CDD:214971"
     misc_feature    200794..202377
                     /gene="coxL2"
                     /locus_tag="NGR_b02050"
                     /note="Molybdopterin-binding domain of aldehyde
                     dehydrogenase; Region: Ald_Xan_dh_C2; pfam02738"
                     /db_xref="CDD:251506"
     gene            202598..203530
                     /locus_tag="NGR_b02060"
                     /db_xref="GeneID:7789744"
     CDS             202598..203530
                     /locus_tag="NGR_b02060"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_002822425.1"
                     /db_xref="GI:227818454"
                     /db_xref="GeneID:7789744"
                     /translation="MSDLKTVRVIAFPGAPNLPTFAAIEQGFFAEEGIEVELALTPSS
                     VAQAEKTAAGEFDIVFTAYDNVVAYGEGQGATAAGVNPDYVVLMGATQLELAIVTAPD
                     VRTYEDLKGRSIALDALTTGFAFVLFEMMAKNGLKRDDVSFAAVGATPQRWQSVKAGE
                     HAATLTIEPFTSIARRADFNVLDVSSNHFDSYQGGVVASRRSYAAENPETVEAFLRGY
                     FKGLEWTLDAKSRDAAAELLKSRMPDIQPAAVPSIMASLLSPRSGLTPGSKILPDGMR
                     TVLDLRSRYGKGSKLTDISKYLDLSFFEAVTGAK"
     misc_feature    202652..203509
                     /locus_tag="NGR_b02060"
                     /note="ABC transporter, substrate-binding protein,
                     aliphatic sulfonates family; Region: SsuA_fam; TIGR01728"
                     /db_xref="CDD:130789"
     misc_feature    202652..203278
                     /locus_tag="NGR_b02060"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     gene            203552..204214
                     /locus_tag="NGR_b02070"
                     /db_xref="GeneID:7789745"
     CDS             203552..204214
                     /locus_tag="NGR_b02070"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase subunit G protein"
                     /protein_id="YP_002822426.1"
                     /db_xref="GI:227818455"
                     /db_xref="GeneID:7789745"
                     /translation="MDMKGEYRIAAPREHVWALINDSAVLKDCIPGCDSLEGTPETGY
                     AARVTTKIGPVKATFAGEVMLSNVQAPESLTISGEGKGGVAGFAKGGADVQLFVDGSE
                     TVLTYIAKAQVGGKLAQLGARLIDSTAKKLADEFFEKLATRAASEAADAGVTERAAAT
                     IVPVKQAKSAETARAASATVEAAAPATAQAVSTAKPPRRFPFVAFGLVAVTVVIIAAL
                     AV"
     misc_feature    203552..203986
                     /locus_tag="NGR_b02070"
                     /note="Carbon monoxide dehydrogenase subunit G (CoxG);
                     Region: CoxG; cd05018"
                     /db_xref="CDD:176853"
     misc_feature    order(203558..203560,203564..203566,203570..203572,
                     203597..203605,203609..203614,203627..203629,
                     203639..203641,203657..203659,203675..203677,
                     203681..203683,203687..203689,203693..203695,
                     203699..203701,203714..203716,203726..203728,
                     203738..203746,203753..203755,203771..203773,
                     203777..203779,203783..203785,203819..203827,
                     203831..203833,203837..203839,203864..203866,
                     203870..203872,203876..203878,203882..203884,
                     203924..203938,203942..203950,203954..203962,
                     203969..203971)
                     /locus_tag="NGR_b02070"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176853"
     gene            204236..204727
                     /gene="coxS"
                     /locus_tag="NGR_b02080"
                     /db_xref="GeneID:7789746"
     CDS             204236..204727
                     /gene="coxS"
                     /locus_tag="NGR_b02080"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-monoxide dehydrogenase small subunit"
                     /protein_id="YP_002822427.1"
                     /db_xref="GI:227818456"
                     /db_xref="GeneID:7789746"
                     /translation="MSRITITINGKAETREVEDRTLLVQFIREHVGLTGTHVGCDTTQ
                     CGACTIHLDGEAVKSCTVLAAAADGCEVTTIEGLADGPKLHPVQQAFHEHHGLQCGYC
                     TPGMIMASVDMIRRHDGVLDEQTVRHELEGNICRCTGYHNIVKAVLDAAEKHRAAHAV
                     AAE"
     misc_feature    204236..204703
                     /gene="coxS"
                     /locus_tag="NGR_b02080"
                     /note="Aerobic-type carbon monoxide dehydrogenase, small
                     subunit CoxS/CutS homologs [Energy production and
                     conversion]; Region: CoxS; COG2080"
                     /db_xref="CDD:224991"
     misc_feature    204245..>204406
                     /gene="coxS"
                     /locus_tag="NGR_b02080"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(204341..204346,204353..204355,204362..204364,
                     204368..204379)
                     /gene="coxS"
                     /locus_tag="NGR_b02080"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(204353..204355,204368..204370,204377..204379)
                     /gene="coxS"
                     /locus_tag="NGR_b02080"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     misc_feature    204455..204682
                     /gene="coxS"
                     /locus_tag="NGR_b02080"
                     /note="[2Fe-2S] binding domain; Region: Fer2_2; pfam01799"
                     /db_xref="CDD:250876"
     gene            204738..205553
                     /locus_tag="NGR_b02090"
                     /db_xref="GeneID:7789747"
     CDS             204738..205553
                     /locus_tag="NGR_b02090"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon monoxide dehydrogenase medium subunit"
                     /protein_id="YP_002822428.1"
                     /db_xref="GI:227818457"
                     /db_xref="GeneID:7789747"
                     /translation="MYATTYHKPRTLAEAVSFYEASEEPSYISGGHTLIPTLKNRLAA
                     PQHLIDLRSIPELSGIAVTPDKVIIGSATKHAVVAASKEVKAAIPALAGLAGSIGDVQ
                     VRHMGTIGGSTANNDPAADYPSAVLSLDAIIHTDRREIPADEYFQGLYTTALEPGEIL
                     VRIEFRIPEIAGYAKFRNPASRYSMAAAFVSKHRDGHVRVAITGAGNEGVFRWTEAEE
                     RLTESLTPAALAGLAIDPSRMMGDMHAPADYRAHLVSVMTRRAVENLGGTHIL"
     misc_feature    204738..205544
                     /locus_tag="NGR_b02090"
                     /note="Aerobic-type carbon monoxide dehydrogenase, middle
                     subunit CoxM/CutM homologs [Energy production and
                     conversion]; Region: CoxM; COG1319"
                     /db_xref="CDD:224238"
     misc_feature    204741..205241
                     /locus_tag="NGR_b02090"
                     /note="FAD binding domain in molybdopterin dehydrogenase;
                     Region: FAD_binding_5; pfam00941"
                     /db_xref="CDD:250245"
     misc_feature    205251..205532
                     /locus_tag="NGR_b02090"
                     /note="CO dehydrogenase flavoprotein C-terminal domain;
                     Region: CO_deh_flav_C; smart01092"
                     /db_xref="CDD:215021"
     gene            205630..207009
                     /locus_tag="NGR_b02100"
                     /db_xref="GeneID:7789748"
     CDS             205630..207009
                     /locus_tag="NGR_b02100"
                     /codon_start=1
                     /transl_table=11
                     /product="DAHP synthetase"
                     /protein_id="YP_002822429.1"
                     /db_xref="GI:227818458"
                     /db_xref="GeneID:7789748"
                     /translation="MAQNWTPSSWRQKLIEQVPDYPDQAALAATEAQLATFPPLVFAG
                     EARRLKKQLASVAEGNAFLLQGGDCAESFVEHGADNIRDFFRSFLQMAVVLTYGAQLP
                     VVKVGRIAGQFAKPRSNSHETQDGRTLLTYRGDIINGTDFTEEARTPDPERQLDAYRQ
                     SAATLNLLRSFAMGGYANLENVHKWMLGFVKESPQSERYRTLADRISEAMNFMRAIGI
                     TTENNPSLRETDFFTSHEALLLGYEEALTRIDSTSGDWYATSSHMIWIGDRTRQLGHA
                     HVEYFRGIKNPIGLKCGPSLEPDSLIELIDALNPMNEAGRLTLICRFGSDKIADRLPK
                     LIRAVEREGRKVVWSCDPMHGNTVTLSGYKTRPFERILSEVESFFQIHRAEGTHPGGI
                     HVEMTGKDVTECTGGARAVTASDLQDRYHTHCDPRLNADQALELAFLLAERMKSRRDE
                     KRTGVWKAV"
     misc_feature    205639..206952
                     /locus_tag="NGR_b02100"
                     /note="Class-II DAHP synthetase family; Region:
                     DAHP_synth_2; pfam01474"
                     /db_xref="CDD:250646"
     gene            207053..207994
                     /locus_tag="NGR_b02110"
                     /db_xref="GeneID:7789749"
     CDS             207053..207994
                     /locus_tag="NGR_b02110"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein"
                     /protein_id="YP_002822430.1"
                     /db_xref="GI:227818459"
                     /db_xref="GeneID:7789749"
                     /translation="MQQRGRPMLRKLDEELPVPQPAVLTDDAAEILAFARDALRSGSR
                     CALVTLVEIRGGAARSLGAHMAVREDGMFCGFVSGGCVEPAVAAEALEAIRAGCDGML
                     VLGQGSKFFDIVLPCGGAITLAIHVLRRNDPLEAVLAALAARKRAGLRYDAAAQSLEF
                     INAATEPGWEEGRFFTSYRPATRVVLCGRSIELRTTISLAEAVGYDVVAVEGAAELRP
                     EQLDADSAVAFLHHDLDREMALLEIALASPAFYIGALGSERTHRRRCDELRRRGFPEA
                     SIARIKAPIGLFAKARDAGSLALSVLADIAACRAAGR"
     misc_feature    207140..207988
                     /locus_tag="NGR_b02110"
                     /note="Xanthine and CO dehydrogenases maturation factor,
                     XdhC/CoxF family [Posttranslational modification, protein
                     turnover, chaperones]; Region: XdhC; COG1975"
                     /db_xref="CDD:224886"
     misc_feature    207158..207367
                     /locus_tag="NGR_b02110"
                     /note="XdhC and CoxI family; Region: XdhC_CoxI; pfam02625"
                     /db_xref="CDD:251428"
     misc_feature    207602..207967
                     /locus_tag="NGR_b02110"
                     /note="XdhC Rossmann domain; Region: XdhC_C; pfam13478"
                     /db_xref="CDD:257802"
     gene            complement(208055..208309)
                     /locus_tag="NGR_b02120"
                     /db_xref="GeneID:7789750"
     CDS             complement(208055..208309)
                     /locus_tag="NGR_b02120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822431.1"
                     /db_xref="GI:227818460"
                     /db_xref="GeneID:7789750"
                     /translation="MSIDAELRKVDAEYAIEYLQEHPESGLCCDDRHCWITPNANETD
                     RQALLLDAVEAERLKDNPRLRLVSGIAHAGRSLWVVRRMT"
     gene            208451..208864
                     /gene="fumA"
                     /locus_tag="NGR_b02130"
                     /db_xref="GeneID:7789751"
     CDS             208451..208864
                     /gene="fumA"
                     /locus_tag="NGR_b02130"
                     /EC_number="4.2.1.2"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate hydratase"
                     /protein_id="YP_002822432.1"
                     /db_xref="GI:227818461"
                     /db_xref="GeneID:7789751"
                     /translation="MSFKDRVVYYVGPVGPVGDEPVGPAGPTTATRMDKYTDMMLELG
                     LLGKVGKAERGPAADASITAHRRAYLMAVGGAAYLVSKAIRSSRVVAFEDLGMKAIFE
                     FDVKDMPVTVAVAADGENVHASGPSYWRQRLPLNR"
     misc_feature    <208457..208828
                     /gene="fumA"
                     /locus_tag="NGR_b02130"
                     /note="Fumarase C-terminus; Region: Fumerase_C; cl00795"
                     /db_xref="CDD:260626"
     gene            complement(208939..210261)
                     /locus_tag="NGR_b02140"
                     /db_xref="GeneID:7789752"
     CDS             complement(208939..210261)
                     /locus_tag="NGR_b02140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822433.1"
                     /db_xref="GI:227818462"
                     /db_xref="GeneID:7789752"
                     /translation="MIKVLTAMQRLLKDQSGNFGLMTALLVPVLFLSGSVALNIANAT
                     REASKMQDALDAAAIKAVRSYGEGESENAVRTEANRLFFANFQTPSATDGYNSASPES
                     PAVEFTFSETGQETRASASYAAQYNPVFWGLQPFVISRRSVAARLTDREACILALHPT
                     ASRAIEVSGSAAVDTSNCTITSNSDDAQSIYLSGTATLSAECLYATGKVYATLAHLEL
                     ACGQAREGVSRTPDPFKKKAVPTAGNWVNLSGCGQGFVGNGGGNGDCNGTGKTPNKVP
                     DGYSVTLKPGTYGELEIKGKVTLQPGNYIIDGGVLKFASQSAVSGEGVTFFLLNGAEI
                     DLHGGSNFHVTAATSGEWAGFVIVSARNNTEPAVINGNSNSSLSGIIYMPASQEIQYS
                     GNGSSGGECVRIIAQEITMIGNSGFAIDCKSELADNKILNPGAIRLVQ"
     misc_feature    complement(<209881..210243)
                     /locus_tag="NGR_b02140"
                     /note="Flp pilus assembly protein TadG [Intracellular
                     trafficking and secretion]; Region: TadG; COG4961"
                     /db_xref="CDD:227296"
     misc_feature    complement(210070..210213)
                     /locus_tag="NGR_b02140"
                     /note="Putative Flp pilus-assembly TadE/G-like; Region:
                     Tad; pfam13400"
                     /db_xref="CDD:257725"
     gene            complement(210554..211537)
                     /locus_tag="NGR_b02150"
                     /db_xref="GeneID:7789753"
     CDS             complement(210554..211537)
                     /locus_tag="NGR_b02150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822434.1"
                     /db_xref="GI:227818463"
                     /db_xref="GeneID:7789753"
                     /translation="MCSRQNDRSSLRARMSVHPIDKLERWLPRSRGAKEGAPVEAFEA
                     SIQTSNPPVAVDGPYGPVRLKWHKLRTHLAEAPFKLSNLALGWQLGASLEVDILATAD
                     ERFAVLHDPTLGPSTTGRGRVARMPIASMRGLFHRNADGAPDPDAPVLALAELVDPLR
                     RLPRAPSANLQLDLKLLEGHTLADSAVTDAAAAVAGLADAIVVGSHHLDDARRLAAAI
                     PGARLGYDPMLAISRQRDLRDPQRLLRHIERRMTGVSLAYLRYDAIVAAENQGFPLVA
                     CLLDLGIETDAWTVNPGRDIDDSILRTLVGARVRQITTDVPSEIFRLIRSL"
     misc_feature    complement(210584..211285)
                     /locus_tag="NGR_b02150"
                     /note="Catalytic domain of phosphoinositide-specific
                     phospholipase C-like phosphodiesterases superfamily;
                     Region: PI-PLCc_GDPD_SF; cl14615"
                     /db_xref="CDD:246675"
     misc_feature    complement(order(210674..210676,210920..210922,
                     211019..211021,211250..211252,211256..211258))
                     /locus_tag="NGR_b02150"
                     /note="active site"
                     /db_xref="CDD:176498"
     misc_feature    complement(211211..211213)
                     /locus_tag="NGR_b02150"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176498"
     gene            complement(211476..212540)
                     /locus_tag="NGR_b02160"
                     /db_xref="GeneID:7789754"
     CDS             complement(211476..212540)
                     /locus_tag="NGR_b02160"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_002822435.1"
                     /db_xref="GI:227818464"
                     /db_xref="GeneID:7789754"
                     /translation="MAKIEFRNVVKRFGAVEVIPDMNLVIEDGEFVALLGPSGCGKST
                     SLFMLAGIYLPSGGELLFDGHVVNEVEARDRNVGIVFQSYALYPHMSVRDNISFPLRF
                     KKTPRDEALAKVKAAAELVRVAELLDRRPAELSGGQQQRVALARALVKEPQLLLLDEP
                     LSNLDASLRLSMRTEIKSLHEQLGVTTVLVTHDQIEATTMADRIICMHAGRIEQVGTP
                     DDLYLRPSSLFVAGFIGSPPINLIAGEAQHGTLTVNGARFPVEGASGLLTVGLRPEHL
                     RFGDTGFAGRIAQIEPMGREILYVVETGLGAVRVLEQGSSAAHSTGEEVRIGFLPEDS
                     LVFETERQKLIAGAHVRAPD"
     misc_feature    complement(211521..212540)
                     /locus_tag="NGR_b02160"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    complement(211893..212531)
                     /locus_tag="NGR_b02160"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    complement(212412..212435)
                     /locus_tag="NGR_b02160"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(order(211965..211967,212064..212069,
                     212295..212297,212409..212417,212421..212426))
                     /locus_tag="NGR_b02160"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(212295..212306)
                     /locus_tag="NGR_b02160"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(212112..212141)
                     /locus_tag="NGR_b02160"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(212064..212081)
                     /locus_tag="NGR_b02160"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(212046..212057)
                     /locus_tag="NGR_b02160"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(211959..211979)
                     /locus_tag="NGR_b02160"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(211530..211736)
                     /locus_tag="NGR_b02160"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(212546..213646)
                     /locus_tag="NGR_b02170"
                     /db_xref="GeneID:7789755"
     CDS             complement(212546..213646)
                     /locus_tag="NGR_b02170"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822436.1"
                     /db_xref="GI:227818465"
                     /db_xref="GeneID:7789755"
                     /translation="MAEQVIPMGSTAASRRGADWDALAARARAVRHAKAVVLYAFLIA
                     VSLPIILPYLWLVTIAFSARTGVAETAVLWRSMAVVVPAIVAFWLTAALAQSRRQVWI
                     GIAAVAAIAAFAFALLVGPDLHVGNFIFLWEPDFASVVRSRIGEVKGAVQFPNVWHAF
                     GNSILIAGAQTAIVVTVASLAAYYLSRFQFPGRSSMLRSLLVLHAFPVLTLIVPMFLM
                     LYWIGLLDTLSGVILVLVAFELPFAIFIMKGFFDAVPWDIEMSALTDGASRRQAFVSV
                     VLPQVRNGILAIAVFTFIRGWEEYIFVFTFLIRNSNWTMSLYMYWVRDDVMGVDYGVV
                     SAVGVFYLVPSLILYMAAQRYLMQMSIGGVKG"
     misc_feature    complement(212552..>213193)
                     /locus_tag="NGR_b02170"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    complement(212609..213169)
                     /locus_tag="NGR_b02170"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(212609..212614,212621..212626,
                     212633..212638,212642..212647,212654..212659,
                     212687..212692,212729..212731,212735..212737,
                     212744..212755,212774..212776,212783..212788,
                     212828..212830,212879..212881,212888..212893,
                     212903..212905,212909..212914,212921..212923,
                     212927..212929,212933..212938,212999..213001,
                     213005..213010,213017..213046,213050..213061,
                     213089..213091,213104..213109,213116..213121))
                     /locus_tag="NGR_b02170"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(212738..212755,212999..213043))
                     /locus_tag="NGR_b02170"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(212657..212659,212687..212689,
                     212696..212698,212735..212737,212951..212953,
                     212999..213001))
                     /locus_tag="NGR_b02170"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(212807..212809,212819..212824,
                     212840..212878))
                     /locus_tag="NGR_b02170"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(213648..214601)
                     /locus_tag="NGR_b02180"
                     /db_xref="GeneID:7789756"
     CDS             complement(213648..214601)
                     /locus_tag="NGR_b02180"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822437.1"
                     /db_xref="GI:227818466"
                     /db_xref="GeneID:7789756"
                     /translation="MTTIADELTIERRGHQGSAARRRTNFVIFLGPAIILTVLFFVVP
                     VIIDITVSFTDLSRSLRISEFTTEQYEKVFRTDRRLSQVIGLTFIYVFGTLAIFNVTF
                     GLILAITTTAIRNVSGSFFRGVWLLPRMSPSVLYILLWLWAVSPTEAGLVNQVLMQAF
                     GLDAPLDLLTSAPIALIIISNGFIGASMGMIIFTAAIRGIPEHLFHAAAVDGAGTFAT
                     IRFITLPALRWPISFVTIYQTLSLLVSFEYILLLTKGGPFYDTTVYALYVYRRAFESG
                     QYGYGAALALFLIVIGVIVALIGWRFFDMERLLQRPRIEVH"
     misc_feature    complement(213693..214541)
                     /locus_tag="NGR_b02180"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    complement(213723..214316)
                     /locus_tag="NGR_b02180"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(213723..213728,213735..213740,
                     213747..213752,213756..213761,213768..213773,
                     213801..213806,213843..213848,213855..213866,
                     213891..213893,213900..213905,213945..213947,
                     213996..213998,214005..214010,214020..214022,
                     214026..214031,214053..214055,214059..214061,
                     214065..214070,214179..214181,214185..214190,
                     214197..214226,214230..214241,214269..214271,
                     214284..214289,214296..214301))
                     /locus_tag="NGR_b02180"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(213849..213866,214179..214223))
                     /locus_tag="NGR_b02180"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(213771..213773,213801..213803,
                     213810..213812,213846..213848,214083..214085,
                     214179..214181))
                     /locus_tag="NGR_b02180"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(213924..213926,213936..213941,
                     213957..213995))
                     /locus_tag="NGR_b02180"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(214678..216480)
                     /locus_tag="NGR_b02190"
                     /db_xref="GeneID:7789757"
     CDS             complement(214678..216480)
                     /locus_tag="NGR_b02190"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="YP_002822438.1"
                     /db_xref="GI:227818467"
                     /db_xref="GeneID:7789757"
                     /translation="MIAGMLERSIKACERAAIIWARNGASASEVTSPTSRLRLARSPR
                     ARSLTWYPSAAAASRTRASVAGAMLAPGVKARETADRDTPASSATAWALTKRPWLLSL
                     LSDTRSTPLDFPHSAFIIVLHSIATINDDTMKTYRCWEKTKMTHWKIGTAALLGAALS
                     VGSAALLAATPLFAQETVKLELWSRQDPSGPLRPGNVVKAAERLNKELEAEGSPKRVE
                     VAVRESPAKGFDDDALQLLKVFGIGEGPDIFIAAHEWICAFQEDGFVLKLDDYIAKYP
                     QHFGTIFPSLWSSAKCPDGTYAIPQDAEARMFFYNKKLLREAGYDAAFVDAMPERALS
                     GDLAMDEVLEIAKKVVDKTKAQYGVLHRPNKGPDYIMVFQAYGSDFADPETGKLLLER
                     DKLAAAFGWFERGVKEKVIPANNTAMEFDALRKEFYTGNAAFWMYGIWDLGSVAFPTY
                     GLPQDEKAFFADWGWITGPAPQKGGKPVSLTHPIVYAIAADTKEPELAVRLLGHASAA
                     DLNTDHAVTTTHLGIKPEQLEDPRYAKAWPLARATELLKITKFLPNNSQFGDLNGIIF
                     AGIQGIESGRLSAQQAADFVIEEASSTLEDVIVK"
     misc_feature    complement(214693..216042)
                     /locus_tag="NGR_b02190"
                     /note="Maltose-binding periplasmic proteins/domains
                     [Carbohydrate transport and metabolism]; Region: MalE;
                     COG2182"
                     /db_xref="CDD:225093"
     misc_feature    complement(214975..215745)
                     /locus_tag="NGR_b02190"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            216107..217186
                     /locus_tag="NGR_b02200"
                     /db_xref="GeneID:7789758"
     CDS             216107..217186
                     /locus_tag="NGR_b02200"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_002822439.1"
                     /db_xref="GI:227818468"
                     /db_xref="GeneID:7789758"
                     /translation="MLCNTIMNALWGKSSGVERVSDSRDNNQGRFVSAQAVAELAGVS
                     RSAVSRAFTPGASIAPATLARVREAAAALGYQVNDLARGLLANRSRLVGLVTSDADAP
                     FRAQMIAALSHALIERSNIPAIISIGPTADDIANASRQLLRYRAEATVFLSGSPPASL
                     VDLTRRNGQPLILINRAETGLDSVHCDDRDGAQQAFEALCMAGATRFAVVNSASPSPS
                     LSAREHAFAEFAAASGFEARIVRAGRSDYGGGQEAARQLLSNGPAPDAVFCVNDLMAF
                     GTLDHLRDAGLRVPHDVSVIGFDDVPIAAWSSYRLTTLRQDPWRIARDVVSILDRRLA
                     DPDSPPISVYVPVELVVRETVMARR"
     misc_feature    216215..217183
                     /locus_tag="NGR_b02200"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    216215..216358
                     /locus_tag="NGR_b02200"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(216233..216247,216251..216256,216263..216265,
                     216278..216283,216290..216292,216329..216331,
                     216338..216340,216347..216352,216356..216358)
                     /locus_tag="NGR_b02200"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    216329..216358
                     /locus_tag="NGR_b02200"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    216377..217168
                     /locus_tag="NGR_b02200"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     gene            217219..218028
                     /locus_tag="NGR_b02210"
                     /db_xref="GeneID:7789759"
     CDS             217219..218028
                     /locus_tag="NGR_b02210"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphoryl diester phosphodiesterase"
                     /protein_id="YP_002822440.1"
                     /db_xref="GI:227818469"
                     /db_xref="GeneID:7789759"
                     /translation="MAFSFFAHEQGRVHVCGHRGYSLHYPENTLPAFEAAKAAGATTV
                     EIDVVLTADGEPIILHDLTVDRTTDGRGFAADLCLEQIRSLDAGGRFHPAFAGTKIPT
                     VAEALDWVKADDMGVVLEIKEAERPDIAVDRVAALLRSTGTVDRVIVISFDHVVLKRA
                     VERHPDLRTEAITHARHADLVGVLKACRASSVSIELDMFRPDDARALHEAGFSNRVHV
                     PRPDVLAEFWRSGRDPLPDLVQWIADGLIDTISGDDVPFIAMLVGRAGRAG"
     misc_feature    217252..217923
                     /locus_tag="NGR_b02210"
                     /note="Glycerophosphoryl diester phosphodiesterase [Energy
                     production and conversion]; Region: UgpQ; COG0584"
                     /db_xref="CDD:223657"
     misc_feature    217267..217917
                     /locus_tag="NGR_b02210"
                     /note="Catalytic domain of phosphoinositide-specific
                     phospholipase C-like phosphodiesterases superfamily;
                     Region: PI-PLCc_GDPD_SF; cl14615"
                     /db_xref="CDD:246675"
     misc_feature    order(217270..217272,217351..217353,217357..217359,
                     217576..217578,217672..217674,217867..217869)
                     /locus_tag="NGR_b02210"
                     /note="active site"
                     /db_xref="CDD:176498"
     misc_feature    order(217270..217272,217396..217398)
                     /locus_tag="NGR_b02210"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176498"
     gene            218221..219738
                     /locus_tag="NGR_b02220"
                     /db_xref="GeneID:7789760"
     CDS             218221..219738
                     /locus_tag="NGR_b02220"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_002822441.1"
                     /db_xref="GI:227818470"
                     /db_xref="GeneID:7789760"
                     /translation="MKAVFVLFDSLNRHVLAPYGGRRVPTPNFTRLAERAATFDRHYV
                     GSLPCMPARRDLQTGRLDFLHRSWGPLEPFDNSFPELLHRAGFYSHLVTDHFHYFEDG
                     GATYHTRYDSYDFIRGQEGDPWKAMVQPPWERLRQMYHERQFSQSARDKFRRNIVNRE
                     FIKDESAFPSVRCFSAGLEFLERNRTADNWLLQIETFDPHEPFTAPERFREAFRTGWN
                     GPVRDWPRYGRVDELPEECEELRANYYAVMALCDFLVGQLLDYFDRHDLWRDTALVVT
                     TDHGFLLGEHDFWAKNRMNMYEEIVHIPLFLRDPRRPGSAGTRRSALTQTIDLAPTFL
                     DLFDVPAAAEIEGHSLLPLLDADRSLRQGALFGYFGGAINVTDGRYTYHRFPPDLRSQ
                     ELYQYTLMPTHIWEPFTPEELAGASLAQPMSFTKGAPVLKIPVIERSPMFDNYGPGAL
                     LESETRLYDLADDPGQNTPLYSPEIEEAMTRLMRDLMRSNDAPPEAFARIGIEAQ"
     misc_feature    218221..219384
                     /locus_tag="NGR_b02220"
                     /note="Arylsulfatase A and related enzymes [Inorganic ion
                     transport and metabolism]; Region: AslA; COG3119"
                     /db_xref="CDD:225661"
     misc_feature    218230..219237
                     /locus_tag="NGR_b02220"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            220070..220867
                     /locus_tag="NGR_b02230"
                     /db_xref="GeneID:7789761"
     CDS             220070..220867
                     /locus_tag="NGR_b02230"
                     /EC_number="3.1.3.25"
                     /note="IMPase; Inositol-1-phosphatase; I-1-Pase"
                     /codon_start=1
                     /transl_table=11
                     /product="Inositol-1-monophosphatase"
                     /protein_id="YP_002822442.1"
                     /db_xref="GI:227818471"
                     /db_xref="GeneID:7789761"
                     /translation="MSMHEAGLDRRFALAKSIAEEAGALALDYFNKRDTLVIETKRDP
                     QDVVSIADRNVETLIRERVAAELPEDGFLGEEFSPVEGASGYTWVVDPIDGTAPFVNG
                     MSTWCVSIAVLHGGVPVIGVIHAPCDGEVYASAAGKGASLNGRKLSLDPSRTIQNAIT
                     GIGCNTHVEPERVGQIIATLLGMGGNFIRNGSGALMLAYVAAGRLVGYYEPHMHAWDC
                     MAGYCLVKEAGGDHLSFPAEGEALLKGHPVLASNPTAYADLLAIHGR"
     misc_feature    220103..220831
                     /locus_tag="NGR_b02230"
                     /note="Bacterial family of Mg++ dependent phosphatases,
                     related to inositol monophosphatases. These enzymes may
                     dephosphorylate inositol monophosphate or similar
                     substrates; Region: Bacterial_IMPase_like_2; cd01643"
                     /db_xref="CDD:238821"
     misc_feature    order(220223..220225,220292..220297,220340..220351,
                     220355..220357,220715..220720)
                     /locus_tag="NGR_b02230"
                     /note="active site"
                     /db_xref="CDD:238821"
     gene            220899..221174
                     /locus_tag="NGR_b02240"
                     /db_xref="GeneID:7789762"
     CDS             220899..221174
                     /locus_tag="NGR_b02240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822443.1"
                     /db_xref="GI:227818472"
                     /db_xref="GeneID:7789762"
                     /translation="MPIFANAAIVICMGTMNISLPDHLKSFVDEQVAGGGYGSTSEYI
                     RELIRRDQDRLALRRLLLDGASSAQTEPVDEHYFTSLRDRVHGQRTT"
     misc_feature    220941..>221057
                     /locus_tag="NGR_b02240"
                     /note="Uncharacterized protein family (UPF0156); Region:
                     RHH_2; cl17383"
                     /db_xref="CDD:247937"
     gene            221298..221495
                     /locus_tag="NGR_b02250"
                     /db_xref="GeneID:7789763"
     CDS             221298..221495
                     /locus_tag="NGR_b02250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822444.1"
                     /db_xref="GI:227818473"
                     /db_xref="GeneID:7789763"
                     /translation="MIASHPGSGSLRYAYELGLPDLRTVSLKRYPYLVFYRDQPGHVD
                     VWRVLHAKRDIPQWMQEPNSH"
     misc_feature    <221298..221480
                     /locus_tag="NGR_b02250"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            222054..222845
                     /locus_tag="NGR_b02260"
                     /db_xref="GeneID:7789764"
     CDS             222054..222845
                     /locus_tag="NGR_b02260"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_002822445.1"
                     /db_xref="GI:227818474"
                     /db_xref="GeneID:7789764"
                     /translation="MYLTNSTMSNIEDCNKVLPKSKIVMLAKTDLFAECLTQAISARF
                     QDQDIVSLADADGLLDHNLIDVSLVILYSLPAAEFPSIMRTIHEFHPKAAVGVMVQNA
                     DELDSSIADLVDEGLVHGVLPLNLNLDVCLTAIDLLMKGGEHFPAALLRRLAPGGLAG
                     SGVLGQKPASSEDVDMERKTDFAQGLLRMREIQILDLICVGTPNKIIAHRLGLSENTV
                     KVHVRNIYKKMNVHNRTEAASRCFRSDADLASLPRSCADAPEVSA"
     misc_feature    222117..222782
                     /locus_tag="NGR_b02260"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    222621..222782
                     /locus_tag="NGR_b02260"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(222621..222623,222660..222668,222690..222695,
                     222699..222704,222708..222722,222753..222755)
                     /locus_tag="NGR_b02260"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(222648..222650,222654..222656,222660..222662,
                     222753..222761,222768..222770,222777..222782)
                     /locus_tag="NGR_b02260"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(223044..223349)
                     /locus_tag="NGR_b02270"
                     /db_xref="GeneID:7789765"
     CDS             complement(223044..223349)
                     /locus_tag="NGR_b02270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822446.1"
                     /db_xref="GI:227818475"
                     /db_xref="GeneID:7789765"
                     /translation="MAEPDRWRHMASAPKNGSRILVTIRPSEQGAAEVDLAYWSNGDQ
                     FGAEGWRASDSSPGRIIEYAEPELKCWMPMPSANLNRITMPSPWEGDDDQELNGSGI"
     gene            complement(223445..224449)
                     /locus_tag="NGR_b02280"
                     /db_xref="GeneID:7789766"
     CDS             complement(223445..224449)
                     /locus_tag="NGR_b02280"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_002822447.1"
                     /db_xref="GI:227818476"
                     /db_xref="GeneID:7789766"
                     /translation="MQIIQNRRTFVAGAAAAGAVSFFGKATKAWAEPPAETTRITLVR
                     IPSICQAPQYVAEELLRSEGFTDVRYLQKEGTADIAPALASGEADLNGHFAAPLLLHL
                     EAGDPIVILAGLHVGCFELFGTDRVQAIRDLKGKTVAVPTLDSSRYVFLASITAYVGL
                     DLHKDIHFVTHPGPESIRLLSEGKIDAYLGFPPEPQEMRERQIGHVVISSTVDRPWSQ
                     YFCCMLAGNREFVRAYPVATKRALRAILKAADFCASEPEQSAQFMVEQGYAKRYDHAL
                     QVVKALPYGWREYSAEDTLRFYALRLHEVGMLKSSPEKLLAQGTDWRFLNELKKELKS
                     "
     misc_feature    complement(223448..224365)
                     /locus_tag="NGR_b02280"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(223679..224350)
                     /locus_tag="NGR_b02280"
                     /note="NMT1-like family; Region: NMT1_2; cl17432"
                     /db_xref="CDD:266680"
     gene            complement(224581..225072)
                     /locus_tag="NGR_b02290"
                     /db_xref="GeneID:7789767"
     CDS             complement(224581..225072)
                     /locus_tag="NGR_b02290"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822448.1"
                     /db_xref="GI:227818477"
                     /db_xref="GeneID:7789767"
                     /translation="MLVTNTCGVEPRPCTEPPLFFDARSGSRRRWISRQDGRIVENDK
                     NAVAENGAQHALGGYRVVPNEGKPFGTQQRSRDIPGGDRDRECASVPGGRLEKSSEGL
                     RQTQRSNLRRAYPFAFPAGISRASDKSGMRKNVCGFPPASRSNLLESITLMILGRSGL
                     KSS"
     gene            225081..225353
                     /locus_tag="NGR_b02300"
                     /db_xref="GeneID:7789768"
     CDS             225081..225353
                     /locus_tag="NGR_b02300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822449.1"
                     /db_xref="GI:227818478"
                     /db_xref="GeneID:7789768"
                     /translation="MSGLTGLRGRLLSSRELDHDVSSAKKAAKSGSVIITSRGKPSHV
                     LMTYDEFERLRGRHRSLVDALAMPGLSAIDFEPHRVEIRPRDVDLS"
     misc_feature    <225153..225263
                     /locus_tag="NGR_b02300"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; cl09153"
                     /db_xref="CDD:263731"
     gene            complement(225526..226155)
                     /locus_tag="NGR_b02310"
                     /db_xref="GeneID:7789769"
     CDS             complement(225526..226155)
                     /locus_tag="NGR_b02310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822450.1"
                     /db_xref="GI:227818479"
                     /db_xref="GeneID:7789769"
                     /translation="MSSGEFSKPEGGLVPAMQRKSPRDGRPSEGTFSAASPFPVARGP
                     CQPGSPVRSASTLPTFRKGLSMSSLTLRDIARKLKKIDFCMMATKASSGAIANRPMSN
                     NGDVEYDGDSWFFSFEDTHKVSDIIRDPRITLAFAEPPSLLGKPGIFISIEGAATLIR
                     DKAQFQEHWVADLERWFAQGVETPGLVLIKVHGDRIQYWDSEDNGVIHV"
     misc_feature    complement(225541..225960)
                     /locus_tag="NGR_b02310"
                     /note="Uncharacterized stress protein (general stress
                     protein 26) [General function prediction only]; Region:
                     COG3871"
                     /db_xref="CDD:226389"
     misc_feature    complement(225667..225924)
                     /locus_tag="NGR_b02310"
                     /note="Pyridoxamine 5'-phosphate oxidase; Region:
                     Pyridox_oxidase; pfam01243"
                     /db_xref="CDD:250471"
     gene            226299..226979
                     /locus_tag="NGR_b02320"
                     /db_xref="GeneID:7789770"
     CDS             226299..226979
                     /locus_tag="NGR_b02320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822451.1"
                     /db_xref="GI:227818480"
                     /db_xref="GeneID:7789770"
                     /translation="METSLYLPIKGFLEKAGYVVKGEVGGCDLVGLSDDDPPVVVICE
                     LKLSFNLELILQAVDRAAIADEVWIAARVSAKGKGREADKRYRDLCRRLGIGMLGISD
                     AGEVSVIVGSVSPMPRTNPKRRSRLMREHQRRRGDPAVGGSTRTPVMTAYRQQALGCA
                     AALASGPLRVREIRCRVPDAGKILLSNVYGWFERLDRGVYGLTDAGREALQRWPQQDV
                     PATIAVPA"
     misc_feature    226302..226976
                     /locus_tag="NGR_b02320"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5482"
                     /db_xref="CDD:227769"
     gene            complement(227176..228117)
                     /locus_tag="NGR_b02330"
                     /db_xref="GeneID:7789771"
     CDS             complement(227176..228117)
                     /locus_tag="NGR_b02330"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="YP_002822452.1"
                     /db_xref="GI:227818481"
                     /db_xref="GeneID:7789771"
                     /translation="MDALEILFTASFWVAAIRIASPLIFATMGELICERAGVLNLGIE
                     GIMTAGAFAGWFTVYSGGDLWAGLLVAALVGAMFGLLHATLTVPLGLSQHVVGIGVTL
                     LATSLTYFIYRLALPEVTSPPKIEPFQPLPLPGLSSIPVVGEALFTQTPLTYLAFVSV
                     AAVAWILYRTPIGLAVRAAGENPSAVEAQGISVTGIRMGAVAVGSALMAVGGAFLTTS
                     AFNSFFFQMINGRGWICIALVVFGSWRPGKALIGAILFAAFDAYQVRLQQISGGIVPY
                     QAFLMMPYALSILALILVARRATYPKALMIPYQKGER"
     misc_feature    complement(227245..228060)
                     /locus_tag="NGR_b02330"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(227512..227568)
                     /locus_tag="NGR_b02330"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(228119..229168)
                     /locus_tag="NGR_b02340"
                     /db_xref="GeneID:7789772"
     CDS             complement(228119..229168)
                     /locus_tag="NGR_b02340"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="YP_002822453.1"
                     /db_xref="GI:227818482"
                     /db_xref="GeneID:7789772"
                     /translation="MRLEPKPAPSLAVTLLFPLAAIATTLMLTSILVLAAGASPLSVF
                     YLVAKGAAGSQFALLETLTRATPLIFTGLAIAVAFRAKLWNIGAEAQLYIGGVVTVVL
                     GTGALPLPSAILIPVIIVAVMAAGALLLLGPAVLKTRFGVDEVVTTLLLNFIVLLFVS
                     MLLEGVLKDPMGLGWPQSQKVIAEAQLPRLIQGKRLHCGFVIALASAVLVWVVMKKTV
                     LGYEMRAVGLNPEGARFVGIPVNRALMKTALLSGGLAALAGFSEVSGLKGNLTLDLSP
                     GYGYTGIVVAMLAMLNPLGVIASAIFVAGIFVGADAMSRAAKVPSYIADVMVATSLLT
                     MVVAILLTRFWIRWR"
     misc_feature    complement(228164..228976)
                     /locus_tag="NGR_b02340"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(228422..228478)
                     /locus_tag="NGR_b02340"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(229158..230687)
                     /locus_tag="NGR_b02350"
                     /db_xref="GeneID:7789773"
     CDS             complement(229158..230687)
                     /locus_tag="NGR_b02350"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_002822454.1"
                     /db_xref="GI:227818483"
                     /db_xref="GeneID:7789773"
                     /translation="MSSNPALRLSRISKRFGPLRANEAISFDLKRGEVIALLGENGAG
                     KTTLMNILFGHYVADEGTVEAFGKPLPPGDPGAALDAGIGMVHQHFTLADNMTVQENI
                     ALGTQRLWRMRLDRAAVRRRIEQLSADFGLAVDPAATVSTLSVGERQRVEILKALYRE
                     ARILILDEPTAVLTPAETDALFRTLKLLVAKGLSIIFISHKLHEVMAVSDRVLVLRSG
                     QLVGERETGSTDRKELAALMVGREIKPAEVSPLKLGAPLLALERISTTPYNGAGLDEV
                     SLTLTAGEITGIAGVAGNGQAVLAALIAGIRHPTSGSISIAGREVADWSPRAALAHGV
                     ARIPEDRHAVGSIGDMSVAENVIAERYRSPRFSRMGFLNWKEAGRFAEKLIADYDVKC
                     PSPEARMRLLSGGNMQKLILGRALDPDPAVILASQPTRGLDVGAVAYVHRMLLEARDR
                     GAAILLISEDLEEILALSDRIIVMSKGRFSTPSSRGERTIPELGELMAGHSGEHSDHA
                     A"
     misc_feature    complement(229191..230675)
                     /locus_tag="NGR_b02350"
                     /note="ABC-type uncharacterized transport systems, ATPase
                     components [General function prediction only]; Region:
                     COG3845"
                     /db_xref="CDD:226364"
     misc_feature    complement(230019..230669)
                     /locus_tag="NGR_b02350"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(230550..230573)
                     /locus_tag="NGR_b02350"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(230088..230090,230184..230189,
                     230424..230426,230547..230555,230559..230564))
                     /locus_tag="NGR_b02350"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(230424..230435)
                     /locus_tag="NGR_b02350"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(230232..230261)
                     /locus_tag="NGR_b02350"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(230184..230201)
                     /locus_tag="NGR_b02350"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(230166..230177)
                     /locus_tag="NGR_b02350"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(230082..230102)
                     /locus_tag="NGR_b02350"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(229251..229928)
                     /locus_tag="NGR_b02350"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(230820..231845)
                     /locus_tag="NGR_b02360"
                     /db_xref="GeneID:7789774"
     CDS             complement(230820..231845)
                     /locus_tag="NGR_b02360"
                     /codon_start=1
                     /transl_table=11
                     /product="lipoprotein periplasmic protein"
                     /protein_id="YP_002822455.1"
                     /db_xref="GI:227818484"
                     /db_xref="GeneID:7789774"
                     /translation="MHSDSFKFAISRRALIKTAGASALVAAAGLPSRLFAADPIKVAA
                     IYTVPVEQQWVSRIHKAANAAKERGDIEYVYSENTANNDYERVMREYCEAGHKLVLGE
                     VFGVEDAARAVAKDYPDVAFLMGSSFKPDAAVPNFSVFDNYIQDASYLSGLIAGAMTK
                     SKNIGMVGGYPIPEVNRLMNAFMAGVKEVAPDTKFQVAFIGSWFDPPKAKETAFAQID
                     GGADLLYAERFGVSDAAKERKILAIGNVIDTQADYPDTVVASALWHFEPTLDKAIAEV
                     KAGTFKADDYGVYSFMKNGGCSLAPLGTFDGKVPDDIKAKVAEKEKMIKGGSFTVEIN
                     DAEPKSS"
     misc_feature    complement(230988..231725)
                     /locus_tag="NGR_b02360"
                     /note="Periplasmic binding domain of the basic membrane
                     lipoprotein Med in Bacillus and its close homologs from
                     other bacteria and Archaea; Region: PBP1_BmpA_Med_like;
                     cd06353"
                     /db_xref="CDD:107348"
     misc_feature    complement(order(231057..231059,231108..231110,
                     231237..231239,231321..231323,231468..231470,
                     231681..231683,231702..231707))
                     /locus_tag="NGR_b02360"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107348"
     gene            231937..232230
                     /locus_tag="NGR_b02370"
                     /db_xref="GeneID:7789775"
     CDS             231937..232230
                     /locus_tag="NGR_b02370"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822456.1"
                     /db_xref="GI:227818485"
                     /db_xref="GeneID:7789775"
                     /translation="MRRKVHRAFKGGSRRFGVLGIADNPDNAIFSHHGLLEGQDYDYP
                     GLVDVEKIRDEILLENADICGPVPFMRMQHDQLLGLGIPEAHIHYGIRPEFIC"
     misc_feature    <232051..232203
                     /locus_tag="NGR_b02370"
                     /note="Ferredoxin reductase (FNR), an FAD and NAD(P)
                     binding protein, was intially identified as a chloroplast
                     reductase activity, catalyzing the electron transfer from
                     reduced iron-sulfur protein ferredoxin to NADP+ as the
                     final step in the electron transport...; Region: FNR_like;
                     cl06868"
                     /db_xref="CDD:263080"
     gene            complement(232413..233219)
                     /locus_tag="NGR_b02380"
                     /db_xref="GeneID:7789776"
     CDS             complement(232413..233219)
                     /locus_tag="NGR_b02380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822457.1"
                     /db_xref="GI:227818486"
                     /db_xref="GeneID:7789776"
                     /translation="MERTLLKIAATAMLLLAPAIAQAAEGYATANVNMRAGPSTAYPA
                     ITVIPAGESIEIYGCLADVPWCDVEFYDGRGWVHGRYIQALYQQRRVYVGPQYYGRLG
                     IPVVVFSFSSYWDRHYRDRDFYRDRARWRRGPEFYRGPDRRAAPGRASRGPDFERPAP
                     PPEFERRLERSPDFSRTPERRRDFDDRPDRVPDFDRTPNRRPNVDRQPDFDRDLPSGN
                     RSRRNLERGGDDGNRVIRRGDDNRSRSGGDNERRRPQRRVCQPGDPECPN"
     misc_feature    complement(232779..233219)
                     /locus_tag="NGR_b02380"
                     /note="Uncharacterized protein with a bacterial SH3 domain
                     homologue [Function unknown]; Region: COG4991"
                     /db_xref="CDD:227324"
     misc_feature    complement(232971..233132)
                     /locus_tag="NGR_b02380"
                     /note="Bacterial SH3 domain; Region: SH3_3; pfam08239"
                     /db_xref="CDD:254683"
     gene            233680..235437
                     /locus_tag="NGR_b02390"
                     /db_xref="GeneID:7789777"
     CDS             233680..235437
                     /locus_tag="NGR_b02390"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome biogenesis protein"
                     /protein_id="YP_002822458.1"
                     /db_xref="GI:227818487"
                     /db_xref="GeneID:7789777"
                     /translation="MILFTIAYIAGVLTIVSPCILPVLPFVFSRAGQPFTRSILPMLI
                     GKVVTFAAVATLVAIGGDWAVHANEAGRYAAIAVLAVFSVMLLSPQFAAVVTRPAVTL
                     GDRLSQRAAGQKTSVGASLLLGVATGLLWAPCAGPVLGLVLTGAALHGANVGTTLLLT
                     AYAAGAATSLALAVLAGGRIFAAMKRSLGIGERLRQGLGIAVLAGVAAIALGLDTGLL
                     ARLSFAGTTDLEQSLLNRLVSDSPEAALSQSATPAVGGQQQAYRSNLPVEGIFPPLDG
                     AVEWLNSKPLTVEELRGKVVLVDFWTYSCINCIRTIPYVRAWAEKYRDQGLVVIGVHA
                     PEFAFEKRIDNVRKAVRDFEIGYPVAIDNDFSIWRAFGNSYWPAHYFIDAEGRIRHRH
                     FGEGDYDQSERVIQELLAETAGSRRGDGLVKPDTKGTEAAPDLANLQSGEDYLGYVRA
                     GNFVSPEGVAADKARDYSVGRPRLNRWGLTGNWTVGAEQATLNRTGGSITYRFNARDL
                     HLVLGPGAGGRQVRFQVKVDGVAPGADSGSDIDPGGNGTVSETRLYQLVRQSGEVRER
                     TFEIRFLDPGVEAFVFTFG"
     misc_feature    233680..234318
                     /locus_tag="NGR_b02390"
                     /note="Cytochrome c biogenesis protein [Posttranslational
                     modification, protein turnover, chaperones]; Region: CcdA;
                     COG0785"
                     /db_xref="CDD:223856"
     misc_feature    234493..234867
                     /locus_tag="NGR_b02390"
                     /note="TlpA-like family, DipZ-like subfamily; composed
                     uncharacterized proteins containing a TlpA-like TRX
                     domain. Some members show domain architectures similar to
                     that of E. coli DipZ protein (also known as DsbD). The
                     only eukaryotic members of the TlpA...; Region:
                     TlpA_like_DipZ_like; cd03012"
                     /db_xref="CDD:239310"
     misc_feature    order(234592..234594,234601..234603)
                     /locus_tag="NGR_b02390"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239310"
     gene            235778..236581
                     /locus_tag="NGR_b02400"
                     /db_xref="GeneID:7789778"
     CDS             235778..236581
                     /locus_tag="NGR_b02400"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_002822459.1"
                     /db_xref="GI:227818488"
                     /db_xref="GeneID:7789778"
                     /translation="MTQKSKGTALITGASSGIGAIYADRLARRGYDLILVARNQSRLN
                     ELAKRLADETERAIEVVAADLGNKPDLGRVEQILRTDASITLLVNNAGVGATGPLLTS
                     DVDKMEEMITLNVNALTRLTYAVVPGLVARGTGAIINIASIVGIAPEVLNGVYGASKA
                     FVLAFTLSLQKELADRNIRIQAVLPGATATDFWDIAGTPLEHVPSEIVMPAEVMVDAA
                     LAGFDLGEQITIPSLPEAADWEAYEAARQTLMPNLSLRTPAARYRSAAF"
     misc_feature    235778..236566
                     /locus_tag="NGR_b02400"
                     /note="Short-chain dehydrogenases of various substrate
                     specificities [General function prediction only]; Region:
                     DltE; COG0300"
                     /db_xref="CDD:223377"
     misc_feature    235802..236464
                     /locus_tag="NGR_b02400"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(235814..235816,235820..235825,235829..235831,
                     235886..235894,236045..236053,236195..236203,
                     236240..236242,236252..236254,236330..236341)
                     /locus_tag="NGR_b02400"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(236117..236119,236201..236203,236240..236242,
                     236252..236254)
                     /locus_tag="NGR_b02400"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            236639..238228
                     /locus_tag="NGR_b02410"
                     /db_xref="GeneID:7789779"
     CDS             236639..238228
                     /locus_tag="NGR_b02410"
                     /codon_start=1
                     /transl_table=11
                     /product="EmrB/QacA subfamily drug resistance transporter"
                     /protein_id="YP_002822460.1"
                     /db_xref="GI:227818489"
                     /db_xref="GeneID:7789779"
                     /translation="MSTPPLTRQNLLFLATGLAGSFLVNLSAQFTSANISDIQQGLLA
                     GADEGSWITTAYTMGSCVGIVTSGLLIGALSIGRYLVVSSILFAAAALAGASTSELGA
                     MVALRSLQGFAAGGFGPAAFVAVFMVAGGPRLAHAVIILAFALLFSGTAGAAIAGYVS
                     DSFGWRGLFAVQAAIGAALALAACLWVPHKALNWSALRADWRSIILLSLALASLMLVL
                     NQGARRFWFANEIIVWGTALTAAAWASFIFVSRSSPVPIVAPRLLLTQKFGLPIGLNF
                     LLRAGLAVSSYLVPQFLATVEGYRPLDVSELMLWAAAAQLLALPLVWWFLHLCDLRVA
                     MAIGVVLLLSGIILMGSEATTSAREYFHYGLAIYAAGQLLLLTPAMIVGTGSLKPADL
                     PTASLTFNISNLAGTTLGVGILSSFVAERQKFHSDALTEAASLYRASDGEWVSGLVGA
                     VAGRVASDAGATVRAAAQIGSAARRQAWALAFGDGFLVVALMLVLGIVAVVAIGRSPP
                     IPRPVKFFRREKPLETENHVA"
     misc_feature    236672..237940
                     /locus_tag="NGR_b02410"
                     /note="drug resistance transporter, EmrB/QacA subfamily;
                     Region: efflux_EmrB; TIGR00711"
                     /db_xref="CDD:129794"
     misc_feature    236678..>237151
                     /locus_tag="NGR_b02410"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(236720..236722,236729..236737,236741..236746,
                     236795..236797,236804..236809,236816..236818,
                     236828..236833,236837..236842,236978..236983,
                     236990..236995,237002..237007,237014..237016,
                     237050..237055,237062..237067,237083..237085)
                     /locus_tag="NGR_b02410"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            238251..239336
                     /locus_tag="NGR_b02420"
                     /db_xref="GeneID:7789780"
     CDS             238251..239336
                     /locus_tag="NGR_b02420"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002822461.1"
                     /db_xref="GI:227818490"
                     /db_xref="GeneID:7789780"
                     /translation="MCTKAKCVTQNFPDRDALQARIGETAWQFASSRNIVSRKNPARK
                     LPPMHRVGFVVFPRFQLMGFAAVTAFEMANSAIGGPAYGIELLSEAGGEVKSSAGFGV
                     LTKSFDDTPYETVIFGAGATIEPITPGLIAFARHALETSRRVAAPCTGAFVLAEAGLL
                     DGRRATTHWAFARQLQERFPAVKVEDDRIFIVDGSVWTSAGMTASIDLALAMIEKDHG
                     QDVARCVARKLVVYHRRAGGQSQFSALLELEPKSDRIQKSIDYAKANLRGALSVEDLA
                     DAAGLSPRQFSRAFRSETGQSPAKAVENLRVEAARLMMEQGRHSMDVIAVETGFADPD
                     RMRRAFLRTLGQPPQTIRRNARDRVSA"
     misc_feature    238371..239324
                     /locus_tag="NGR_b02420"
                     /note="Transcriptional regulator containing an amidase
                     domain and an AraC-type DNA-binding HTH domain
                     [Transcription]; Region: COG4977"
                     /db_xref="CDD:227311"
     misc_feature    238401..238946
                     /locus_tag="NGR_b02420"
                     /note="AraC transcriptional regulators having a Type 1
                     glutamine amidotransferase (GATase1)-like domain; Region:
                     GATase1_AraC_1; cd03137"
                     /db_xref="CDD:153231"
     misc_feature    238692..238694
                     /locus_tag="NGR_b02420"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153231"
     misc_feature    239037..239144
                     /locus_tag="NGR_b02420"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            239481..240527
                     /locus_tag="NGR_b02430"
                     /db_xref="GeneID:7789781"
     CDS             239481..240527
                     /locus_tag="NGR_b02430"
                     /codon_start=1
                     /transl_table=11
                     /product="epoxide hydrolase"
                     /protein_id="YP_002822462.1"
                     /db_xref="GI:227818491"
                     /db_xref="GeneID:7789781"
                     /translation="MTGEINSQRRRFVGAAALTLAAAQLGMTSLAAAKSASEAGIPAI
                     TPGTNTSFTSFKQIEAGVLNVGYAELGAGDAPVVILLHGWPYDIHTYVDVAPLLAEAG
                     YRVIVPYLRGYGTTRFISEDTPRNGQQSAIAADTVALMDALGIGKAIIGGCDWGARTA
                     NILAALWPERCKALVSVSGYLIGSREANKMPLPPGAEHAWWYQFYFATERGRAGYERN
                     RKEFARLIWQLASPKWNFDDVTFDRSAAALENPDHVDITIHNYRWRISLADGEPKYDN
                     LEERLAKLPLIGVPTITLEGDANGAPHPKPAAYAKKFSGKYEHRLITGGIGHNLPQEA
                     PRAFAKAVIDVDRF"
     misc_feature    239652..240521
                     /locus_tag="NGR_b02430"
                     /note="Predicted hydrolases or acyltransferases
                     (alpha/beta hydrolase superfamily) [General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     misc_feature    239667..>239975
                     /locus_tag="NGR_b02430"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            240937..241353
                     /locus_tag="NGR_b02440"
                     /db_xref="GeneID:7789782"
     CDS             240937..241353
                     /locus_tag="NGR_b02440"
                     /codon_start=1
                     /transl_table=11
                     /product="OsmC-like protein"
                     /protein_id="YP_002822463.1"
                     /db_xref="GI:227818492"
                     /db_xref="GeneID:7789782"
                     /translation="MTETEKVLYTGKTRTTGGREGASRSSDGRLDVKLSLPGSSKPGT
                     NPEQLFAAGWSACFIGAIGKAASERKVTLPVDLAVDAEVDLFHDAGAYSLQARLNVNM
                     PGIERDTAQALVERAHQTCPYSKATRGNIDVAISIV"
     misc_feature    240958..241347
                     /locus_tag="NGR_b02440"
                     /note="peroxiredoxin, Ohr subfamily; Region:
                     organ_hyd_perox; TIGR03561"
                     /db_xref="CDD:234259"
     gene            241492..242157
                     /locus_tag="NGR_b02450"
                     /db_xref="GeneID:7789783"
     CDS             241492..242157
                     /locus_tag="NGR_b02450"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="YP_002822464.1"
                     /db_xref="GI:227818493"
                     /db_xref="GeneID:7789783"
                     /translation="MTTATNSERARPLDMKLEVIVVPVTNVDRAKEFYASLGWRLDAD
                     FADGEAFRVIQFTPPGSGASVIFGTNVTDAAPGSARGLYLIVSDIEAARDDLRRRGVD
                     VSEVFHAGDVHAGDDEPYLFGRLRVGGADPERRSYRSYASFSDPDGNGWLFQEVTARL
                     PGRVDASTTTFASAADLASAFRRAEAAHGDYEKQLGHRDEDWPTWYADYMVREQTSAP
                     QPS"
     misc_feature    241546..241956
                     /locus_tag="NGR_b02450"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(241546..241548,241558..241560,241648..241650,
                     241687..241689,241693..241695,241732..241734,
                     241915..241917,241939..241941,241945..241947)
                     /locus_tag="NGR_b02450"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(241546..241548,241732..241734,241945..241947)
                     /locus_tag="NGR_b02450"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            242188..243396
                     /locus_tag="NGR_b02460"
                     /db_xref="GeneID:7789784"
     CDS             242188..243396
                     /locus_tag="NGR_b02460"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FAD/FMN-binding protein"
                     /protein_id="YP_002822465.1"
                     /db_xref="GI:227818494"
                     /db_xref="GeneID:7789784"
                     /translation="MQHRGTLFEPLQLPCGLTLKNRIAKSAMSDSLGDGTGHPTAEQT
                     RLYQRWAEGGLAVSIIGEVQLTGCYAENPGNLVLNEASNLDRFRELARHGSENGTKLW
                     LQLGHAGALAYAPTSNPKGPSALDLPGLRCVEVTLDEMRQLPLEFARTAWLAQQAGFG
                     GVEIHAAHGFLLSQFLSPLFNKRSDEYGGAIANRMRPLLEAIEATRAAVGPDFPIAVK
                     LNSSDQLEGGFDKEDALKVVAALDRSSVDLIDISGGTYFPGAKSASDGMGRGPYFLEF
                     AKRARAVTTKPLMLTGGFKTRAQAEDAVASGAVDIVGLARALVLEPSLPDLWKAERKP
                     EPFFPRFSDAPEGGITAWYTMRLTEIGADKETPVFGDLGQAIRDYEARNQSRTGIWLR
                     HFANDVVRQT"
     misc_feature    242206..243177
                     /locus_tag="NGR_b02460"
                     /note="Old yellow enzyme (OYE)-related FMN binding domain,
                     group 2.  Each monomer of OYE contains FMN as a
                     non-covalently bound cofactor, uses NADPH as a reducing
                     agent with oxygens, quinones, and alpha,beta-unsaturated
                     aldehydes and ketones, and can act as...; Region:
                     OYE_like_2_FMN; cd04733"
                     /db_xref="CDD:240084"
     misc_feature    order(242266..242268,242272..242274,242371..242373,
                     242497..242499,242695..242697,242851..242853,
                     243130..243135)
                     /locus_tag="NGR_b02460"
                     /note="putative active site [active]"
                     /db_xref="CDD:240084"
     misc_feature    order(242266..242268,242272..242274,242371..242373,
                     242497..242499,242851..242853,243130..243135)
                     /locus_tag="NGR_b02460"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240084"
     misc_feature    order(242689..242691,242695..242697)
                     /locus_tag="NGR_b02460"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240084"
     misc_feature    242695..242697
                     /locus_tag="NGR_b02460"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240084"
     gene            complement(243584..244906)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /db_xref="GeneID:7789785"
     CDS             complement(243584..244906)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="osmolarity sensor protein EnvZ"
                     /protein_id="YP_002822466.1"
                     /db_xref="GI:227818495"
                     /db_xref="GeneID:7789785"
                     /translation="MATPAVLKGIRLWPRTLRARLFIILLAGLAIAHAMSFAALFSER
                     YFAARSVMFNTLENDVATSIAILDRLPAAERAGWLDQLARGSYRFVLGPGIPGNPVLE
                     PDDAEVASKIQAAIGAKYPVEVQSIPGAGRHLQAHLRLNDGEPLTIDVTPRGVMPVAD
                     WLPYVLVAQLSLLVLCSWFAMRQAIRPLANLAKAADTLDPNSNTPRLSETGPTEVANA
                     ATAFNAMRDRIAQYLEERVQILAAISHDLQTPITRMKLRAEMAEDSVDKDKLVQDLGE
                     VERLVKEGVAYARSAHGKEENASRVDLASFIESLACDYQDTGKAVTIGELSDGAIVTR
                     PHALRRVLTNLIDNALKFAGGAEIEVQRHDGTVLITVLDRGPGIPDGQLQAVLQPFFR
                     LEQSRNRDTGGTGLGLAIALQLATAIGATLTLRNRDGGGLAAEIALRQ"
     misc_feature    complement(243620..244867)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="heavy metal sensor kinase; Region: cztS_silS_copS;
                     TIGR01386"
                     /db_xref="CDD:233391"
     misc_feature    complement(244214..244354)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(244220..244225,244232..244237,
                     244241..244246,244253..244258,244262..244267,
                     244313..244315,244319..244324,244331..244336,
                     244340..244345,244352..244354))
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(244061..244210)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(244067..244069,244079..244081,
                     244085..244087,244136..244138,244145..244147,
                     244157..244159,244166..244168,244178..244180,
                     244190..244192))
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(244172..244174)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(243593..243895)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(243605..243607,243611..243616,
                     243629..243631,243635..243637,243683..243694,
                     243773..243778,243782..243784,243788..243790,
                     243794..243796,243854..243856,243863..243865,
                     243875..243877))
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(243863..243865)
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(243686..243688,243692..243694,
                     243776..243778,243782..243784))
                     /gene="envZ"
                     /locus_tag="NGR_b02470"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            complement(244906..245643)
                     /locus_tag="NGR_b02480"
                     /db_xref="GeneID:7789786"
     CDS             complement(244906..245643)
                     /locus_tag="NGR_b02480"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator protein"
                     /protein_id="YP_002822467.1"
                     /db_xref="GI:227818496"
                     /db_xref="GeneID:7789786"
                     /translation="MEHIDHILIVDDDREIRELVSSYLKKNGLRATAVADGRQMRAFL
                     DGNTVDLIILDLMMPGDDGLVLSRELRVGRHKATPIVMLTARSDEMDRIIGLEMGADD
                     YLAKPFSARELLARIKAVLRRARMLPPNLQISEAGQLLGFGEWRLDTTARHLIDADGT
                     VIALSGAEYRLLRVFVDHPQRVLNRDQLLNLTQGREAELFDRSIDLLVSRVRQRLGDD
                     ARDPTYIKTVRSEGYVFSMPVEILEPR"
     misc_feature    complement(244939..245643)
                     /locus_tag="NGR_b02480"
                     /note="osmolarity response regulator; Provisional; Region:
                     ompR; PRK09468"
                     /db_xref="CDD:181883"
     misc_feature    complement(245281..245622)
                     /locus_tag="NGR_b02480"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(245323..245328,245335..245337,
                     245392..245394,245455..245457,245479..245481,
                     245608..245613))
                     /locus_tag="NGR_b02480"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(245479..245481)
                     /locus_tag="NGR_b02480"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(245455..245463,245467..245472))
                     /locus_tag="NGR_b02480"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(245320..245328)
                     /locus_tag="NGR_b02480"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(244939..245226)
                     /locus_tag="NGR_b02480"
                     /note="Effector domain of response regulator. Bacteria and
                     certain eukaryotes like protozoa and higher plants use
                     two-component signal transduction systems to detect and
                     respond to changes in the environment. The system consists
                     of a sensor histidine kinase and...; Region: trans_reg_C;
                     cd00383"
                     /db_xref="CDD:238225"
     misc_feature    complement(order(244948..244950,244963..244965,
                     244999..245004,245026..245028,245035..245037,
                     245089..245094,245149..245151))
                     /locus_tag="NGR_b02480"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238225"
     gene            complement(245837..246238)
                     /locus_tag="NGR_b02490"
                     /db_xref="GeneID:7789787"
     CDS             complement(245837..246238)
                     /locus_tag="NGR_b02490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822468.1"
                     /db_xref="GI:227818497"
                     /db_xref="GeneID:7789787"
                     /translation="MRTSRIMTTALLIVGSGLALHGAKAQQAGIQRTDLVQRDLGVPG
                     REAVQVRVDFEPGAVSIKHSHPGEEVAYVLEGSLQYQLEGRAPVTLHAGETLFIPAGV
                     AHLAKNVGDGRASELATYIVEKGTPLVVPVK"
     misc_feature    complement(245840..246211)
                     /locus_tag="NGR_b02490"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     misc_binding    246627..246859
                     /note="NGR_b02500; B12 riboswitch, Cobalamin, RF00174"
                     /bound_moiety="B12"
     gene            247050..248084
                     /locus_tag="NGR_b02510"
                     /db_xref="GeneID:7789788"
     CDS             247050..248084
                     /locus_tag="NGR_b02510"
                     /codon_start=1
                     /transl_table=11
                     /product="Fe III ABC transporter periplasmic-binding
                     protein"
                     /protein_id="YP_002822469.1"
                     /db_xref="GI:227818498"
                     /db_xref="GeneID:7789788"
                     /translation="MKSIFAKSHRGIACAAAVLLAAIGVEAQAAETSYPLTLTNCGHQ
                     VIFQKAPDRAVSIGQSSTEILYLLGLQDRMVGTAVWIGPVINGYEEANAKVERLADND
                     PSFESVVARKPDLVTAQFQWHVGPEGIVARPEQFEELGVPVYTSPADCVGKDNSGGGD
                     GVRHTVFTMDLIYQEITELVQIFNVQERGEKLVAELKAREEAAKKKIASADGRLSAVF
                     WFSSAELDIDPYVAGKNGAPGYIMRSLGIRNVVDSEEEWPTVGWETIAKSGPTLVVAG
                     KMERRRFPADDIAVKHKFLESDPVTSLMPAVKEGHVVEMDAQAMNPTIRTIEGIEVLA
                     DAVEKSGLNK"
     misc_feature    247149..248051
                     /locus_tag="NGR_b02510"
                     /note="Metal binding protein TroA_a.  These proteins are
                     predicted to function as initial receptors in ABC
                     transport of metal ions in eubacteria. They belong to the
                     TroA superfamily of helical backbone metal receptor
                     proteins that share a distinct fold and...; Region:
                     TroA_a; cd01148"
                     /db_xref="CDD:238568"
     misc_feature    247212..248006
                     /locus_tag="NGR_b02510"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    247311..247313
                     /locus_tag="NGR_b02510"
                     /note="putative ligand binding residues [chemical
                     binding]; other site"
                     /db_xref="CDD:238568"
     gene            247817..249109
                     /locus_tag="NGR_b02520"
                     /db_xref="GeneID:7789789"
     CDS             247817..249109
                     /locus_tag="NGR_b02520"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822470.1"
                     /db_xref="GI:227818499"
                     /db_xref="GeneID:7789789"
                     /translation="MADGRLGNHCQVRTDACRRRQDGAPPLPCRRHCRQAQVPGVRPG
                     HQPHACRQGGSRRRDGRPGDEPDDPDHRGHRGARRCRREIRPEQVIGITPSLSRTSAG
                     LLALVVLLVALWLGAAIGETAIPMGVVAKTVANRLWDAGYGLDALDEGIIWNYRVSRA
                     IVAACCGSALALSGVVLQSLLRNPLADPYILGISAGASTGAVAVAVLGIGAGLLTLPV
                     GAFVGALLAFGLVSLLAMRAGRGHGAIILAGVAGSQLFNALTSFIVTKAANAEQARAI
                     MFWLLGNLSGVRWPDVWVAVPVAAVGLIVCLWHARALDAFTFGSESAASLGIPVRRVY
                     GVLIGVTAMMTAAMVSMVGSIGFVGLVIPHVSRMIVGVRHGLLLPGSALIGAVFMIAA
                     DIVSRIIIPGQVLPIGVVTALVGAPAFAVILSQRRTVR"
     misc_feature    248297..249085
                     /locus_tag="NGR_b02520"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(248348..248350,248360..248368,248735..248740,
                     248744..248752,248756..248761,248765..248782,
                     248786..248794,248915..248917,248936..248938)
                     /locus_tag="NGR_b02520"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(248363..248365,248369..248371,248384..248386,
                     248546..248548,248552..248557,248564..248569,
                     248576..248581,248588..248590,248597..248602,
                     248606..248608,248645..248650,248657..248659,
                     248885..248887,249041..249043,249050..249055,
                     249062..249064,249071..249076,249083..249085)
                     /locus_tag="NGR_b02520"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(248606..248608,248687..248689,248861..248863,
                     248873..248875,249005..249007,249032..249034)
                     /locus_tag="NGR_b02520"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            249106..249909
                     /locus_tag="NGR_b02530"
                     /db_xref="GeneID:7789790"
     CDS             249106..249909
                     /locus_tag="NGR_b02530"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="YP_002822471.1"
                     /db_xref="GI:227818500"
                     /db_xref="GeneID:7789790"
                     /translation="MTLAACNVSWSTGGVSILRDVSLDVVPGEFLGIVGPNGSGKTSL
                     MSLLAGLRRPRSGRVLLDGDAVEKLGRKDIARRIALVEQQAETSERISARRAVELGRT
                     PHLGPFTPWSARDDAIVDEAIRNVGMAELAARLWHTLSGGERQRLHIARALAQQPQIL
                     LLDEPTNHLDVGHQIGLLHLVRQQKLTAVAALHDLNHAATFCDRVALMSGGRIVASGR
                     PNEVLTEERIRGVFGVDADVEFHGEGRCHIRYRAPGSPAAERPMLKRIS"
     misc_feature    249106..249849
                     /locus_tag="NGR_b02530"
                     /note="ABC-type cobalamin/Fe3+-siderophores transport
                     systems, ATPase components [Inorganic ion transport and
                     metabolism / Coenzyme metabolism]; Region: FepC; COG1120"
                     /db_xref="CDD:224045"
     misc_feature    249124..249756
                     /locus_tag="NGR_b02530"
                     /note="ATP-binding component of iron-siderophores, vitamin
                     B12 and hemin transporters and related proteins; Region:
                     ABC_Iron-Siderophores_B12_Hemin; cd03214"
                     /db_xref="CDD:213181"
     misc_feature    249208..249231
                     /locus_tag="NGR_b02530"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    order(249217..249222,249226..249234,249352..249354,
                     249592..249597,249682..249684)
                     /locus_tag="NGR_b02530"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213181"
     misc_feature    249343..249354
                     /locus_tag="NGR_b02530"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213181"
     misc_feature    249520..249549
                     /locus_tag="NGR_b02530"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213181"
     misc_feature    249580..249597
                     /locus_tag="NGR_b02530"
                     /note="Walker B; other site"
                     /db_xref="CDD:213181"
     misc_feature    249604..249615
                     /locus_tag="NGR_b02530"
                     /note="D-loop; other site"
                     /db_xref="CDD:213181"
     misc_feature    249670..249690
                     /locus_tag="NGR_b02530"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213181"
     gene            249906..250361
                     /locus_tag="NGR_b02540"
                     /db_xref="GeneID:7789791"
     CDS             249906..250361
                     /locus_tag="NGR_b02540"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudoazurin"
                     /protein_id="YP_002822472.1"
                     /db_xref="GI:227818501"
                     /db_xref="GeneID:7789791"
                     /translation="MIKPARLLLTTIVALSTPALAGAETVEVKMLNRGEKGSMVFEPD
                     FLGLQAGDSVKFIATSKSHNAATIDGMVPDGHAGFKGKINKEILVTFDQPGFYGIKCS
                     PHFGMGMVMLIKVGDVELPQSYRAIEVPARAKPRFDALCAAAQAEVAGK"
     misc_feature    249978..250325
                     /locus_tag="NGR_b02540"
                     /note="Pseudoazurin (Paz) is a type I blue copper
                     electron-transfer protein; Region: Pseudoazurin; cd04218"
                     /db_xref="CDD:259880"
     misc_feature    order(250092..250094,250206..250208,250215..250217,
                     250230..250232)
                     /locus_tag="NGR_b02540"
                     /note="Type 1 (T1) Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259880"
     gene            250682..250873
                     /locus_tag="NGR_b02550"
                     /db_xref="GeneID:7789792"
     CDS             250682..250873
                     /locus_tag="NGR_b02550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822473.1"
                     /db_xref="GI:227818502"
                     /db_xref="GeneID:7789792"
                     /translation="MSEDAFNMSIRKFLKEVGITSQRKIEETVREGQTGGKKLKVRMT
                     LTAEGTGLNHVVDGEIELP"
     gene            251217..252242
                     /locus_tag="NGR_b02560"
                     /db_xref="GeneID:7789793"
     CDS             251217..252242
                     /locus_tag="NGR_b02560"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter ribose-binding protein"
                     /protein_id="YP_002822474.1"
                     /db_xref="GI:227818503"
                     /db_xref="GeneID:7789793"
                     /translation="MTKFIAFALGTVASIVVSASAVNAETFKIGLSNGWVGSEWRTQM
                     IDEAKEAAAKWKDKGVDVEVSVQSANVDVPGQIAHIRNFIAEGVNAIIVNPNSPTAFD
                     PIFAQAKEAGILVIATDAEVSSPDAVYVGIDQTAWGAAGAKWLAETLDGKGKVVAING
                     VAGHPANEMRVAGYKSVLKDFPDIQIVNEVNANWDQAQGQQAMQNILATYPDINGVVV
                     QDGMAAGAWKSIMDAGKKDQIAATGEIRKDFIDLWIKDKLNSGATVNPPGVMASALNV
                     AVLMLQGKELKEPAKAGQYGNALYLPIPFIDSKNVEKAAKQLEGKPGYYSYTSSLSIS
                     DAEALFK"
     misc_feature    251217..252164
                     /locus_tag="NGR_b02560"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    251298..252134
                     /locus_tag="NGR_b02560"
                     /note="Periplasmic sugar-binding component of
                     uncharacterized ABC-type transport systems that are
                     members of the pentose/hexose sugar-binding protein family
                     of the type I periplasmic binding protein superfamily;
                     Region: PBP1_ABC_sugar_binding_like_1; cd06300"
                     /db_xref="CDD:107295"
     misc_feature    order(251334..251336,251571..251573,251724..251726,
                     251946..251948,252006..252008)
                     /locus_tag="NGR_b02560"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107295"
     gene            252315..253820
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /db_xref="GeneID:7789794"
     CDS             252315..253820
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /EC_number="3.6.3.17"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose/galactose/methyl galactoside import
                     ATP-bindingprotein 3"
                     /protein_id="YP_002822475.1"
                     /db_xref="GI:227818504"
                     /db_xref="GeneID:7789794"
                     /translation="MSKLKLNGVSKAYGATLALRRGDLEVMAGEVHVLMGSNGSGKST
                     LCKIIAGSVRPDDGRILIDDTPVTITGPRSARAQGIGIFYQELSLAAHRTVEENICLA
                     ALPAKARLFVDRTALKERAARYIALFDGVSGDGFSADALVGNLRPDQRQLVEIMKALA
                     SEAPLLIFDEPTSALDRAQVERFFEILRDLKRRGRGIIFISHRMDEIKAIGDRVTIIR
                     DGETITTLSLGETDAGTVIRLMVGGAGDMPASQSSAPAIVDAKDGAALTVRNLSGAGF
                     RNVSFEVARGEILGFGGLHGQGQSALLRAIFGAGSIASGEILIGNDRFDAASPRDAIR
                     RGCAYVSGDRGRDGVISGRPIIENVTPIHYLRDRLMIARPSKLSDRVAPALESMHTKF
                     ASLFHPINSLSGGNQQKVIIARWLIDRPDVLLLDDPTKGIDLSAKADLFALIRQLAAD
                     GLGIILYSSEDAELLGNANRILVFNGGSVSRELTGPERTRYNLYQAAYEAA"
     misc_feature    252324..253808
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    252324..252989
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    252420..252443
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(252429..252434,252438..252446,252567..252569,
                     252819..252824,252918..252920)
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    252558..252569
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(252573..252584,252759..252776)
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    252807..252824
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    252831..252842
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    252906..252926
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    253104..253751
                     /gene="rbsA1"
                     /locus_tag="NGR_b02570"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            253820..254812
                     /locus_tag="NGR_b02580"
                     /db_xref="GeneID:7789795"
     CDS             253820..254812
                     /locus_tag="NGR_b02580"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="YP_002822476.1"
                     /db_xref="GI:227818505"
                     /db_xref="GeneID:7789795"
                     /translation="MAEIATSPTYRRAGGIRRLLERYPFLPALAIVLVLLALNGFFSP
                     NSLSYRSLTGLLSTYMALILLAIAQTYVVYAGDIDLSAGSILSLVNVAIVVLMERWGG
                     GAGAVLLALALGLLLGLACGLVNGLVVAALRLQAIVATFATSIFFTGLALYILPVAGT
                     PAPTIFWRTYGGRLLGLPFVFYILAGLVLLLLVLGRTRLTTQLLAVGDDQQAAFQTGL
                     PVVSIRIRGYLLCGLFSALAAFCITGDTASGDPLVGGKMTLFSVAAVVLGGSALSGGW
                     GTVVGSLLGALTIGLISSVVFFMGTPSEWQNFVQGLAILVVLMAGVLAGRRARP"
     misc_feature    254003..254779
                     /locus_tag="NGR_b02580"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    254450..254506
                     /locus_tag="NGR_b02580"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            254809..255765
                     /locus_tag="NGR_b02590"
                     /db_xref="GeneID:7789796"
     CDS             254809..255765
                     /locus_tag="NGR_b02590"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="YP_002822477.1"
                     /db_xref="GI:227818506"
                     /db_xref="GeneID:7789796"
                     /translation="MSSVVSFLRQPIVVALVLIVLLLYLGELLSPGFASGAQILRLMI
                     VASLLGIVAAGQNVVILGGREGIDLSVGGVVSLSAIIAGNVMQGADIGIVPAIAACLL
                     AGAFFGLLNGLGVTLLRIPPLVMTLGMLGVLQGLLVVIRMGIPSGQAAPALSRFVTQP
                     LFFGVPGIIWLWVAIGILMAFMLNRTVFGHRIYAIGSNEHAAYMAGVPVRLMRIALFM
                     ISGMFAAVAGLCLLGYSGSSFANVGEQYTLTSIIAVVFGGTSLAGGKGGYTGTMAGAF
                     LLVILQGILTTVNIDESGRQMVFGATLLILMMFYGRGRAMRA"
     misc_feature    254944..255738
                     /locus_tag="NGR_b02590"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    255406..255462
                     /locus_tag="NGR_b02590"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            255321..256781
                     /locus_tag="NGR_b02600"
                     /db_xref="GeneID:7789797"
     CDS             255321..256781
                     /locus_tag="NGR_b02600"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_002822478.1"
                     /db_xref="GI:227818507"
                     /db_xref="GeneID:7789797"
                     /translation="MGRDRHPHGLHAQPHRLRPPHLRDRLERARRLYGGRAGPVDAHR
                     ALHDLRHVRGGRRPLPARLFRLVLRQCRRAIYTDLDHRRRLRRHIARRRQGRLYRHHG
                     RRLPARHPAGHPHHGEHRRIRPADGIRGDPAHPHDVLWPGSGDARMRDRPKIKDIAEK
                     AGVSVATVSRALSDSALVTAETRQRIHDLARELNYRPNVSARNLRTRKSMAVLLVVRD
                     VGNPFYLDILKGVEATAREAGYAVLMGNTENDPLREIEYFNMLRDGHADGMILMTGKL
                     PPAGGNRAGGWNHLPVVVALEMIEGSGLPHVQVDNVGAARAAVEHLISLGHRRIAHIS
                     GPVPEPMSVYRREGYRLAMREAGLAIPDGYEVRGNFLLESGQECCRELLALPEPPTAL
                     FVANDEMAYGAAHELRRTGRDVPGEVSVVGFDDLYLSKAFYPPLTTVSQPRAEIGRTA
                     MGLLLSILSGGSVGGDEPIVLPTALNIRGSTAPPRG"
     misc_feature    255774..256775
                     /locus_tag="NGR_b02600"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    255783..255938
                     /locus_tag="NGR_b02600"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(255783..255785,255807..255821,255825..255830,
                     255837..255839,255852..255857,255864..255866,
                     255903..255905,255912..255914,255921..255926,
                     255930..255935)
                     /locus_tag="NGR_b02600"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    255903..255932
                     /locus_tag="NGR_b02600"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    255951..256760
                     /locus_tag="NGR_b02600"
                     /note="Ligand-binding domain of an uncharacterized
                     transcription regulator from Actinobacillus succinogenes
                     and its close homologs from other bacteria; Region:
                     PBP1_LacI_like_6; cd06284"
                     /db_xref="CDD:107279"
     misc_feature    order(255951..255953,256014..256016,256041..256043,
                     256050..256052,256056..256058,256113..256115,
                     256434..256436,256533..256535)
                     /locus_tag="NGR_b02600"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107279"
     misc_feature    order(255981..255983,256353..256355,256590..256592,
                     256641..256643)
                     /locus_tag="NGR_b02600"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107279"
     gene            256800..258044
                     /locus_tag="NGR_b02610"
                     /db_xref="GeneID:7789798"
     CDS             256800..258044
                     /locus_tag="NGR_b02610"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_002822479.1"
                     /db_xref="GI:227818508"
                     /db_xref="GeneID:7789798"
                     /translation="MTALPRQTLRIGFVGTGFIARFHLQSLIGVRNVEVTGVYSRKAE
                     NRERFAEAVRELELGICRPHGSLDHLLSAGDVDAIWILSPNYTRLEVMRTLHAEIKAG
                     RSQVFAVACEKPLARTVAEAREMLHLAQDAGLNHGYLENQVFCTPVLRGKEIIWRRAA
                     LTTGRPYLARAAEEHSGPHEPWFWQGDKQGGGVLSDMMCHSVEVARHLLTAPGAARNS
                     LKVKAVNGTVANLKWTRPAYADQLRQRYGNEVDYRNRPSEDFARATVTLEDEEGRELM
                     IEATTSWAYVGAGLRIQLELLGPEYALEYNSLGTGLKIFLSRAVKGSEGEDLVEKQNA
                     EQGLMPVLEDETGVYGYTDENRHMVECFRKGVKPLETFEDGLAVVEILMGLYRSAEIG
                     ATLHFPAPELETYVPLVARTGV"
     misc_feature    256818..257984
                     /locus_tag="NGR_b02610"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    256824..257201
                     /locus_tag="NGR_b02610"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    257253..>257435
                     /locus_tag="NGR_b02610"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            258165..259091
                     /locus_tag="NGR_b02620"
                     /db_xref="GeneID:7789799"
     CDS             258165..259091
                     /locus_tag="NGR_b02620"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase"
                     /protein_id="YP_002822480.1"
                     /db_xref="GI:227818509"
                     /db_xref="GeneID:7789799"
                     /translation="MQVDRSAVVGEIRRFNRFYTRTIGLLDETLTESAFTLTEARVLF
                     ELGHRESPAASEIATELRLDPAYLARILRRFAANGLAKARADGADRRRRILSLTEKGR
                     SALAELQAAADEDVARLVDDLSDEKLRELDIALRRTMELLRRSPMETPVITLRPHRIG
                     DIGWVVQRQAVLYAEEYGWDITYEALAAEIGAAFLRNFREGRDFCWVAERDGTPVGAV
                     FLVWEDDETARLRLLHVETEARGLGIGKRLVDACIDQARVSGYRRVVLWTNDVLVAAR
                     TLYERAGFRLIGEEGHHSFGKDLVGQTWELAL"
     misc_feature    258198..258584
                     /locus_tag="NGR_b02620"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    258270..258548
                     /locus_tag="NGR_b02620"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cl17220"
                     /db_xref="CDD:266564"
     misc_feature    258618..259019
                     /locus_tag="NGR_b02620"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_3; pfam13302"
                     /db_xref="CDD:257639"
     misc_feature    258777..258965
                     /locus_tag="NGR_b02620"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(258861..258869,258897..258902)
                     /locus_tag="NGR_b02620"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            259218..260000
                     /locus_tag="NGR_b02630"
                     /db_xref="GeneID:7789800"
     CDS             259218..260000
                     /locus_tag="NGR_b02630"
                     /EC_number="1.1.1.35"
                     /note="3-hydroxyacyl-CoA dehydrogenase type II; Type II
                     HADH; 3-hydroxy-2-methylbutyryl-CoA dehydrogenase; Scully
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="3-hydroxyacyl-CoA dehydrogenase"
                     /protein_id="YP_002822481.1"
                     /db_xref="GI:227818510"
                     /db_xref="GeneID:7789800"
                     /translation="MRSTAMLILDKVFLVTGGGSGLGAAVARMFVADGAHVIIADVNV
                     DAGTAIAAELGARARFVRTDVTSEADGAAAVQAALDSFGHLHGLINCAGIAPGEKVLG
                     RDGPHRLDSFSRAIGINLIGTFNMIRLAAAAIAREEPDLEGGRGVIVNTASVAAFDGQ
                     IGQAAYAAAKGGVVAMTLPIARELARSGIRVVSIAPGIFETPMMAGMPQEVQDSLGKS
                     VPFPPRLGRPGEYAALVRHICENDMLNGEVIRLDGALRMGAR"
     misc_feature    259233..259988
                     /locus_tag="NGR_b02630"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK08217"
                     /db_xref="CDD:181297"
     misc_feature    259245..259988
                     /locus_tag="NGR_b02630"
                     /note="17hydroxysteroid dehydrogenase type 10
                     (HSD10)-like, classical (c) SDRs; Region:
                     HSD10-like_SDR_c; cd05371"
                     /db_xref="CDD:187629"
     misc_feature    order(259266..259268,259275..259283,259338..259343,
                     259404..259412,259488..259496,259569..259571,
                     259668..259676,259713..259715,259725..259727,
                     259803..259814,259818..259829)
                     /locus_tag="NGR_b02630"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187629"
     misc_feature    order(259512..259520,259524..259526,259533..259538,
                     259542..259544,259551..259556,259563..259565,
                     259575..259580,259587..259592,259599..259601,
                     259608..259613,259620..259622,259641..259649,
                     259683..259703,259707..259709,259716..259721,
                     259728..259733,259740..259745,259749..259757,
                     259761..259766,259770..259781,259785..259787,
                     259812..259814,259875..259883,259887..259895,
                     259905..259907,259914..259919,259926..259928,
                     259932..259979,259983..259988)
                     /locus_tag="NGR_b02630"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187629"
     misc_feature    order(259512..259520,259533..259538,259542..259544,
                     259551..259553,259563..259565,259578..259580,
                     259587..259592,259599..259601,259683..259703,
                     259707..259709,259716..259721,259728..259733,
                     259740..259745,259752..259757,259761..259766,
                     259986..259988)
                     /locus_tag="NGR_b02630"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187629"
     misc_feature    order(259572..259574,259674..259676,259713..259715,
                     259725..259727)
                     /locus_tag="NGR_b02630"
                     /note="active site"
                     /db_xref="CDD:187629"
     gene            complement(260011..260436)
                     /locus_tag="NGR_b02640"
                     /db_xref="GeneID:7789801"
     CDS             complement(260011..260436)
                     /locus_tag="NGR_b02640"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein"
                     /protein_id="YP_002822482.1"
                     /db_xref="GI:227818511"
                     /db_xref="GeneID:7789801"
                     /translation="MIILDTNVLSDLLAPAPSVSVEAWLAGQPPAVIFTTTVTEAEIL
                     YGVRLMPDGRPRRELEAAIALIFREDLSGRVLAFDSDAADAYASIATRRRKSGRPISQ
                     FDAQIAAIALSRGAALATRNVVDFADTGVVIVNPWDHRP"
     misc_feature    complement(260035..260430)
                     /locus_tag="NGR_b02640"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(260059..260061,260116..260121,
                     260125..260130,260134..260136,260155..260157,
                     260164..260169,260176..260181,260185..260187,
                     260200..260208,260212..260214,260254..260256,
                     260263..260265,260299..260307,260311..260319,
                     260323..260328,260338..260340,260362..260364,
                     260371..260373,260395..260403,260407..260412,
                     260419..260427))
                     /locus_tag="NGR_b02640"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(260071..260073,260125..260127,
                     260311..260313,260422..260424))
                     /locus_tag="NGR_b02640"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    complement(order(260122..260124,260128..260133,
                     260164..260169,260173..260181,260185..260190,
                     260203..260205,260248..260250,260257..260262,
                     260302..260307,260311..260316,260323..260328))
                     /locus_tag="NGR_b02640"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(260433..260681)
                     /locus_tag="NGR_b02650"
                     /db_xref="GeneID:7789802"
     CDS             complement(260433..260681)
                     /locus_tag="NGR_b02650"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822483.1"
                     /db_xref="GI:227818512"
                     /db_xref="GeneID:7789802"
                     /translation="MASMTIRNLDDALKQRLRVRAAAHGRSMEDEARDILRAALSTGE
                     GRPRNLAAAIRDRIAPLGGVALELPAREPIREAPDFSA"
     misc_feature    complement(260463..260681)
                     /locus_tag="NGR_b02650"
                     /note="Plasmid stability protein [General function
                     prediction only]; Region: StbC; COG4691"
                     /db_xref="CDD:227035"
     gene            complement(260711..261838)
                     /locus_tag="NGR_b02660"
                     /db_xref="GeneID:7789803"
     CDS             complement(260711..261838)
                     /locus_tag="NGR_b02660"
                     /codon_start=1
                     /transl_table=11
                     /product="lactose ABC transporter ATP-binding protein"
                     /protein_id="YP_002822484.1"
                     /db_xref="GI:227818513"
                     /db_xref="GeneID:7789803"
                     /translation="MSELQLNGVRKSYGGFEVIKGVDLEIKSGEFVVFVGPSGCGKST
                     LLRMIAGLEEITSGDLTIDDVLMNDVDPSKRGIAMVFQSYALYPHMTVRENMGFALRF
                     AGVPKAEIQKRVMEAANILELGSLLDRKPKQLSGGQRQRVAIGRAIVRHPKIFLFDEP
                     LSNLDAELRVHMRIEIARLHKQLAATIVYVTHDQVEAMTMADKIVVMRGGVVEQVGSP
                     LDLYDDPANLFVAGFIGSPKMNFLKGVIETVDGEVYARLPDYADTKIPVGLKGAPSGM
                     PVTVGIRPEHFKEQGSAALDLTIDMLEHLGGETFAYARHGNGELVVIETKNGRDLRSG
                     DRIAARFDPGCALVFDEGGKRLRLLEPRSEQAHLAMPAIDD"
     misc_feature    complement(260771..261838)
                     /locus_tag="NGR_b02660"
                     /note="glycerol-3-phosphate transporter ATP-binding
                     subunit; Provisional; Region: ugpC; PRK11650"
                     /db_xref="CDD:236947"
     misc_feature    complement(261191..261829)
                     /locus_tag="NGR_b02660"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    complement(261710..261733)
                     /locus_tag="NGR_b02660"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(order(261263..261265,261362..261367,
                     261593..261595,261707..261715,261719..261724))
                     /locus_tag="NGR_b02660"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(261593..261604)
                     /locus_tag="NGR_b02660"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(261410..261439)
                     /locus_tag="NGR_b02660"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(261362..261379)
                     /locus_tag="NGR_b02660"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(261344..261355)
                     /locus_tag="NGR_b02660"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(261257..261277)
                     /locus_tag="NGR_b02660"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    complement(260792..261001)
                     /locus_tag="NGR_b02660"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            complement(261835..264099)
                     /gene="lacZ"
                     /locus_tag="NGR_b02670"
                     /db_xref="GeneID:7789804"
     CDS             complement(261835..264099)
                     /gene="lacZ"
                     /locus_tag="NGR_b02670"
                     /EC_number="3.2.1.23"
                     /note="Lactase"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-galactosidase"
                     /protein_id="YP_002822485.1"
                     /db_xref="GI:227818514"
                     /db_xref="GeneID:7789804"
                     /translation="MRSVTSFNDSWVFSEGFNAADAGMLQAGDPVSLPHNAVELPFNY
                     FDETSYQRAFTYQKVIAWRPDFAGREISIVFDAAMADAVVYLNGEEIIAHKDGYTPFE
                     ARLTGRLRESDNLITVKIDGSENPEIPPFGGRIDYLTYAGIYRDVWLKITDPVAIANI
                     KIEPRDVLSDTKSVSVRCDLANPQGLAVAGTVTALLRDANGEVLAEAVGETSGESVTL
                     DMTGLKGLSLWDIDAPVLYQVDVQLRTDHGRDRLASHFGFRTAEFTVDGFRLNGRPLK
                     IRGLNRHQAFPYVGYAMGRSAQERDAELLKHKLHCNLVRTSHYPQSKWFLDHCDRIGL
                     LVFEEIPGWQHIGGEAWKQEAIQNVARMIERDWNHPSIVIWGVRINESQDSHDFYVET
                     NRLARELDPTRQTGGVRYITDSEFLEDVYTMNDFILGNEELPGSNRPRTALRPQQECT
                     GLSRKVPYLITEFGGHMYPTKIYDQEQRQAEHVRRHLEVLNAAHGDPSISGAIGWCMF
                     DYNTHKDFGSGDRICYHGVMDMFREPKFAAYVYASQCAPSEEVVMKPVTFWARGERNI
                     GGVLPLIVLTNCDEIELKYGSLTKRVGPDRETFPHLPHAPVVIDHRHFTKDELGVWGM
                     KWESAEFTGFIGGKAVAHLRMVADPLPTTLEVEADSKTLRAEGRDSVRVVVRALDQVG
                     NVLPFLNDAVDIAVEGPARLIGPNRLVFQGGSTGFWLGSTGAAGNISVTVTSSRVGTT
                     KLDLSATSEGAARV"
     misc_feature    complement(261838..264099)
                     /gene="lacZ"
                     /locus_tag="NGR_b02670"
                     /note="Beta-galactosidase/beta-glucuronidase [Carbohydrate
                     transport and metabolism]; Region: LacZ; COG3250"
                     /db_xref="CDD:225789"
     misc_feature    complement(263641..264099)
                     /gene="lacZ"
                     /locus_tag="NGR_b02670"
                     /note="Glycosyl hydrolases family 2, sugar binding domain;
                     Region: Glyco_hydro_2_N; pfam02837"
                     /db_xref="CDD:251564"
     misc_feature    complement(263323..263637)
                     /gene="lacZ"
                     /locus_tag="NGR_b02670"
                     /note="Glycosyl hydrolases family 2; Region:
                     Glyco_hydro_2; pfam00703"
                     /db_xref="CDD:250069"
     misc_feature    complement(262459..263319)
                     /gene="lacZ"
                     /locus_tag="NGR_b02670"
                     /note="Glycosyl hydrolases family 2, TIM barrel domain;
                     Region: Glyco_hydro_2_C; pfam02836"
                     /db_xref="CDD:251563"
     misc_feature    complement(261844..262146)
                     /gene="lacZ"
                     /locus_tag="NGR_b02670"
                     /note="Bacterial Ig-like domain (group 1); Region: Big_1;
                     cl17740"
                     /db_xref="CDD:266802"
     gene            complement(264108..264929)
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /db_xref="GeneID:7789805"
     CDS             complement(264108..264929)
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /codon_start=1
                     /transl_table=11
                     /product="lactose ABC transporter permease"
                     /protein_id="YP_002822486.1"
                     /db_xref="GI:227818515"
                     /db_xref="GeneID:7789805"
                     /translation="MRTNPSNIASAVLTYGFVGLMAFLSIFPFIWMALGATNSSIDII
                     KGRLLPGEALTTNIANFFTLVNLPLVFWNSAKVTIFATVLTLAVSSLAGYGFEIFRSR
                     HRERLYRAMLLTLMIPFAALMIPLFIMMGKMGLINTHIAVVLPTIGSAFIVFYFRQST
                     KAFPSELRDAAKVDGLKEWQIFFYIYVPVMRSTYAAAFIIVFMTAWNNYLWPLIVLQS
                     NETKTITLVISSLASAYYPDYGVVMVGTILATLPTLAVFFFMQRQFVQGMLGSVK"
     misc_feature    complement(264111..264929)
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    complement(264168..264719)
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264168..264173,264180..264185,
                     264192..264197,264201..264206,264213..264218,
                     264246..264251,264288..264293,264300..264311,
                     264330..264332,264339..264344,264384..264386,
                     264435..264437,264444..264449,264459..264461,
                     264465..264470,264477..264479,264483..264485,
                     264489..264494,264549..264551,264555..264560,
                     264567..264596,264600..264611,264639..264641,
                     264654..264659,264666..264671))
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264294..264311,264549..264593))
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264216..264218,264246..264248,
                     264255..264257,264291..264293,264507..264509,
                     264549..264551))
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264363..264365,264375..264380,
                     264396..264434))
                     /gene="lacG"
                     /locus_tag="NGR_b02680"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(264926..265825)
                     /gene="lacF"
                     /locus_tag="NGR_b02690"
                     /db_xref="GeneID:7789806"
     CDS             complement(264926..265825)
                     /gene="lacF"
                     /locus_tag="NGR_b02690"
                     /codon_start=1
                     /transl_table=11
                     /product="lactose ABC transporter permease"
                     /protein_id="YP_002822487.1"
                     /db_xref="GI:227818516"
                     /db_xref="GeneID:7789806"
                     /translation="MALARRGGIGRYYDINGWLFVAPALGLIALFMVYPIVWSLWMSF
                     QSGRGMMMKFAGFANIARLWNDPVFIKALTNTMTYFVVQVPIMILLALILASLLNNPR
                     LVGRAFFRTAIFLPCVTSLVAYSVLFKGMFAFDGIVNSTLQAIGIIASPIPWQTHPFW
                     AKALVIIAITWRWTGYNMIFYLAALQNIDRSIYEVARIDGVPAWARFTHITIPLLKPV
                     ILFTTVISTIGTLQLFDEVYNLTEGKGGPSNATLTLSLYIYNLTFRFMPNFGYAATVS
                     YVIVVLVALLAFLQFFLAREREK"
     misc_feature    complement(264929..265783)
                     /gene="lacF"
                     /locus_tag="NGR_b02690"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(264971..>265393)
                     /gene="lacF"
                     /locus_tag="NGR_b02690"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(264971..264976,264983..264988,
                     264995..265000,265004..265009,265016..265021,
                     265049..265054,265109..265114,265121..265132,
                     265151..265153,265160..265165,265205..265207,
                     265256..265258,265265..265270,265280..265282,
                     265286..265291,265298..265300,265304..265306,
                     265313..265318,265391..265393))
                     /gene="lacF"
                     /locus_tag="NGR_b02690"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(265019..265021,265049..265051,
                     265058..265060,265112..265114,265331..265333,
                     265391..265393))
                     /gene="lacF"
                     /locus_tag="NGR_b02690"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(265184..265186,265196..265201,
                     265217..265255))
                     /gene="lacF"
                     /locus_tag="NGR_b02690"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(265944..267218)
                     /gene="lacE"
                     /locus_tag="NGR_b02700"
                     /db_xref="GeneID:7789807"
     CDS             complement(265944..267218)
                     /gene="lacE"
                     /locus_tag="NGR_b02700"
                     /note="LBP"
                     /codon_start=1
                     /transl_table=11
                     /product="Lactose-binding protein"
                     /protein_id="YP_002822488.1"
                     /db_xref="GI:227818517"
                     /db_xref="GeneID:7789807"
                     /translation="MDNFARAHLPRIAALALASASLLAVTAAEAKEITIWCWDPNFNV
                     AIMKEAGARYTKTHPDVTFNVVDFAKTDVEQKLQTGLASGTADALPDIVLIEDYGAQK
                     YLQSFPGAFAPLSGTVDYSGFAPYKVEVMTVDGQVYGMPFDSGVTGLYYRKDYLEQAG
                     FKPEDMQNLTWDRFIEIGKEVEAKTGKKMMGLDPNDGGLVRIIMQSAGQWYFDKEGKP
                     NITGNPALKAAVETVGKIMSANIYKPANGWSDWVGTFTSGDVASVVTGVWITGTVKAQ
                     PDQAGKWGVAPIPALSIEGATHASNLGGSSWYVLESSAEKAEAIDFLNEIYGKDIDFY
                     QKILQDRGAVGSLLAARGGAAYEAADPFFGGEKVWQNFSDWLVKVPSVNYGVFTNEAD
                     LAVTAQLPALTQGMPVDDALKAIETEISGHIQ"
     misc_feature    complement(265962..267143)
                     /gene="lacE"
                     /locus_tag="NGR_b02700"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    complement(266142..267074)
                     /gene="lacE"
                     /locus_tag="NGR_b02700"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_8; pfam13416"
                     /db_xref="CDD:257741"
     gene            complement(267344..267781)
                     /locus_tag="NGR_b02710"
                     /db_xref="GeneID:7789808"
     CDS             complement(267344..267781)
                     /locus_tag="NGR_b02710"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822489.1"
                     /db_xref="GI:227818518"
                     /db_xref="GeneID:7789808"
                     /translation="MFLDASAIVAILGDEEDADLLIAKIENAATPIYYSSLSIFEAVI
                     SLARNKRDGALGNQVPIPPHLIDLAQQHVEAFIETIGAKELTIDSAMHRTAIDACRTY
                     GGVVAHPARLNFGDCFSYACAKTYRLPLLFKGDDFSQTDLEPA"
     misc_feature    complement(267347..267781)
                     /locus_tag="NGR_b02710"
                     /note="PIN domain of the VapC-like UPF0110 protein Mb0640
                     and homologs; Region: PIN_UPF0110; cd09871"
                     /db_xref="CDD:189041"
     misc_feature    complement(order(267434..267436,267659..267661,
                     267770..267772))
                     /locus_tag="NGR_b02710"
                     /note="putative active site [active]"
                     /db_xref="CDD:189041"
     gene            complement(267781..268026)
                     /locus_tag="NGR_b02720"
                     /db_xref="GeneID:7789809"
     CDS             complement(267781..268026)
                     /locus_tag="NGR_b02720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822490.1"
                     /db_xref="GI:227818519"
                     /db_xref="GeneID:7789809"
                     /translation="MSLYIRDGAVDELAKQVQQAINAPNKTEAVRRALLNELERARQA
                     VPLKDRIKRLQNEVRAMGPDDPDFDMKKFADEQWGNI"
     misc_feature    complement(267790..268026)
                     /locus_tag="NGR_b02720"
                     /note="Rv0623-like transcription factor; Region:
                     PSK_trans_fac; pfam07704"
                     /db_xref="CDD:203734"
     gene            complement(268152..269222)
                     /locus_tag="NGR_b02730"
                     /db_xref="GeneID:7789810"
     CDS             complement(268152..269222)
                     /locus_tag="NGR_b02730"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_002822491.1"
                     /db_xref="GI:227818520"
                     /db_xref="GeneID:7789810"
                     /translation="MVTIKEIAAAVGVSSATVSRVLNYDPTLSISTRKRQAIIETAEA
                     LNYATPRNRGRAAAQGVGAGQKIALVHFLEPAQELADPYYVGVRLGIESRCQAMKSEI
                     VKVVPTGSPPEAAILEGASGVVAVGHYYGEALEWLRRHSRHLVFADYAPAGDADDSVL
                     SDVAMAMTRLLEAVHRMGYRRIGFIGWIDAFHEPENIHSERRCRTFIDWMVKAGLYDP
                     ELCLVERMTPDSGYALTKAMLSKPNPPKVLITCNDNMALGAYRAIQEMGLRIPEDIAV
                     ASFNDIPVAQFLGPPLSTVKIPAELIGETAVDLLLERLSGRDVAKKVVLGTEMVWRGS
                     TPQPVDREPGRSMAAREELRSV"
     misc_feature    complement(268209..269219)
                     /locus_tag="NGR_b02730"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(269055..269210)
                     /locus_tag="NGR_b02730"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(269058..269063,269070..269072,
                     269082..269084,269127..269129,269136..269141,
                     269154..269156,269163..269168,269172..269186,
                     269208..269210))
                     /locus_tag="NGR_b02730"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(269055..269078,269082..269084))
                     /locus_tag="NGR_b02730"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(268221..269027)
                     /locus_tag="NGR_b02730"
                     /note="Ligand-binding domain of DNA transcription
                     repressor GalR which is one of two regulatory proteins
                     involved in galactose transport and metabolism; Region:
                     PBP1_GalR; cd01544"
                     /db_xref="CDD:107257"
     misc_feature    complement(order(268428..268433,268440..268442,
                     268452..268454,268536..268538,268866..268874,
                     268887..268889,268896..268898,268911..268913,
                     268917..268931,268944..268949,268953..268958,
                     268965..268973,269025..269027))
                     /locus_tag="NGR_b02730"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107257"
     misc_feature    complement(order(268332..268334,268383..268385,
                     268545..268547,268617..268619,268740..268742,
                     268779..268781,268845..268847,268962..268964,
                     268971..268976))
                     /locus_tag="NGR_b02730"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107257"
     gene            complement(269292..270227)
                     /locus_tag="NGR_b02740"
                     /db_xref="GeneID:7789811"
     CDS             complement(269292..270227)
                     /locus_tag="NGR_b02740"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002822492.1"
                     /db_xref="GI:227818521"
                     /db_xref="GeneID:7789811"
                     /translation="MGNSVLQQLIDRGPVMRTVSLPRGRQSLHTMPTSTGYEIRTDGG
                     YDWDGRKRGQTPFTVLQHTIGGAGNLRYEHRSYRLREGDTLLLLVPHNHRYWLEEAGR
                     WEFFWISMNGEEALRIHRAILAVTGPVLKLQPETVEHLADCSLRLITGGEMPGSASAI
                     AYEAAMALYDDVFGSHPVISEEYRKMQHVIDHILSNLEKPLPVEELARVSGLSRAHFS
                     RIFAASEGMPPAEFVLQKRLQRAVKLLTKTADLPVKEVAILSGFDDPNYFAKVFRRVF
                     GASPTEFRTTGMYASVPAKTPKISESVTTLAAACD"
     misc_feature    complement(269733..270122)
                     /locus_tag="NGR_b02740"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    complement(269532..269651)
                     /locus_tag="NGR_b02740"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    complement(269376..269612)
                     /locus_tag="NGR_b02740"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     misc_feature    complement(269373..269486)
                     /locus_tag="NGR_b02740"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            270426..271898
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /db_xref="GeneID:7789812"
     CDS             270426..271898
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /EC_number="3.2.1.22"
                     /note="Melibiase"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="YP_002822493.1"
                     /db_xref="GI:227818522"
                     /db_xref="GeneID:7789812"
                     /translation="MASFKIAIIGAGSVGFTKKLFTDILSVPELRDVEFALTDLSEHN
                     LGMIKSILDRIVGSNNLPTRVTATTDRRKAIEGARYIISCVRVGGLEAYADDIRIPLK
                     YGVDQCVGDTICAGGILYGQRNIPVILDFCKDIREVAEPGAKFLNYANPMAMNTWAAI
                     EYGKVDTVGLCHGVQHGAEQIAQILGAKDGELDYVCSGINHQTWFIDVRLNGRRIGKD
                     ELVAAFEAHPVFSKQEKLRIDVLKRFGVYSTESNGHLSEYLPWYRKRPDEITKWIDMS
                     DWIHGETGGYLRYSTETRNWFETEYPRFLEEAGRPLSTIKRSNEHASHILEALETGRV
                     YRGHFNVKNDGVITNLPADAIIESPGFVDRFGINMVSGITIPEACAATCNASINVQRM
                     SVHAAITGDIDLLKLAVLHDPLVGAICTPEEVWQMVDEMVVAQAEWLPQYAHAVDAAK
                     DRLARSTVKTREWTGAARREVRSIEEIRAEKDAAKLRAAG"
     misc_feature    270432..271754
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /note="alpha-galactosidase; Provisional; Region: PRK15076"
                     /db_xref="CDD:185035"
     misc_feature    270435..271721
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /note="Glycoside Hydrolases Family 4; Alpha-glucosidases
                     and alpha-galactosidases; Region:
                     GH4_alpha_glucosidase_galactosidase; cd05297"
                     /db_xref="CDD:133433"
     misc_feature    order(270459..270464,270540..270545,270555..270557,
                     270675..270683,270690..270695,270765..270767,
                     270804..270806,270867..270869,270873..270875,
                     270933..270935)
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133433"
     misc_feature    order(270765..270767,270873..270875,270936..270938,
                     271026..271028,271176..271178,271185..271187)
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:133433"
     misc_feature    order(270936..270938,271026..271028)
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /note="divalent metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133433"
     misc_feature    order(270993..270995,271002..271004,271050..271052,
                     271071..271073,271419..271421,271455..271457,
                     271512..271517,271521..271523,271527..271538)
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /note="putative tetramer (dimer of dimers) interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:133433"
     misc_feature    order(271155..271157,271191..271193,271551..271556,
                     271566..271568,271575..271577,271587..271589,
                     271596..271598,271608..271610,271626..271628,
                     271632..271634,271641..271646,271653..271658,
                     271671..271673,271677..271679,271683..271685,
                     271689..271691)
                     /gene="agaL1"
                     /locus_tag="NGR_b02750"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133433"
     gene            272230..274311
                     /locus_tag="NGR_b02760"
                     /db_xref="GeneID:7789813"
     CDS             272230..274311
                     /locus_tag="NGR_b02760"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic alpha-galactoside-binding protein"
                     /protein_id="YP_002822494.1"
                     /db_xref="GI:227818523"
                     /db_xref="GeneID:7789813"
                     /translation="MKTHRLTTTASLLIGISAFAVQAFASEPTVVPEQPPVPAQGKIT
                     YVPRDSILEFKALPEYHEPEWVTEKFVKAGKLPPVAERLPKEPMVFKTGNMPDGAGVY
                     GDVMRHVIGGRPEGWNYSAGQTQGWGGIDIGMSECLTRTAPLYQVEASDVEPLPNLAR
                     SWEWSEDGHKLTMHLIEGAKWSDGDPFDADDVMFYWDDNVVDPNVSPLNGATPETFGE
                     GTTLKKIDQNTVEWTFKEAFPRQHLYAMAYGTFCPGPSHILKTKHPKYAGTTYDQYKN
                     GFPPEYMNIPVMGAWVPVAYRPDDIIVLRRNPYYWKVDEAGNQLPYLNEVHYKLSTWA
                     DRDVQAIAGSGDFSNLEQPENFVESLKRAANEAAPARLAFGPRVIGYNLRLNYSANGW
                     GEPDERAQAVRELNRNLDFRKAVTMAVDRKKLGEALVKGPFTAIYPGGLSSGTSFYDR
                     NSTIYYPFDLDGAKALLEKAGLKDTDGNGIVNFPEGTAGGADVQIVMLVNSDYGTDRN
                     LAEGLVGQMEKLGLKVVLNSVDGTKRDATQYAGKFDWLIRRNDQELTSVVQNTTQLAP
                     TGPRTSWHHRAPESGKVDLLPHEQELVDIVNKFIASNDNEARADLMKQFQKVSTENVD
                     TVGLTEYPGALIINKRFSNIPPGAPIFMFNWAEDTIIRERVFVPADKQGDYELYAEQL
                     PGKPGDSGPSN"
     misc_feature    272479..274161
                     /locus_tag="NGR_b02760"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_4; cd08500"
                     /db_xref="CDD:173865"
     misc_feature    272653..274212
                     /locus_tag="NGR_b02760"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     gene            274421..275434
                     /locus_tag="NGR_b02770"
                     /db_xref="GeneID:7789814"
     CDS             274421..275434
                     /locus_tag="NGR_b02770"
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="YP_002822495.1"
                     /db_xref="GI:227818524"
                     /db_xref="GeneID:7789814"
                     /translation="MFRFLLVRIASAIPVLFVLSVVTFAIIQAPPGDYSDYIRSQLIN
                     QGGASFEEADAQAQAYRKEHGLDKPLPIQYANWVTGIVTRGDFGHSLYYNKPVADVVG
                     ERLPRTLALALVCHILASVIGIGFGILAATRQYSWVDSLLSTVSFLGMTVPRFLMALI
                     IVYVLVFHFNVSEINSFHSARYGGAPWSWDKFVDLVKHVWPVVAIATFGGLAYNMRVM
                     RGNLLDTLNAQYVETARAKGLSEGAVVMRHAVPNALHPLIMYQGVVLPYMLTGEIETA
                     IIFALPTVGPAIVGSMWVGDVYVTATFMLVLSATLIVGNIIADMLLAALDPRVRMGGG
                     AYA"
     misc_feature    274421..275419
                     /locus_tag="NGR_b02770"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    274733..275371
                     /locus_tag="NGR_b02770"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(274781..274786,274793..274798,274811..274813,
                     274844..274855,274859..274888,274895..274900,
                     274904..274906,275042..275047,275051..275053,
                     275057..275059,275066..275071,275075..275077,
                     275090..275095,275102..275104,275153..275155,
                     275195..275200,275207..275209,275228..275239,
                     275246..275251,275288..275293,275321..275326,
                     275333..275338,275342..275347,275354..275359,
                     275366..275371)
                     /locus_tag="NGR_b02770"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(274862..274906,275228..275245)
                     /locus_tag="NGR_b02770"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(274904..274906,275027..275029,275246..275248,
                     275282..275284,275291..275293,275321..275323)
                     /locus_tag="NGR_b02770"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(275105..275143,275159..275164,275174..275176)
                     /locus_tag="NGR_b02770"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            275431..276558
                     /locus_tag="NGR_b02780"
                     /db_xref="GeneID:7789815"
     CDS             275431..276558
                     /locus_tag="NGR_b02780"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822496.1"
                     /db_xref="GI:227818525"
                     /db_xref="GeneID:7789815"
                     /translation="MTIEAHSTVPVAMQPEEKHHHESYTALVWRRLKRSWTGLLGLIL
                     VSLLILMAIFADFLSPVDPKATGVAFAPPQAISFTDKDGNFVFSPRSYPVRETEELDP
                     ITFQPVIGPDYENPQILGFFVQGAPYRLLGLIPAERHFFGAVDGTPVHLLGTDKFGRD
                     VLSRILYGSRISLIIALTVVSIVTVVGTTVGMVSGYFGGRFDAWMQRFVELVLAFPQL
                     PLYLALASLIPVTAPTNVFLAFVVIVMSALGWAQMSREVRGKTLALARIDYVRAAIAI
                     GATDRRIIFQHIFPNVMSHVIVAVTLAIPQVVLLESFLGFLGFAVKPPLISWGLMLQD
                     TANYSAIGSYPWILSPVAFVLVTVFAFNALGDGLRDAIDPY"
     misc_feature    <275866..276552
                     /locus_tag="NGR_b02780"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    275938..276453
                     /locus_tag="NGR_b02780"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(275983..275988,275995..276000,276013..276015,
                     276043..276054,276058..276087,276094..276099,
                     276103..276105,276172..276177,276181..276183,
                     276187..276189,276196..276201,276205..276207,
                     276217..276222,276229..276231,276280..276282,
                     276322..276327,276334..276336,276355..276366,
                     276373..276378,276418..276423,276451..276453)
                     /locus_tag="NGR_b02780"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(276061..276105,276355..276372)
                     /locus_tag="NGR_b02780"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(276103..276105,276157..276159,276373..276375,
                     276412..276414,276421..276423,276451..276453)
                     /locus_tag="NGR_b02780"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(276232..276270,276286..276291,276301..276303)
                     /locus_tag="NGR_b02780"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            276570..278240
                     /locus_tag="NGR_b02790"
                     /db_xref="GeneID:7789816"
     CDS             276570..278240
                     /locus_tag="NGR_b02790"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_002822497.1"
                     /db_xref="GI:227818526"
                     /db_xref="GeneID:7789816"
                     /translation="MATIESIVPAPEERTDRHTKETRPVIDARKVAVNFKVENGTVEA
                     VKDVSFQLYRGETVAIVGESGSGKSVTARTIMGLLSKRATIASHSRIEYDGRDVLKFS
                     KRERRALRGDRISMIFQEPMSSLNPVYTIGSQIIEAIRAHRRMSRRAAAARALELLQH
                     VQIPDPEARLNQYPHQLSGGQRQRVMIAMALANDSDVLIADEPTTALDVTVQAQILNL
                     IRKLQQELGMAVILITHDLTVVRQFSDYVYVMQLGEVKEHNTTAALFANPQHVYTRRL
                     LASEPSGSAKPLPDNAPIVLDGRNVRVSFMLKKGGFFKPELKELVAVDSLSLNLRRHE
                     TLGLVGESGSGKTTFGQALIRLINTDAGEIFFEGEPIHGKDRKGMRPLRSRIQIVFQD
                     PFASLNPRMSIGQIIEEGLIVNGIGENRKDRLARVQDALISAGMPANILSRFPHEFSG
                     GQRQRIAIARAIALEPEFILLDEPTSALDLSVQAQIIELLRKLQDERGLSYLFISHDL
                     KVVRALCHRVVVMQHGKIVEEGPVSEILSNPKTAYTERLVRAAFEVAA"
     misc_feature    276633..278234
                     /locus_tag="NGR_b02790"
                     /note="ABC-type uncharacterized transport system,
                     duplicated ATPase component [General function prediction
                     only]; Region: COG4172"
                     /db_xref="CDD:226641"
     misc_feature    276642..277346
                     /locus_tag="NGR_b02790"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    276753..276776
                     /locus_tag="NGR_b02790"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(276762..276767,276771..276779,276924..276926,
                     277170..277175,277272..277274)
                     /locus_tag="NGR_b02790"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    276915..276926
                     /locus_tag="NGR_b02790"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    277098..277127
                     /locus_tag="NGR_b02790"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    277158..277175
                     /locus_tag="NGR_b02790"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    277182..277193
                     /locus_tag="NGR_b02790"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    277260..277280
                     /locus_tag="NGR_b02790"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    277347..>277469
                     /locus_tag="NGR_b02790"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     misc_feature    277452..278159
                     /locus_tag="NGR_b02790"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    277587..277610
                     /locus_tag="NGR_b02790"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(277596..277601,277605..277613,277740..277742,
                     277983..277988,278085..278087)
                     /locus_tag="NGR_b02790"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    277731..277742
                     /locus_tag="NGR_b02790"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    277911..277940
                     /locus_tag="NGR_b02790"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    277971..277988
                     /locus_tag="NGR_b02790"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    277995..278006
                     /locus_tag="NGR_b02790"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    278073..278093
                     /locus_tag="NGR_b02790"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    278148..>278231
                     /locus_tag="NGR_b02790"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            278264..279637
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /db_xref="GeneID:7789817"
     CDS             278264..279637
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-galactosidase"
                     /protein_id="YP_002822498.1"
                     /db_xref="GI:227818527"
                     /db_xref="GeneID:7789817"
                     /translation="MTRQPKITFIGAGSTVFMKNIIGDVLQRPALSAATIALMDLNPE
                     RLAESEIVAGKLVRTLGVKAKVETYSNQLKALEGADFVVVAFQIGGYEPCTVTDFEVP
                     KKYGLRQTIADTLGVGGIMRGLRTVPHLWKICEDMLKVCPEAILLQYVNPMAINTWAI
                     AEKYPTIRQVGLCHSVQGTAFELARDLDIPLEEIRYRAAGINHMAFYLKFEHRQKDGS
                     YRDLYPDLIRGYREGRFPKPSHWNPRCPNKVRYEMLTRLGYFVTESSEHFAEYTPYFI
                     KDGRPDLIEKFGIPLDEYPKRCIEQIERWKGQAAAFKEAETIEVAESHEYASSIMNSV
                     WTGEPSVIYGNLRNNGCITSLPENCAAEVPCLVDASGIQPTYIGALPPQLTALIRTNI
                     NVQELTVQALVTENREHLYHAAMMDPHTAAELDLDQIWSLVDDLLVAHRDWIPEWARV
                     SKKVQAA"
     misc_feature    278276..279607
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /note="alpha-galactosidase; Provisional; Region: PRK15076"
                     /db_xref="CDD:185035"
     misc_feature    278276..279574
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /note="Glycoside Hydrolases Family 4; Alpha-glucosidases
                     and alpha-galactosidases; Region:
                     GH4_alpha_glucosidase_galactosidase; cd05297"
                     /db_xref="CDD:133433"
     misc_feature    order(278300..278305,278381..278386,278396..278398,
                     278516..278524,278531..278536,278609..278611,
                     278648..278650,278708..278710,278714..278716,
                     278777..278779)
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133433"
     misc_feature    order(278609..278611,278714..278716,278780..278782,
                     278870..278872,279053..279055,279062..279064)
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:133433"
     misc_feature    order(278780..278782,278870..278872)
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /note="divalent metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133433"
     misc_feature    order(278837..278839,278846..278848,278894..278896,
                     278918..278920,279272..279274,279308..279310,
                     279365..279370,279374..279376,279380..279391)
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /note="putative tetramer (dimer of dimers) interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:133433"
     misc_feature    order(279032..279034,279068..279070,279404..279409,
                     279419..279421,279428..279430,279440..279442,
                     279449..279451,279461..279463,279479..279481,
                     279485..279487,279494..279499,279506..279511,
                     279524..279526,279530..279532,279536..279538,
                     279542..279544)
                     /gene="agaL2"
                     /locus_tag="NGR_b02800"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133433"
     gene            complement(279808..279996)
                     /locus_tag="NGR_b02810"
                     /db_xref="GeneID:7789818"
     CDS             complement(279808..279996)
                     /locus_tag="NGR_b02810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822499.1"
                     /db_xref="GI:227818528"
                     /db_xref="GeneID:7789818"
                     /translation="MTFVPYTCRIYARTLRVISGFGHFGSLARMRTPYMRFLFVRPAL
                     CLQLSFRPRLATTPLLFG"
     gene            280450..280635
                     /locus_tag="NGR_b02820"
                     /db_xref="GeneID:7789819"
     CDS             280450..280635
                     /locus_tag="NGR_b02820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822500.1"
                     /db_xref="GI:227818529"
                     /db_xref="GeneID:7789819"
                     /translation="MEKKPDRPKNKGESGTARKNQPGHVGGDQARKAQEWDGGSKGSK
                     GPVTEKDKHNPNSSAKT"
     gene            complement(280895..281620)
                     /locus_tag="NGR_b02830"
                     /db_xref="GeneID:7789820"
     CDS             complement(280895..281620)
                     /locus_tag="NGR_b02830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822501.1"
                     /db_xref="GI:227818530"
                     /db_xref="GeneID:7789820"
                     /translation="MPDFDRDGRTAAAQGTSTMTAFFDSRRDAEAAVERLHKAELGAA
                     SVQLVLGIGERCSDFEREGIWSAIENFFFPDEDREIYAEGLARGGYLVTVSGIDDQSY
                     AAVRDILDDEGTIDLDERADLWRSEGWSGWQGGGVAPNALPTGSTEDTFDAPRPAAAT
                     RDHVRSSGTVRTYRTESASAPVSVHETPPRGIYEPQPHSPNSGAWPQAEADASGGFRQ
                     EQDGRSQSQQIGSGWSQSQKCGS"
     gene            complement(281759..283105)
                     /locus_tag="NGR_b02840"
                     /db_xref="GeneID:7789821"
     CDS             complement(281759..283105)
                     /locus_tag="NGR_b02840"
                     /codon_start=1
                     /transl_table=11
                     /product="dicarboxylate carrier protein"
                     /protein_id="YP_002822502.1"
                     /db_xref="GI:227818531"
                     /db_xref="GeneID:7789821"
                     /translation="MGIEILSILLLVGMFIIATIQPINMGALAFGCTFLLGSLIIGMK
                     ANDIFAGFPSDLFLTLVAVTYLFAIAQINCTIDWLVECAVRLVRGHVVWIPWVMFLVA
                     AVITGFGALGPAAVAILAPVALSFAVQYRIHPAMMGLMVIHGAQAGGFSPISVYGGIT
                     NQIVVKAGLPFAPTSLFLSSFFFNLAIAVLVFFVFGGAKIMRQRPATAGPLPELHPEG
                     VSASIRGHGGTPAKPIREHAYGTAADTLQTLRLTPEMIFTLGGLTALGIGALVFKFNV
                     GLVAITVAVVLALISPKTQKAAIDKVSWSTVLLITGIITYVGVMEKAGTIDYVASGIS
                     SLGMPLLVALLLCFTGAIVSAFASSTALLGAIIPLAVPFLLQGHISAIGVVAAIAIST
                     TIVDTSPFSTNGALVVANAPDEKREHVLRQLLIYSALIAIIGPVVAWLVFVVPGLV"
     misc_feature    complement(282659..283105)
                     /locus_tag="NGR_b02840"
                     /note="Dicarboxylate carrier protein MatC N-terminus;
                     Region: MatC_N; pfam07158"
                     /db_xref="CDD:115789"
     misc_feature    complement(281927..282877)
                     /locus_tag="NGR_b02840"
                     /note="Anion permease ArsB/NhaD.  These permeases have
                     been shown to translocate sodium, arsenate, antimonite,
                     sulfate and organic anions across biological membranes in
                     all three kingdoms of life.  A typical anion permease
                     contains 8-13 transmembrane helices...; Region:
                     ArsB_NhaD_permease; cl17221"
                     /db_xref="CDD:266565"
     misc_feature    complement(order(281927..281953,282035..282082,
                     282146..282202,282233..282277,282305..282343,
                     282521..282565,282626..282637,282647..282658,
                     282659..282703,282716..282769,282773..282778,
                     282782..282826))
                     /locus_tag="NGR_b02840"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238344"
     gene            complement(283203..284717)
                     /locus_tag="NGR_b02850"
                     /db_xref="GeneID:7789822"
     CDS             complement(283203..284717)
                     /locus_tag="NGR_b02850"
                     /note="catalyzes the formation of malonyl-CoA from
                     malonate and CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-CoA synthase"
                     /protein_id="YP_002822503.1"
                     /db_xref="GI:227818532"
                     /db_xref="GeneID:7789822"
                     /translation="MSNHLFDAIRTAATGDAPFIRINGGRTWTYDDALDLSGRIASAI
                     DALGIRPGDRVAVQVEKSAEALILYLACLRSGAVYLPLNTAYTLAELDYFIGDAEPRL
                     VVVSPAAREGVRTIAEPHGAIVETLDADGTGSLLDLARDEPAGFVDASRSADDLAAIL
                     YTSGTTGRSKGAMLTHGNLLSNATTLRDSWRITAADRLIHALPLFHTHGLFVATNVTL
                     LAGASLFLLPKFDPDEILSLMPEATLLMGVPTFYVRLLQSPRLDRQAVASMRLFISGS
                     APLLAETHVEFRKRTGHAILERYGMTETNMNTSNPYDGERIAGTVGFPLPGVTVRVTD
                     PTTGAPLPPEETGMIEIRGANVFKGYWRMPEKTAAEFTADGFFISGDLGKIDRDGYVH
                     IVGRSKDLVISGGYNIYPKEVEGEIDQLEGVAESAVIGVPHPDFGEGVTAIVVRKPEA
                     AIDESAILGALNDRLARYKQPKRIIFADDLPRNTMGKVQKNVLRQQYADLYGKR"
     misc_feature    complement(283212..284717)
                     /locus_tag="NGR_b02850"
                     /note="malonyl-CoA synthase; Validated; Region: PRK07514"
                     /db_xref="CDD:181011"
     misc_feature    complement(283248..284672)
                     /locus_tag="NGR_b02850"
                     /note="Malonyl-CoA synthetase (MCS); Region: MCS; cd05941"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(284208..284213,284217..284234,
                     284241..284243))
                     /locus_tag="NGR_b02850"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(283302..283304,283410..283412,
                     283497..283499,283506..283508,283515..283517,
                     283539..283541,283575..283577,283755..283757,
                     283800..283802,283812..283829,283884..283892,
                     283956..283958,283968..283970,283974..283976,
                     284094..284102,284109..284114,284232..284234))
                     /locus_tag="NGR_b02850"
                     /note="active site"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(283497..283499,283515..283517,
                     283539..283541,283575..283577,283755..283757,
                     283812..283829,283884..283892,284232..284234))
                     /locus_tag="NGR_b02850"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(283302..283304,283410..283412,
                     283500..283508,283800..283802,283812..283820,
                     283824..283826,283890..283892,283956..283958,
                     283968..283970,283974..283976,284094..284102,
                     284109..284114))
                     /locus_tag="NGR_b02850"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213307"
     gene            complement(284714..286135)
                     /locus_tag="NGR_b02860"
                     /db_xref="GeneID:7789823"
     CDS             complement(284714..286135)
                     /locus_tag="NGR_b02860"
                     /codon_start=1
                     /transl_table=11
                     /product="MCD, Malonyl-CoA decarboxylase MCD"
                     /protein_id="YP_002822504.1"
                     /db_xref="GI:227818533"
                     /db_xref="GeneID:7789823"
                     /translation="MPGTSFFSDMLQGITERGRKLLFAGSRAADVAAEANLETLCEML
                     LSSRGEASGMAIAAEILARWSKLDSDGVEAFLHVLSEKFGADTVKLDKAVDRYRTEKS
                     PSAIIALHGAAEPRRQELLRRLNHAPGGTAKLVRIRQQLLASKDRSDEFRAVDSDFAH
                     LFSSWFNRGFLTLRPIDWSTPAHILEKIIKYEAVHEIAGWEELRRRLAPADRRCFAFF
                     HPRLTDEPLVFVEVALARSVPGAIRDVLDEGREQIDPDQATTAVFYSISNCQEGLRGI
                     SFGNFLIKQVVEDLRRDLPGLRNFVTLSPVPGFARWLARARTSEAEPLLTEEDRKVLG
                     LLDDPAWVDDANAANEIERVLLPLAAHYFLIERTPEGRPVDPVARFHLGNGARLDRLN
                     FLGDRSAKAMQQGHGLMVNYLYKLEDIEANHEALAQRGEVTASPAVKSLLGRNGESRR
                     GGRSEISRPFAQVMNDRTGGGRK"
     misc_feature    complement(284891..285901)
                     /locus_tag="NGR_b02860"
                     /note="Malonyl-CoA decarboxylase (MCD); Region: MCD;
                     pfam05292"
                     /db_xref="CDD:253136"
     gene            286305..286955
                     /locus_tag="NGR_b02870"
                     /db_xref="GeneID:7789824"
     CDS             286305..286955
                     /locus_tag="NGR_b02870"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002822505.1"
                     /db_xref="GI:227818534"
                     /db_xref="GeneID:7789824"
                     /translation="MSENVGRWLRDEIENAILSNEFAPGERLDEMVLASRFGVSRTPV
                     REALMQLNAIGLIEIRPRRGAVVIDPGPHRIYEMFEVMAELEGLAGSLAARRLDERSR
                     QAITAAHERCEHSAEAGDSDAYYYDNEEFHRAIYAASRSDFLEEQCTQLHRRLRPYRR
                     LQLRVRNRLTTSFSEHCGIVDAIFAGDGDEARRLLRSHVGIQGERFSDLVASMAAR"
     misc_feature    286329..286505
                     /locus_tag="NGR_b02870"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    286335..286901
                     /locus_tag="NGR_b02870"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    order(286389..286391,286392..286397,286419..286433,
                     286437..286442,286449..286451,286479..286484,
                     286488..286499)
                     /locus_tag="NGR_b02870"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    286533..286901
                     /locus_tag="NGR_b02870"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            287068..287370
                     /locus_tag="NGR_b02880"
                     /db_xref="GeneID:7789825"
     CDS             287068..287370
                     /locus_tag="NGR_b02880"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822506.1"
                     /db_xref="GI:227818535"
                     /db_xref="GeneID:7789825"
                     /translation="MGKNADLTKLKKARRQNAAGWWKLEDAKARFSEVVRHAREDGPQ
                     RVTVRGRDAVVIMSAEEFDRLVPEKPRAPFIEFMESLHLAELDLEREMDRGRDIEL"
     misc_feature    287131..287262
                     /locus_tag="NGR_b02880"
                     /note="prevent-host-death family protein; Region: phd_fam;
                     TIGR01552"
                     /db_xref="CDD:233465"
     gene            287367..287831
                     /locus_tag="NGR_b02890"
                     /db_xref="GeneID:7789826"
     CDS             287367..287831
                     /locus_tag="NGR_b02890"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein"
                     /protein_id="YP_002822507.1"
                     /db_xref="GI:227818536"
                     /db_xref="GeneID:7789826"
                     /translation="MKGWLLDTNVVAALINPRGAPSVKTWAADQDEEAIYISILTLAE
                     YDKGIHNLPEDHTDRPRYMAARDALAERFGRRVLSLDDVVVRRWGRISGEVKRDSGHA
                     PPVIDTMLAATAIEHDLYLVTRNVKDARPSGATIFDPWNDDAEKFPLSPRGR"
     misc_feature    287379..287750
                     /locus_tag="NGR_b02890"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    order(287382..287390,287397..287402,287406..287414,
                     287436..287438,287445..287447,287469..287471,
                     287481..287486,287490..287498,287502..287510,
                     287556..287558,287565..287567,287595..287597,
                     287601..287609,287622..287624,287628..287633,
                     287640..287645,287652..287654,287676..287678,
                     287682..287687,287691..287696)
                     /locus_tag="NGR_b02890"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    order(287385..287387,287496..287498,287685..287687,
                     287739..287741)
                     /locus_tag="NGR_b02890"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    order(287481..287486,287493..287498,287502..287507,
                     287559..287564,287571..287573,287604..287606,
                     287619..287624,287628..287636,287640..287645,
                     287679..287684,287688..287690)
                     /locus_tag="NGR_b02890"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            complement(288022..288627)
                     /gene="thiE"
                     /locus_tag="NGR_b02900"
                     /db_xref="GeneID:7789827"
     CDS             complement(288022..288627)
                     /gene="thiE"
                     /locus_tag="NGR_b02900"
                     /note="Condenses 4-methyl-5-(beta-hydroxyethyl)-thiazole
                     monophosphate and 4-amino-5-hydroxymethyl pyrimidine
                     pyrophosphate to form thiamine monophosphate"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="YP_002822508.1"
                     /db_xref="GI:227818537"
                     /db_xref="GeneID:7789827"
                     /translation="MTLDPFYLIVDSARWIERLVPLGVKLVQLRIKERSDEDIRNQIR
                     IAKSICTAHRCQLIVNDFWRLAIEEGCDFVHLGQEDLAEADLGAIRAAGLKLGLSTHD
                     EAELEAALAAAPDYVALGPIYPTILKKMKWAPQGLARLSAWRERVHPLPLVAIGGLNP
                     ERIDGVFAHGADSAAVVTDITLNADPEARTREWIRKTEAWR"
     misc_feature    complement(288043..288612)
                     /gene="thiE"
                     /locus_tag="NGR_b02900"
                     /note="Thiamine monophosphate synthase (TMP
                     synthase)/TenI. TMP synthase catalyzes an important step
                     in the thiamine biosynthesis pathway, the substitution of
                     the pyrophosphate of 2-methyl-4-amino-5-
                     hydroxymethylpyrimidine pyrophosphate by 4-methyl-5-;
                     Region: TMP_TenI; cd00564"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(288094..288105,288157..288159,
                     288169..288171,288247..288249,288253..288255,
                     288274..288276,288280..288282,288331..288333,
                     288403..288405,288538..288540,288544..288546,
                     288601..288603,288607..288609))
                     /gene="thiE"
                     /locus_tag="NGR_b02900"
                     /note="thiamine phosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(288094..288099,288157..288159,
                     288244..288249,288253..288255,288331..288333,
                     288388..288390,288445..288450,288532..288534,
                     288538..288540,288544..288546))
                     /gene="thiE"
                     /locus_tag="NGR_b02900"
                     /note="active site"
                     /db_xref="CDD:238317"
     misc_feature    complement(order(288244..288246,288331..288333,
                     288388..288390,288397..288399,288445..288450,
                     288532..288534,288538..288540))
                     /gene="thiE"
                     /locus_tag="NGR_b02900"
                     /note="pyrophosphate binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238317"
     gene            complement(288624..289397)
                     /gene="thiG"
                     /locus_tag="NGR_b02910"
                     /db_xref="GeneID:7789828"
     CDS             complement(288624..289397)
                     /gene="thiG"
                     /locus_tag="NGR_b02910"
                     /note="functions in thiamine (vitamin B1) biosynthesis; in
                     Bacillus subtilis this enzyme catalyzes the formation of
                     thiazole from dehydroxyglycine and
                     1-deoxy-D-xylulose-5-phosphate and ThiS-thiocarboxylate"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole synthase"
                     /protein_id="YP_002822509.1"
                     /db_xref="GI:227818538"
                     /db_xref="GeneID:7789828"
                     /translation="MPQFYGTDMRSRLLLGTARYPSPAILAEAVRRSRTDIVTVSLRR
                     ETAGGRQGGAFFELIRELGVRVLPNTAGCHSVSEAVLTAKMAREVFATDWIKLEVIGH
                     HDTLQPDVFGLVEAARILTGEGFEVFPYTTDDLVVAERLLAAGCQVLMPWCAPIGSAM
                     GPQNLAALRAMRAEFPDVPLIVDAGIGRPSHAATVMELGYDAVLLNTAVAGADDPAAM
                     AEAFAAAIEAGHMAHGAGMLEPRDMAVPSTPVIGKAVFS"
     misc_feature    complement(288648..289385)
                     /gene="thiG"
                     /locus_tag="NGR_b02910"
                     /note="Thiazole synthase (ThiG) is the tetrameric enzyme
                     that is involved in the formation of the thiazole moiety
                     of thiamin pyrophosphate, an essential ubiquitous cofactor
                     that plays an important role in carbohydrate and amino
                     acid metabolism. ThiG catalyzes...; Region: ThiG; cd04728"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(289227..289229,289236..289238,
                     289275..289277))
                     /gene="thiG"
                     /locus_tag="NGR_b02910"
                     /note="ThiS interaction site; other site"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(288849..288851,289104..289106,
                     289110..289112))
                     /gene="thiG"
                     /locus_tag="NGR_b02910"
                     /note="putative active site [active]"
                     /db_xref="CDD:240079"
     misc_feature    complement(order(288651..288653,288657..288665,
                     288669..288671,288675..288680,288684..288698,
                     288702..288707,288714..288716,288735..288737,
                     288744..288749,288756..288764,288777..288779,
                     288804..288809,288816..288818,288828..288836,
                     288879..288881,288891..288893,288909..288911,
                     288918..288926,288978..288983,288990..288998,
                     289002..289004,289071..289079,289086..289088,
                     289095..289097))
                     /gene="thiG"
                     /locus_tag="NGR_b02910"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240079"
     gene            complement(289400..290776)
                     /locus_tag="NGR_b02920"
                     /db_xref="GeneID:7789829"
     CDS             complement(289400..290776)
                     /locus_tag="NGR_b02920"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis oxidoreductase ThiO"
                     /protein_id="YP_002822510.1"
                     /db_xref="GI:227818539"
                     /db_xref="GeneID:7789829"
                     /translation="MRVLIKGAGVAGLTSAHELVARGAEVMVSDPSPGFASAASWYAG
                     GMLAPWCERESAEEAVLTRGIGAADWWEAVLPAGSVHRNGTLVVAPPRDAAELKRFAS
                     RTSGFRWIGAEEIGALEPALAGRFRQALFFAEEAHLDPRLALSTLRQGLEAQGVVFSG
                     GPIDEGRFDLTIDCTGAAQIGDIEGLRGVRGEMLYLQTEEVALSRPVRLLHPRIPLYI
                     VPRSGGLFMCGATMIESDDAGPMTARSLMEILNGAYTLHPAFAEARLVETGTGVRPAY
                     ADNLPRVSRHESTITVNGLYRHGFLLSPALAEEVAALALGQPCGRPLPNPPPQGGGAK
                     QPLRSPAIFDHRARCKGRDRGGGNAAEEAPPPCGEGLGRGEIRRVWRGMRKGFSERKC
                     PMKFTINGEEHELPATTVADLLLLLEYEGEWLATAVNGELVHGADRARHRLSESDRIE
                     ILSPMQGG"
     misc_feature    complement(289865..290773)
                     /locus_tag="NGR_b02920"
                     /note="FAD dependent oxidoreductase; Region: DAO;
                     pfam01266"
                     /db_xref="CDD:250489"
     misc_feature    complement(289865..290728)
                     /locus_tag="NGR_b02920"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(289403..289594)
                     /locus_tag="NGR_b02920"
                     /note="ThiaminS ubiquitin-like sulfur carrier protein;
                     Region: ThiS; cd00565"
                     /db_xref="CDD:176353"
     misc_feature    complement(order(289421..289429,289481..289483))
                     /locus_tag="NGR_b02920"
                     /note="thiS-thiF/thiG interaction site; other site"
                     /db_xref="CDD:176353"
     gene            complement(290778..292610)
                     /gene="thiC"
                     /locus_tag="NGR_b02930"
                     /db_xref="GeneID:7789830"
     CDS             complement(290778..292610)
                     /gene="thiC"
                     /locus_tag="NGR_b02930"
                     /note="required for the synthesis of the
                     hydromethylpyrimidine moiety of thiamine"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiC"
                     /protein_id="YP_002822511.1"
                     /db_xref="GI:227818540"
                     /db_xref="GeneID:7789830"
                     /translation="MNVFKPLAAAPSVTQGPLPASRKVYKPGEIHAGIRVPMREIALH
                     PTSGEPAVTVYDASGPYTLENADIRIDAGLPRLRRDWILARGDVDSYEGRTVKAEDNG
                     FATGERLTPEFPVRHQPLKAKPGQAVTQLAYARAGIITPEMEFIAIRENLGRKAAKEA
                     LARDGESFGAAVPDFVTPEFVRQEVASGRAIIPANINHPESEPMIIGRNFLVKINANI
                     GNSAVTSSMAEEVEKMVWATRWGADTVMDLSTGRNIHNIREWIIRNSPVPIGTVPLYQ
                     ALEKVNGIAEDLSWEVFRDTLIEQAEQGVDYFTIHAGVRLHYIPLTVSRVTGIVSRGG
                     SIMAKWCLHHHRESFLYEHFEEICDICRAYDVSFSLGDGLRPGSIADANDAAQFAELE
                     TLGELTRIAWAKDCQVMIEGPGHVPMHKIKENMDKQLAVCGEAPFYTLGPLTTDIAPG
                     YDHITSGIGAAMIGWFGTAMLCYVTPKEHLGLPDRNDVKVGVITYKIAAHAADLAKGH
                     PAARIRDDALSRARFEFRWEDQFNLSLDPETARNFHDETLPKEAHKVAHFCSMCGPKF
                     CSMRISHDIRAEAQKEGLEAMAAKYRDGGDLYMPLPGAAEPAGE"
     misc_feature    complement(290808..292589)
                     /gene="thiC"
                     /locus_tag="NGR_b02930"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     misc_feature    complement(292347..292565)
                     /gene="thiC"
                     /locus_tag="NGR_b02930"
                     /note="ThiC-associated domain; Region: ThiC-associated;
                     pfam13667"
                     /db_xref="CDD:257973"
     misc_feature    complement(290883..292226)
                     /gene="thiC"
                     /locus_tag="NGR_b02930"
                     /note="ThiC family; Region: ThiC; pfam01964"
                     /db_xref="CDD:250998"
     misc_binding    292708..292819
                     /note="NGR_b02940; TPP Riboswitch, TPP, RF00059"
                     /bound_moiety="TPP"
     gene            293042..293230
                     /locus_tag="NGR_b02950"
                     /db_xref="GeneID:7789831"
     CDS             293042..293230
                     /locus_tag="NGR_b02950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822512.1"
                     /db_xref="GI:227818541"
                     /db_xref="GeneID:7789831"
                     /translation="MAYSYRCKDYPGMETCPASFTAETEAELWKHIELHGETAHQEEP
                     NKWSSEDRQQIKNLVHET"
     gene            293269..293877
                     /locus_tag="NGR_b02960"
                     /db_xref="GeneID:7789832"
     CDS             293269..293877
                     /locus_tag="NGR_b02960"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="YP_002822513.1"
                     /db_xref="GI:227818542"
                     /db_xref="GeneID:7789832"
                     /translation="MGIYSDVILPKLCDLSMRNERLHPYRERVVGAAEGRVLEIGSGS
                     GLNLPFYRSVREILALEPDPALLAMARRVPHSEMPVNFIEASAEAIPLEDKSIDTVVT
                     TWTLCTIPRAATALAEMRRVLRPQGKLLFVEHGLSPDGGVRWWQNRLTPVWRRIGGGC
                     HLNRPIRSMIEDGGFRIDRIETGYMRGPKPTTFMYEGGATPN"
     misc_feature    293374..293664
                     /locus_tag="NGR_b02960"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(293386..293406,293449..293454,293521..293529,
                     293575..293577)
                     /locus_tag="NGR_b02960"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(293951..295180)
                     /locus_tag="NGR_b02970"
                     /db_xref="GeneID:7789833"
     CDS             complement(293951..295180)
                     /locus_tag="NGR_b02970"
                     /codon_start=1
                     /transl_table=11
                     /product="MFS permease"
                     /protein_id="YP_002822514.1"
                     /db_xref="GI:227818543"
                     /db_xref="GeneID:7789833"
                     /translation="MISSVKSKGGCDDQSRHASSGLLARERPGTVQTASVMVMTVGGL
                     AGSKIAPSPALTTMPIAAMFLGTAIATLPASMWMSRVGRRPGFVLGALLGVAGGATAA
                     LGVWVADLLLLSFGTMLVGVYQAFAQFYRFAASEVATEAFRPRAISLVLGGGIVAAFA
                     GPMIGRFGGPLLGPEYLGSFLLLSLVSLLSAGILLGLRIPAATAANSIVEGRDWKAIV
                     SQPAYLVALFGAATGYGIMILAMTATPIAMVHHRHDLSTAASVIQLHVLGMFLPSFFT
                     GSLIARFGVLQIMFIGVLILSGHVLMTLTGTGFGSFAAALVLLGVGWNFLYIGGTALL
                     TTTYTQEEKGRAQAINDMTIFAVGLACSFGTGALLQRLGWQMLNLALLPWLAVAAAAL
                     AWLGYRRRRGLEPAHAA"
     misc_feature    complement(294053..295027)
                     /locus_tag="NGR_b02970"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(294101..295027)
                     /locus_tag="NGR_b02970"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    complement(order(294107..294109,294116..294121,
                     294128..294133,294140..294145,294176..294178,
                     294185..294190,294200..294202,294209..294214,
                     294221..294223,294362..294364,294374..294376,
                     294383..294385,294395..294397,294407..294409,
                     294449..294451,294458..294463,294470..294475,
                     294482..294484,294695..294697,294713..294718,
                     294725..294730,294764..294766,294773..294778,
                     294794..294799,294806..294811,294956..294961,
                     294965..294970,294980..294982,294989..294994,
                     295001..295003))
                     /locus_tag="NGR_b02970"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            295225..295893
                     /locus_tag="NGR_b02980"
                     /db_xref="GeneID:7789834"
     CDS             295225..295893
                     /locus_tag="NGR_b02980"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="YP_002822515.1"
                     /db_xref="GI:227818544"
                     /db_xref="GeneID:7789834"
                     /translation="MSSPKVQIYEQLAELAKMLGSAHRLELIEYVSQGERSVERLAEL
                     TGLTVANTSQHLQLLRRGGYVRSRRDGKRVLYRLGDGPILELLASLHCYAERNSAEVR
                     EIVGDYFGKLDHLEPVTREELLGRLDDEDVTLLDVRPEDEFNLGHLPGALNVPLGELE
                     RHLAELPRDHEIVAYCRGPYCVLSFEAVAALRAKGYHVRRLKDGFPEWKAAGYAVEVA
                     SSGM"
     misc_feature    295270..295497
                     /locus_tag="NGR_b02980"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(295270..295275,295279..295281,295288..295290,
                     295297..295302,295309..295314,295321..295323,
                     295411..295413,295471..295473,295477..295485,
                     295489..295497)
                     /locus_tag="NGR_b02980"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(295273..295278,295288..295296,295333..295341,
                     295366..295377,295381..295386,295393..295398,
                     295402..295407,295423..295431,295444..295452)
                     /locus_tag="NGR_b02980"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(295333..295335,295342..295344)
                     /locus_tag="NGR_b02980"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    295588..295851
                     /locus_tag="NGR_b02980"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    295750..295752
                     /locus_tag="NGR_b02980"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            295896..297155
                     /locus_tag="NGR_b02990"
                     /db_xref="GeneID:7789835"
     CDS             295896..297155
                     /locus_tag="NGR_b02990"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator family transporter"
                     /protein_id="YP_002822516.1"
                     /db_xref="GI:227818545"
                     /db_xref="GeneID:7789835"
                     /translation="MAGESAAEPPSSIRLGLRENWSQFALLVLINAFVGGMVGIERTV
                     VPLIGSEEFHLASTTLVVSFIASFGVVKAFANLVSGQMADVWGRKRVLVLGWLFGLPV
                     PFMVIWAPSWAWVIAANALLGINQGLAWSMTVIMKVDLVGPKSRGLAVGLNEFAGYLA
                     VGLTAFITGYLASEYGLRPMPIYIGIAYALFGTVLSILLVRDSRDHVRLEASARPEQS
                     PSIGFREVFAMTSFKDRNLFAASQAGLVNNLNDGMSWGIFPLFFASFGLGVERIGILK
                     AVYPATWGILQIATGPLSDRWGRKGLIVSGMWVQSFGLFLTALTRSFEWWLVASLFIG
                     LGTAMVYPTLIAAVSDAAHPTWRARALSVYRFWRDLGYAIGAVSAGLIADRFGLAWAV
                     ASVAALTFVSGSIVAFAMQERPSSEPK"
     misc_feature    295965..297119
                     /locus_tag="NGR_b02990"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    295974..297023
                     /locus_tag="NGR_b02990"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(296007..296009,296016..296024,296028..296033,
                     296088..296090,296097..296102,296109..296111,
                     296121..296126,296130..296135,296271..296276,
                     296283..296288,296295..296300,296307..296309,
                     296343..296348,296355..296360,296376..296378,
                     296634..296636,296643..296648,296655..296660,
                     296667..296669,296709..296711,296721..296723,
                     296733..296735,296742..296744,296754..296756,
                     296895..296897,296904..296909,296916..296918,
                     296928..296933,296940..296942,296973..296978,
                     296985..296990,296997..297002,297009..297011)
                     /locus_tag="NGR_b02990"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(297452..298192)
                     /locus_tag="NGR_b03000"
                     /db_xref="GeneID:7789836"
     CDS             complement(297452..298192)
                     /locus_tag="NGR_b03000"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain type dehydrogenase/reductase y4eK"
                     /protein_id="YP_002822517.1"
                     /db_xref="GI:227818546"
                     /db_xref="GeneID:7789836"
                     /translation="MSDAYRTALVTGVTSGIGRATVFKLCAMGLTVLAVGRNEEALAA
                     LSTECGALPIKADVRDTRVIAEEIGDREIDILVNNAGILSTRASFQEIDPDEIDAMID
                     INLKAPMHLTRLVLPGMVARRRGHLIYLGSSGGLAPFPSMGAYGPSKAGLSLFCDNLR
                     CDLLGTSIRVSEIVPGRVQTDLYRTALGAEQARSALYDGYRPIQPEHIASLIGTVIDL
                     PAFVDVARIEVFPTDQATGGGLMVKFDG"
     misc_feature    complement(297488..298192)
                     /locus_tag="NGR_b03000"
                     /note="Short-chain alcohol dehydrogenase of unknown
                     specificity [General function prediction only]; Region:
                     COG4221"
                     /db_xref="CDD:226674"
     misc_feature    complement(297479..298174)
                     /locus_tag="NGR_b03000"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(297659..297670,297746..297748,
                     297758..297760,297797..297805,297950..297958,
                     298079..298087,298142..298144,298148..298153,
                     298157..298159))
                     /locus_tag="NGR_b03000"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(297746..297748,297758..297760,
                     297797..297799,297881..297883))
                     /locus_tag="NGR_b03000"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(298185..298934)
                     /locus_tag="NGR_b03010"
                     /db_xref="GeneID:7789837"
     CDS             complement(298185..298934)
                     /locus_tag="NGR_b03010"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain type dehydrogenase/reductase y4eL"
                     /protein_id="YP_002822518.1"
                     /db_xref="GI:227818547"
                     /db_xref="GeneID:7789837"
                     /translation="MKGQTAVIVGGASGLGLTTAKLMVERSAAKIGLIDKNEERLAEA
                     ARILADLGAEVAIASGDISVRESAHAAFEDLAGRLGRIHALVNSAAIYPRKAIFEITD
                     AEWDLENAINIKGTYHMMVAAVLHMRRFVNAPDVTGRIVNVTSVDAFKAHPQNAHYAA
                     TKAAVVSLTKSFAQECAKDQILVNSVAPAGFATDRAKELGFLPELAKASALGRAAEPV
                     EMAEWIVMMASSRNTYATGENVVISGGYIYV"
     misc_feature    complement(298200..298934)
                     /locus_tag="NGR_b03010"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(298209..298919)
                     /locus_tag="NGR_b03010"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(298353..298358,298362..298373,
                     298449..298451,298461..298463,298500..298508,
                     298602..298604,298665..298673,298749..298757,
                     298824..298832,298890..298901,298905..298907))
                     /locus_tag="NGR_b03010"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(298449..298451,298461..298463,
                     298500..298502,298599..298601))
                     /locus_tag="NGR_b03010"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            299025..302093
                     /locus_tag="NGR_b03020"
                     /db_xref="GeneID:7789838"
     CDS             299025..302093
                     /locus_tag="NGR_b03020"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD linked oxidase-like protein"
                     /protein_id="YP_002822519.1"
                     /db_xref="GI:227818548"
                     /db_xref="GeneID:7789838"
                     /translation="MIPALAARPKMGRQYTDYLDALRQANFAGDMEASAGSTTVFATD
                     NSIYQLRPQAVLFPRGRADLVLIARLASEPRFRGVCFAVRGGGTGTNGQSLTDGIVID
                     MSRHMNRILSIDPAGRTAVVEAGVVKDQLNKALKPYGLFFAPELSTSNRATIGGMINT
                     DACGQGSCIYGKTSNHVLALNAVLMDGTEWLSRPLAPEALKDVLERPDRVGEIHRLAD
                     AIERENRDLIGATFPKLNRFLTGYDLAHLRTEDGGLNLNAVLCGAEGTLAMIAEAELN
                     LLPIPRFAALINIRYDDFDMALRDARFLVELKVASVETIDAKVLSLARSDIVWEEVGQ
                     FFADNRAGDVAGINIVEVLADDEEGLQAKLDQVTSALSADGRPGRRGFTLAPDKRDVE
                     AIWAMRKRAVGLLGNVEGPRRPVAFVEDTAVPPEHLADYIGEFRALLDAEGLDYGMFG
                     HVDAGVLHVRPALDLTDERQEPLVRRVSDAVAKLTRKYGGVFWGEHGKGVRSEYAPDF
                     FGPLYPELQRLKAAFDPHNQLNPGKIATPGHGALTRIDELPLRGALDRRIDPETRQAF
                     DNAAYCNGNGACFDFNTDSAMCPSFKGTGDRRFSPKGRASLIREWLRLLAERGVDPKA
                     EAERLRRRPVWRGFLPRLIASLGRTTKGDFSDQVREAMDTCLACKACAGQCPVKVNVP
                     AFRSKFLELYYGRYLRPLKDPLIASIEHLLPVMAKVGGLYNLVAGSRPGQVLMGRVGL
                     TALPLLPSQSLPAELRRRGVALARPAELAALSASEKERSLILVQDCFTSYFEPALLLD
                     VIDLLLALGFRPFVAPLMANGKALHVHGYLGAFERVAERNARHLSRLAASGVPLVGLD
                     PSMTLCYRSEYPGALGAERTPTVLLPQEWLGARLDRLANRKFDRPETQYVLLPHCTER
                     TNAADSVRSWGAIFEAFGLKLTIEDAGCCGMAGTFGHERRNRALSETIYRLSWQQKFE
                     GAGPHRVLMATGYSCRSQVKLMGAPGLPHPLQLLKALVCSDADFHNSHDM"
     misc_feature    299073..300635
                     /locus_tag="NGR_b03020"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    299178..299588
                     /locus_tag="NGR_b03020"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    299862..300626
                     /locus_tag="NGR_b03020"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     misc_feature    300708..302054
                     /locus_tag="NGR_b03020"
                     /note="Fe-S oxidoreductase [Energy production and
                     conversion]; Region: GlpC; COG0247"
                     /db_xref="CDD:223325"
     gene            302090..302869
                     /locus_tag="NGR_b03030"
                     /db_xref="GeneID:7789839"
     CDS             302090..302869
                     /locus_tag="NGR_b03030"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002822520.1"
                     /db_xref="GI:227818549"
                     /db_xref="GeneID:7789839"
                     /translation="MICETIDPKDPKESGPDVSVITQRGNLAEIVVAQLASRIDSGLY
                     GPGDKLPSSAQLCEEFGVSRTVIREALTSLKVAGRVTARQGAGVFVTEKDAKTLNFEI
                     SRIDDIRSAMQIIELRLGVELQSVALAASRRTPEALAEIARAYDQLESLDTTDAEIEA
                     EADFDFHLAIAKATRNPHFPRFLEAVRGEISLDLVLKHRQSAGGYQAYLKKINKEHAA
                     ILAAITQGDVKGAKNALALHLEESLNRYRAMLDEPATVAEE"
     misc_feature    302141..302851
                     /locus_tag="NGR_b03030"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    302168..302362
                     /locus_tag="NGR_b03030"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(302171..302173,302240..302242,302246..302251,
                     302273..302287,302291..302296,302303..302305,
                     302333..302338,302342..302353)
                     /locus_tag="NGR_b03030"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    302426..302812
                     /locus_tag="NGR_b03030"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            303220..304131
                     /locus_tag="NGR_b03040"
                     /db_xref="GeneID:7789840"
     CDS             303220..304131
                     /locus_tag="NGR_b03040"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase"
                     /protein_id="YP_002822521.1"
                     /db_xref="GI:227818550"
                     /db_xref="GeneID:7789840"
                     /translation="MKTSLEHLPEKKQRELARVVAIIHEEFADALEGSSSAFKKRGRI
                     LKIILFGSYARGSFVDEPHTMKGYRSDYDILVIVNSKRLAEREYWDKATDRLMWDKGV
                     STPVGLIVHGAREVNNFLADGQYFFVDILREGVVLYELDDRPLAEPRRLSPADAFRFA
                     KQYFDDRIPHARVFLKTAKFCVREHDLKEAAFLLHQAIEQLYAASLLVLTNYSPPSHN
                     LKFLRGLAEDRDQRLVEAWPRNQHRYIAWYNILNEAYVKARYSKHFEISEEALAWLLE
                     RTEHLHRLVETVCQERLAELKRAAGAT"
     misc_feature    303292..303630
                     /locus_tag="NGR_b03040"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(303367..303375,303382..303384,303427..303432,
                     303436..303438,303532..303534,303538..303540)
                     /locus_tag="NGR_b03040"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(303367..303375,303382..303384,303427..303432,
                     303436..303438)
                     /locus_tag="NGR_b03040"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(303430..303432,303436..303438,303538..303540)
                     /locus_tag="NGR_b03040"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    order(303532..303534,303538..303540)
                     /locus_tag="NGR_b03040"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     misc_feature    303721..304083
                     /locus_tag="NGR_b03040"
                     /note="Higher Eukarytoes and Prokaryotes
                     Nucleotide-binding domain; Region: HEPN; smart00748"
                     /db_xref="CDD:214800"
     gene            complement(304254..305939)
                     /locus_tag="NGR_b03050"
                     /db_xref="GeneID:7789841"
     CDS             complement(304254..305939)
                     /locus_tag="NGR_b03050"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine pyrophosphate protein"
                     /protein_id="YP_002822522.1"
                     /db_xref="GI:227818551"
                     /db_xref="GeneID:7789841"
                     /translation="MTTGTKGRNGGQILIDALRIHGVERAFCVPGESYLAALDALHEA
                     KDDIELVVCRQEGGAAYMAEAYGKLTGKPGICFVTRGPGATNASVGVHTAFQDSTPTI
                     LFIGQVARDQVEREAFQEVDYRRMFGQMAKWVVQIDDAARIPELVSQAFHRAVNGRPG
                     PIVVALPEDMLIDCVDVADAPAYKTVEMHAGQAQLDELRSRLEQAERPIVIVGGAGWT
                     EDAVADIRSFSEAMRLPVAASFRCQDLFDNTHPNYAGDLGLAAGPKLIQRIKDSDLLI
                     VIGARLGEMTTGGYSLIDIPVPKQTLVHVHAGAEELGRVYHADLPINASAAAFARQAA
                     GLAPIAEPRWAEWTRGANADYRENLEHPAVPGPVQMGDIMAWLRDHLPADAILTTGAG
                     NYSAWAHRFYQYRTFRTQLGPTNGSMGYGVPAAIAAKLSAPERPVIAFAGDGCFLMNG
                     QELATAMQYDARVIVLVINNGMYGTIRMHQERHYPGRVSGTQLTNPDFAALARAYGLH
                     GETVETTEDFAPAFERAEQSGKPALIEVRIDPEALTPKMSLTQIRDQALAQGT"
     misc_feature    complement(304266..305939)
                     /locus_tag="NGR_b03050"
                     /note="thiamine pyrophosphate protein; Validated; Region:
                     PRK08199"
                     /db_xref="CDD:181285"
     misc_feature    complement(305436..305906)
                     /locus_tag="NGR_b03050"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(305649..305654,305661..305663,
                     305673..305675,305694..305696,305730..305738,
                     305742..305747,305754..305759,305766..305768,
                     305775..305795,305823..305825,305835..305837,
                     305847..305852,305865..305867))
                     /locus_tag="NGR_b03050"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(305553..305555,305562..305564,
                     305664..305666,305673..305678,305682..305687,
                     305694..305696,305769..305771,305775..305786,
                     305790..305792,305823..305825,305835..305837,
                     305844..305852))
                     /locus_tag="NGR_b03050"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(305682..305684,305694..305696,
                     305772..305774,305850..305852))
                     /locus_tag="NGR_b03050"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(304974..305357)
                     /locus_tag="NGR_b03050"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(304326..304826)
                     /locus_tag="NGR_b03050"
                     /note="Thiamine pyrophosphate (TPP) enzyme family,
                     TPP-binding module; found in many key metabolic enzymes
                     which use TPP (also known as thiamine diphosphate) as a
                     cofactor. These enzymes include, among others, the E1
                     components of the pyruvate, the acetoin and...; Region:
                     TPP_enzymes; cd00568"
                     /db_xref="CDD:238318"
     misc_feature    complement(order(304524..304526,304530..304532,
                     304605..304616,304686..304688))
                     /locus_tag="NGR_b03050"
                     /note="TPP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238318"
     gene            complement(305969..307162)
                     /locus_tag="NGR_b03060"
                     /db_xref="GeneID:7789842"
     CDS             complement(305969..307162)
                     /locus_tag="NGR_b03060"
                     /codon_start=1
                     /transl_table=11
                     /product="FAD dependent oxidoreductase"
                     /protein_id="YP_002822523.1"
                     /db_xref="GI:227818552"
                     /db_xref="GeneID:7789842"
                     /translation="MQASKTSYDVVIVGGAVVGSSAAYFLATNPDFTGSVLVIEKDWT
                     YQRCATALSSSSIRHQFSNAINVQVSQFGTEFIRDFKKHVAVDDDTPEIGFHEAGYLF
                     LAGDERGEQVLRRNHENQVACGAEVTLLDVEALGRRFPWLNLEGLVLGSTGERGEGWF
                     DSVGLMQGFRKKARSLGVEYVEDEVVAVNREDDRIVSVTTRSGQTIGCGTMVNTSGTN
                     GKKVARLAGLDIPVEPRRRSLFVVDCRTPLEGRVGLTIDPTGVFFRPEGKFYLMGTYP
                     KHDPEVDPNDFDVMHDEFDEEIWPILANRVPAFEALKVVNCWAGHYDYCTLDHNVILG
                     PHTEVRNFLFANGFSGHGLQQSPAMGRGLSELIAYGGFRTLDLSPFGYERVVANRPFL
                     EDAVI"
     misc_feature    complement(305996..307105)
                     /locus_tag="NGR_b03060"
                     /note="Glycine/D-amino acid oxidases (deaminating) [Amino
                     acid transport and metabolism]; Region: DadA; COG0665"
                     /db_xref="CDD:223737"
     misc_feature    complement(306062..306889)
                     /locus_tag="NGR_b03060"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(307172..307984)
                     /locus_tag="NGR_b03070"
                     /db_xref="GeneID:7789843"
     CDS             complement(307172..307984)
                     /locus_tag="NGR_b03070"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-glucose 4,6-dehydratase"
                     /protein_id="YP_002822524.1"
                     /db_xref="GI:227818553"
                     /db_xref="GeneID:7789843"
                     /translation="MSDYQRVLLTGAAGALGSELRKSGTRLGKVVRLSARGPCENLAP
                     HEEDFPLDLADFDAVSAAVKGCDAIVHMGGQALEGPWQTILDSNIVGGYNIYEAARRH
                     GVKRIVYASSVHAIGYYERTQTIDGNVPTRPDSLYGVSKTFVENLARYYFDKFGIETV
                     CLRIGSSFPEPTDRRHLITWLSYRDCRQLVEKSLSAPRVGFMIAYGMSNNSEAFWDNR
                     TAAVLGYKPEDSADDYRDKVFAKTTQGDPNDPAVRFQGGSFCAAGHFEDENK"
     misc_feature    complement(<307496..307969)
                     /locus_tag="NGR_b03070"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(307535..307966)
                     /locus_tag="NGR_b03070"
                     /note="short chain dehydrogenase; Region: adh_short;
                     pfam00106"
                     /db_xref="CDD:249592"
     misc_feature    complement(order(307562..307564,307574..307576,
                     307649..307657,307763..307771,307886..307888,
                     307937..307939,307943..307948,307952..307954))
                     /locus_tag="NGR_b03070"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(307562..307564,307574..307576,
                     307649..307651,307721..307723))
                     /locus_tag="NGR_b03070"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(307998..309200)
                     /gene="aatA1"
                     /locus_tag="NGR_b03080"
                     /db_xref="GeneID:7789844"
     CDS             complement(307998..309200)
                     /gene="aatA1"
                     /locus_tag="NGR_b03080"
                     /EC_number="2.6.1.1"
                     /note="Transaminase A; AspAT"
                     /codon_start=1
                     /transl_table=11
                     /product="Aspartate aminotransferase B"
                     /protein_id="YP_002822525.1"
                     /db_xref="GI:227818554"
                     /db_xref="GeneID:7789844"
                     /translation="MNFESRRAGSIKSSPSMAVSLAAKAMRAKGESVVDLSLGEPDFE
                     TPDFIVEAAIAAMRGGKTRYTGPDGTEELRAAIVAKFKRENRLDYAMDEISIGNGAKQ
                     ILFNAFLGTLEAGDEVIVPAPYWVSYTDIVILHGGVPRIIACGVEDDFKLTPERLEHA
                     ITPKTRWVLFNSPSNPTGAIYTSAELAALGEVLERHPHVLVMSDEIYEHIVADDVPFT
                     SFANACPQVRERTLIINGVSKAYAMTGWRLGYAAGPKSLTRVLNKMQSQSTTCPSSIS
                     QAAAAAALNGPQNFVAEAVAEYKARGELVTRGFSAIPGLEVRAPDGAFYLFPKCAGYI
                     GKTAPDGTVIENDTALASFLLTAGKVATVPGAAFGVEPYIRLSFATSRENLHIAIERI
                     GEALAKLR"
     misc_feature    complement(308001..309182)
                     /gene="aatA1"
                     /locus_tag="NGR_b03080"
                     /note="aspartate aminotransferase; Provisional; Region:
                     PRK06107"
                     /db_xref="CDD:180403"
     misc_feature    complement(308019..309101)
                     /gene="aatA1"
                     /locus_tag="NGR_b03080"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(308460..308462,308484..308489,
                     308493..308495,308580..308582,308676..308678,
                     308826..308828,308898..308906))
                     /gene="aatA1"
                     /locus_tag="NGR_b03080"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(308364..308366,308373..308375,
                     308460..308468,308601..308603,308796..308798,
                     308895..308897))
                     /gene="aatA1"
                     /locus_tag="NGR_b03080"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(308484..308486)
                     /gene="aatA1"
                     /locus_tag="NGR_b03080"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            complement(309221..310873)
                     /locus_tag="NGR_b03090"
                     /db_xref="GeneID:7789845"
     CDS             complement(309221..310873)
                     /locus_tag="NGR_b03090"
                     /EC_number="3.5.2.14"
                     /codon_start=1
                     /transl_table=11
                     /product="N-methylhydantoinase B"
                     /protein_id="YP_002822526.1"
                     /db_xref="GI:227818555"
                     /db_xref="GeneID:7789845"
                     /translation="MSEPLIDIHMQVMWNRLISVVEEQAQTLIRTAFSTSVREAGDLS
                     AGIFDLEGRMLAQAVTGTPGHVNAMAESVAHFINDIGPENIFEGDVYITNDPWKGTGH
                     LHDITVVTPSFHHGKLVGYFASTAHVVDVGGRGFGPDAREVYEEGLFIPIMKFFDRGE
                     VNRTLIHIVRNNVRENDKVVGDFYALAACNETGHRRLVDMLTEFNLEDLGTIGSFILK
                     HSREATLERLRNLPHGSWSYSLDLDGYDEPVHLAAQLTISPDGVLVDFDGTSGMSRFG
                     INVPLVYAKAYACYGIKCVVAPEIPNNTASLAPFDVVAPEGCILNAKRPAPVAVRHVL
                     GHFVPDLVLGALHQALPGKVPAEGASALWNLHMSVRPVSDEIGGKGAEILMFNSGGTG
                     ARPSLDGLSATAFPSGVHTMPIEATENVGPIIVWRKELREGSGGAGEQRGGLGQVIEI
                     AAAEGYAFRFSAMFDRLGHPARGRDGGGDGAAGSVSLDDGTTFKGKGLQFVPAGRKLV
                     LHLPGGGGYGDAAKRPAAAIDADIANGYITKDQAAADYGRKK"
     misc_feature    complement(309233..310852)
                     /locus_tag="NGR_b03090"
                     /note="Hydantoinase B/oxoprolinase; Region:
                     Hydantoinase_B; cl19816"
                     /db_xref="CDD:268169"
     gene            complement(310887..312968)
                     /locus_tag="NGR_b03100"
                     /db_xref="GeneID:7789846"
     CDS             complement(310887..312968)
                     /locus_tag="NGR_b03100"
                     /EC_number="3.5.2.14"
                     /codon_start=1
                     /transl_table=11
                     /product="N-methylhydantoinase A"
                     /protein_id="YP_002822527.1"
                     /db_xref="GI:227818556"
                     /db_xref="GeneID:7789846"
                     /translation="MTSASRNCRVGVDIGGTFTDIALDLDGTLHSTKVLTDYTAPERA
                     ILKGVKAVAETAGIALSDIDILIHGTTLATNALIERRGAKTAFVTTEGFRDVLEMRTE
                     NRFEQYDLNISLPPALIQRADRFTVRERMNAVGEVLQPLDAASVAAVVDQVAKGEYES
                     VAVGFIHAYANGAHEAAVRDALLKRLPQISVSVSSEVSPQMREFERFNTVCANAYVKP
                     AIKSYLDRLVVSLKEIGVGCPVYMIHSGGGIVSVESAAEFPVRLVESGPAGGAIFAAD
                     IARRHGLDTVLSFDMGGTTAKICLIENQVPKTAKTFEVARTYRFRKGSGMPISIPVVE
                     MVEIGAGGGSIASVDVMRQIRVGPHSAASEPGPACYQRGGLKPTVTDADLLLGKLDPD
                     NFAGGAIPLSVAASRDAMDREIGPGLGLDAEGAAYGTCEMVDENMANAGRVHTVENGK
                     DISDFTMITFGGAGPLHAARLCEKMGISTFLVPPGAGVGSAIGFLRAPFGYESVRSAV
                     FNLSRFDVDGANRLMAAMKSEALSFVAGGLDTADPVIERTVFMRYAGQGWDIPVALPF
                     EHFDAASAEQIRALFEGAYARFFGRAIEGLDIEIVSWAVKASSPLPEVARVEAVGRSR
                     EAEPGKRRRLFDVGQRSFLEAGIHEREMLVPGDVVSGPAVIAERETSTVLTSSFVATV
                     QVDGCLLVTRR"
     misc_feature    complement(310890..312947)
                     /locus_tag="NGR_b03100"
                     /note="N-methylhydantoinase A/acetone carboxylase, beta
                     subunit [Amino acid transport and metabolism / Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: HyuA; COG0145"
                     /db_xref="CDD:223223"
     misc_feature    complement(312411..312944)
                     /locus_tag="NGR_b03100"
                     /note="Hydantoinase/oxoprolinase N-terminal region;
                     Region: Hydant_A_N; pfam05378"
                     /db_xref="CDD:253171"
     misc_feature    complement(311478..312353)
                     /locus_tag="NGR_b03100"
                     /note="Hydantoinase/oxoprolinase; Region: Hydantoinase_A;
                     pfam01968"
                     /db_xref="CDD:251002"
     gene            complement(313279..314262)
                     /locus_tag="NGR_b03110"
                     /db_xref="GeneID:7789847"
     CDS             complement(313279..314262)
                     /locus_tag="NGR_b03110"
                     /codon_start=1
                     /transl_table=11
                     /product="exported ErfK/YbiS/YhnG family protein"
                     /protein_id="YP_002822528.1"
                     /db_xref="GI:227818557"
                     /db_xref="GeneID:7789847"
                     /translation="MVMKSVAIFAASLTLGLSGSVSAQELQPEAVNAASMASIPSERP
                     SKASPRPEPAIVRLQVLLDRAGASPGVIDGYYGENVTKAVAGFEAMQGLPVDGKPDPE
                     VTERLSGGKPVIEPYVISEDDAKGLVDSIPEDYAEQAEMEHLGYTSVEEKLSERFHMD
                     IDLLKALNPGSAFAVGATVSVAMPGTAKEGTVKRIEARRRAGQVLAFAEDGSVLAVYP
                     ATIGSEESPSPSGTHKVKGVARMPVYVYNPKVNFQQGDNSEVLELPKGPNGPVGSVWI
                     DLTEPTYGIHGTPEPSLVDKAGSHGCIRLTNWDAEELAAMVKPGVVVAFTD"
     misc_feature    complement(<313942..314214)
                     /locus_tag="NGR_b03110"
                     /note="Putative peptidoglycan-binding domain-containing
                     protein [Cell envelope biogenesis, outer membrane];
                     Region: COG3409"
                     /db_xref="CDD:225943"
     misc_feature    complement(313942..314112)
                     /locus_tag="NGR_b03110"
                     /note="Putative peptidoglycan binding domain; Region:
                     PG_binding_1; pfam01471"
                     /db_xref="CDD:250643"
     misc_feature    complement(313282..313923)
                     /locus_tag="NGR_b03110"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: ErfK; COG1376"
                     /db_xref="CDD:224294"
     misc_feature    complement(313294..313686)
                     /locus_tag="NGR_b03110"
                     /note="L,D-transpeptidase catalytic domain; Region: YkuD;
                     pfam03734"
                     /db_xref="CDD:252135"
     gene            complement(314374..315276)
                     /locus_tag="NGR_b03120"
                     /db_xref="GeneID:7789848"
     CDS             complement(314374..315276)
                     /locus_tag="NGR_b03120"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter substrate-binding
                     protein"
                     /protein_id="YP_002822529.1"
                     /db_xref="GI:227818558"
                     /db_xref="GeneID:7789848"
                     /translation="MRAPRSVVLSALACLVLPGVAFARCEGHVPQPKPQNTFPQDVGR
                     SFDRILEEGWIEFAVYEDFPPWSIEEKGEAHGVDVEIGKLVAAALGVEPRFRLVQAGE
                     TLDADLINYVWKGAVVGGHVSDVMLHVPYDSDYACRIEQVTFTGQYAREAIAIAYDKA
                     GYPDKGPTPSYFRFDTVAVENDSISDFHLTSLLGPVDKIRRYRSTALAVEALAGGETM
                     AAMGPRAQLQAGIAAHPVAALAVHEPPLVGMARGKWTLGVAVNFQHKDLAYAVDDALA
                     AALADGRIAAIFQAYGLTFEPPPR"
     misc_feature    complement(314476..315114)
                     /locus_tag="NGR_b03120"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(314608..314610,314725..314727,
                     314863..314865,315088..315090))
                     /locus_tag="NGR_b03120"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(314629..314631,314647..314649,
                     314659..314661))
                     /locus_tag="NGR_b03120"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(314506..314511,314521..314532))
                     /locus_tag="NGR_b03120"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(315280..315966)
                     /locus_tag="NGR_b03130"
                     /db_xref="GeneID:7789849"
     CDS             complement(315280..315966)
                     /locus_tag="NGR_b03130"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c550"
                     /protein_id="YP_002822530.1"
                     /db_xref="GI:227818559"
                     /db_xref="GeneID:7789849"
                     /translation="MSTNRIRAGLAALALLGTATIVAAHGDVAPQPVNTDALPEVGEE
                     WLTENPYREEKVGRDTWLKAVEIGASGFNQNCARCHGLGAVSGGLAPDLRLLEAEEYG
                     DEWFIERFRLGYTQDGTTKMPAFGDILGQKAAWAIRTYIETRPEDGALDAHSDRLHEV
                     RNELASSKVSDPKALKAELEKIAAEVKTASGAPVADSVAYEAARVLTDTPESWKKASD
                     ILTVGLSASE"
     misc_feature    complement(315544..315777)
                     /locus_tag="NGR_b03130"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     gene            316125..317312
                     /locus_tag="NGR_b03140"
                     /db_xref="GeneID:7789850"
     CDS             316125..317312
                     /locus_tag="NGR_b03140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822531.1"
                     /db_xref="GI:227818560"
                     /db_xref="GeneID:7789850"
                     /translation="MPKRRISWKISACLLVALAGSSGPARAEITVAMTYLRQEVQAPP
                     VLSNLDPIPADLGIAGAEVALADTETTGSFLGHHYTLKVISVAPGGDIAAAAKAALAA
                     SSVLLIDAPAESLLNVADLAEAGGALLFNVASGARALRDADCRANLLHTIPEDAMRAD
                     ALMQMLKARRWTRTAMIVGPRPEDAAYAATLRAAAEKFGVEILADKVWSFDTDLRRAA
                     GKEVPLFTQDLPDHDVLLVADEADDFARYVVDNTWLARPVAGSDGLRGEGWAPVLEQW
                     GAVQLQNRFEGAAKREMRTRDYAAWAALRSVGEAVTRTNSADPAELRAYILSDAFALD
                     GFKGRSLTYRRWNGQLRQPMPVVNARALVELTPIDGYLHQENDMDTLGLDRAESACKA
                     FGG"
     misc_feature    316296..317063
                     /locus_tag="NGR_b03140"
                     /note="Periplasmic binding domain of ATP-binding cassette
                     transporter-like systems that belong to the type I
                     periplasmic binding fold protein superfamily; Region:
                     PBP1_ABC_transporter_LIVBP_like; cd06268"
                     /db_xref="CDD:107263"
     misc_feature    316521..316526
                     /locus_tag="NGR_b03140"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107263"
     gene            317314..318276
                     /locus_tag="NGR_b03150"
                     /db_xref="GeneID:7789851"
     CDS             317314..318276
                     /locus_tag="NGR_b03150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822532.1"
                     /db_xref="GI:227818561"
                     /db_xref="GeneID:7789851"
                     /translation="MRRICLFLAAVAAFPLAATAGEIWVTNEKDDNISVIDIATLEVI
                     RTIPTGERPRGITFNSDHSRAYICASDSDAVEVMDPATGEILHELPSGEDPEQFVLAP
                     DDKHLWIANEDDAVTTVVDVDRREVVAQINVGIEPEGMAVSADGKIVVATSETTNMAH
                     WIDTATMKIVANTLVDSRPRHAEFTSDGKELWVSSEIGGSVTVFDVATRSEKAKIRFA
                     ITGVNDDLVQPVGFKFTPDGKTAFVALGPANHLAVIDMKTFAVEGYILVGRRVWHMAF
                     SPNHSQLFTTNGVSGDVTVIDVAERQPLKSIKVGRFPWGAATRP"
     misc_feature    317374..318273
                     /locus_tag="NGR_b03150"
                     /note="PQQ-dependent catabolism-associated beta-propeller
                     protein; Region: PQQ_ABC_repeats; TIGR03866"
                     /db_xref="CDD:234377"
     misc_feature    317380..317490
                     /locus_tag="NGR_b03150"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     misc_feature    318145..318264
                     /locus_tag="NGR_b03150"
                     /note="40-residue YVTN family beta-propeller repeat;
                     Region: beta_rpt_yvtn; TIGR02276"
                     /db_xref="CDD:213697"
     gene            318304..318759
                     /locus_tag="NGR_b03160"
                     /db_xref="GeneID:7789852"
     CDS             318304..318759
                     /locus_tag="NGR_b03160"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822533.1"
                     /db_xref="GI:227818562"
                     /db_xref="GeneID:7789852"
                     /translation="MRHRIVFAALLALALPNGVALADEESETPETGLAGLLSAPNRKE
                     LPKLTLAAGAALAAEPMRLKSGSYYKLTVEADGSQELALEGAGFFRAIWMNEIVVEGI
                     EIRPLGVASLEFDEAGEAEISFVAVVPGSYELKVPGTSGDLQKVAITIE"
     misc_feature    318484..318717
                     /locus_tag="NGR_b03160"
                     /note="Cupredoxin superfamily; Region: Cupredoxin;
                     cl19115"
                     /db_xref="CDD:267468"
     gene            318770..319483
                     /locus_tag="NGR_b03170"
                     /db_xref="GeneID:7789853"
     CDS             318770..319483
                     /locus_tag="NGR_b03170"
                     /note="ATP-binding cassette; transporter
                     nucleotide-binding domai"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_002822534.1"
                     /db_xref="GI:227818563"
                     /db_xref="GeneID:7789853"
                     /translation="MDGLAVEAITHDWGARRALDAVSFSVARGQFCALLGPNGAGKST
                     LYGLLTRLFTPRAGAIVIAGHDLARNPRAALARIGVVFQQPTIDLDLTVRRNLLYFAA
                     LHGLFGRQAEARVAAALERLGMADRAGEKAAALNGGHRRRMEIARALVHGPSVLLLDE
                     PTVGLDAAARAAIVDHVHRLAAEDGLTVLWATHLVDEVRPRDRLVVLHRGRVLAAGEA
                     GDIGGADLTGRFLALTGGA"
     misc_feature    318776..319471
                     /locus_tag="NGR_b03170"
                     /note="ABC transporter, ATP-binding subunit, PQQ-dependent
                     alcohol dehydrogenase system; Region: PQQ_ABC_ATP;
                     TIGR03864"
                     /db_xref="CDD:188394"
     misc_feature    318785..319432
                     /locus_tag="NGR_b03170"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    318875..318898
                     /locus_tag="NGR_b03170"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(318884..318889,318893..318901,319016..319018,
                     319244..319249,319346..319348)
                     /locus_tag="NGR_b03170"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    319007..319018
                     /locus_tag="NGR_b03170"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    319172..319201
                     /locus_tag="NGR_b03170"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    319232..319249
                     /locus_tag="NGR_b03170"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    319256..319267
                     /locus_tag="NGR_b03170"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    319334..319354
                     /locus_tag="NGR_b03170"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            319483..320376
                     /locus_tag="NGR_b03180"
                     /db_xref="GeneID:7789854"
     CDS             319483..320376
                     /locus_tag="NGR_b03180"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822535.1"
                     /db_xref="GI:227818564"
                     /db_xref="GeneID:7789854"
                     /translation="MTHAEECNDLEPRRFDVVTVTRSRTLESSAADTLLNRALVALSS
                     ILCREALRFLGQRGRLLAALVRPLVWLIVFAAGFRAALGLSITPPYQTYITYEIYITP
                     GLVGMILLFNGMQSSLSLVYDREMGSMRLLLTAPLPRWWLLTCKLIAGSLISVIQAYV
                     FLAAAAAWGIRFTLTGYLCALPAIMLAALMVGALGLVLSSFIRQLENFAGVMNFVIFP
                     VFFLSTALYPLWRMAEASPLLRNICAVNPFTHAVELVRFALHAQVEPLALAVTVAALA
                     VFGAGALWGYDPARGLAARKV"
     misc_feature    319597..320355
                     /locus_tag="NGR_b03180"
                     /note="ABC-2 type transporter; Region: ABC2_membrane;
                     cl17235"
                     /db_xref="CDD:266576"
     misc_feature    319672..320262
                     /locus_tag="NGR_b03180"
                     /note="ABC-type multidrug transport system, permease
                     component [Defense mechanisms]; Region: COG0842"
                     /db_xref="CDD:223912"
     gene            complement(320466..320690)
                     /locus_tag="NGR_b03190"
                     /db_xref="GeneID:7789855"
     CDS             complement(320466..320690)
                     /locus_tag="NGR_b03190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822536.1"
                     /db_xref="GI:227818565"
                     /db_xref="GeneID:7789855"
                     /translation="MVHIVISEIECRRGGLRFPSWLVLDEYNRVELDEAYDFSTTTPS
                     GAFSPAFVRKIAILIKQAATQRRLRAVVRK"
     gene            complement(320859..321110)
                     /locus_tag="NGR_b03200"
                     /db_xref="GeneID:7789856"
     CDS             complement(320859..321110)
                     /locus_tag="NGR_b03200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822537.1"
                     /db_xref="GI:227818566"
                     /db_xref="GeneID:7789856"
                     /translation="MKQFTFSDMNRASGEILETALIEPVALTKRGKEKLVILSATDYH
                     KLVGRPRVEAYTLADAPDDVHEELIAGLDAIIAGDDDHG"
     misc_feature    complement(<320973..321110)
                     /locus_tag="NGR_b03200"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            complement(321261..321695)
                     /locus_tag="NGR_b03210"
                     /db_xref="GeneID:7789857"
     CDS             complement(321261..321695)
                     /locus_tag="NGR_b03210"
                     /codon_start=1
                     /transl_table=11
                     /product="Pseudoazurin"
                     /protein_id="YP_002822538.1"
                     /db_xref="GI:227818567"
                     /db_xref="GeneID:7789857"
                     /translation="MLRRMGIVAAMVLMAGAAIAAEHEVKMLNKGESGTMIFEPAFVK
                     AAAGDTIRFVPVDKGHNVESIKGMLPDGVDKFKSKVNEEYVMTPTVPGLYGVKCSPHF
                     AMGMVALIQVGEVPPNVEAVKAVKLPKKADERIKEALAASFR"
     misc_feature    complement(321279..321632)
                     /locus_tag="NGR_b03210"
                     /note="Pseudoazurin (Paz) is a type I blue copper
                     electron-transfer protein; Region: Pseudoazurin; cd04218"
                     /db_xref="CDD:259880"
     misc_feature    complement(order(321378..321380,321393..321395,
                     321402..321404,321516..321518))
                     /locus_tag="NGR_b03210"
                     /note="Type 1 (T1) Cu binding site [ion binding]; other
                     site"
                     /db_xref="CDD:259880"
     gene            complement(321858..324062)
                     /locus_tag="NGR_b03220"
                     /db_xref="GeneID:7789858"
     CDS             complement(321858..324062)
                     /locus_tag="NGR_b03220"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="YP_002822539.1"
                     /db_xref="GI:227818568"
                     /db_xref="GeneID:7789858"
                     /translation="MTRISDWLIDPADNPERNTAKLLTIAEVLMRQVEQASGERGVAY
                     EQFQRAALLEDRVRQRTSDLESTLKILNETNARLAEANRATERARRNLADAIEAVEEG
                     FALFDASEILVMYNSRFCCDLEDVRATLRPGLSFADYIEACSRSRFLALPKGGGPADW
                     MATRMQRHRTRSVFQVALAGDRWLQVSEQPTSDGGTVVLQTDVTEIIRMERSERGRML
                     DDQARLIHATLEHINQGICIFDAAGRLVGWNERLRLLLDIPVTVLRTGTGFDTLQRWM
                     QRDGELLSSITPPELFSWAVQQTQRPPLFLEIRRTSGVMLVVFAEETPDRGFVMSFSD
                     VTRERLAIQAMQRANASLEARVAARTEDLRAALADAERANSTRARFVAAASHDLLQPL
                     SAAKLFVASARDETEDERAGGTLDKAHKALASVEAILGALLDISRLDEAVVEISPVRL
                     APLFAQLTDEFAPMAERKGLQLAILPCALTVFSDPAYLRRILQNLISNAIRYTRTGRV
                     LVGPRRLPGGVRIEVHDTGPGIAPEDQRAIFREFHRLNASASASEGLGLGLAIVERAC
                     ALLGHRLTLNSTPGRGTCFAIELEQAPARAVASYPCGEAIEDGATDDVGDRIALLVEN
                     DEELRHAISLVLERRGVTVLEVASGEEALELVDEMGIVPDLYLVDQQLGDGLTGIETL
                     TALKQRHGDRPARIITADRTPSVRDACAAAEIEIIYKPLDPEVLDAFVTRGG"
     misc_feature    complement(323430..323777)
                     /locus_tag="NGR_b03220"
                     /note="PAS fold; Region: PAS_7; pfam12860"
                     /db_xref="CDD:257355"
     misc_feature    complement(322296..323258)
                     /locus_tag="NGR_b03220"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: BaeS; COG0642"
                     /db_xref="CDD:223715"
     misc_feature    complement(322752..322943)
                     /locus_tag="NGR_b03220"
                     /note="Histidine Kinase A (dimerization/phosphoacceptor)
                     domain; Histidine Kinase A dimers are formed through
                     parallel association of 2 domains creating 4-helix
                     bundles; usually these domains contain a conserved His
                     residue and are activated via...; Region: HisKA; cd00082"
                     /db_xref="CDD:119399"
     misc_feature    complement(order(322767..322769,322779..322781,
                     322788..322790,322800..322802,322809..322811,
                     322821..322823,322869..322871,322878..322880,
                     322890..322892,322899..322901,322911..322913,
                     322923..322925))
                     /locus_tag="NGR_b03220"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119399"
     misc_feature    complement(322905..322907)
                     /locus_tag="NGR_b03220"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:119399"
     misc_feature    complement(322296..322601)
                     /locus_tag="NGR_b03220"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(322308..322310,322314..322319,
                     322332..322334,322338..322340,322386..322397,
                     322473..322478,322482..322484,322488..322490,
                     322494..322496,322560..322562,322569..322571,
                     322581..322583))
                     /locus_tag="NGR_b03220"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(322569..322571)
                     /locus_tag="NGR_b03220"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(322389..322391,322395..322397,
                     322476..322478,322482..322484))
                     /locus_tag="NGR_b03220"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(321885..322205)
                     /locus_tag="NGR_b03220"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(321903..321908,321915..321917,
                     321969..321971,322029..322031,322056..322058,
                     322191..322196))
                     /locus_tag="NGR_b03220"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(322056..322058)
                     /locus_tag="NGR_b03220"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(322029..322037,322044..322049))
                     /locus_tag="NGR_b03220"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(321900..321908)
                     /locus_tag="NGR_b03220"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(324059..325240)
                     /locus_tag="NGR_b03230"
                     /db_xref="GeneID:7789859"
     CDS             complement(324059..325240)
                     /locus_tag="NGR_b03230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822540.1"
                     /db_xref="GI:227818569"
                     /db_xref="GeneID:7789859"
                     /translation="MRIFGGSGVVRDAIVPSASTAANDPNAAETLSRQLGPGPFSLIM
                     LFLSPAADLERLPAEAARVFVDVPIVGCTTAGEISGAGYDEGTVVALALPSEFFRVDT
                     VTIPDLMRLDPPALAAAVVRKRVAMARQYPELAHEFALLLVDGLSQKEDELTSALAAG
                     LGAMPMLGGSAGDGTRYARTFVLDGGRLSRNAAVLALVRTECPVRVFNFDHLMPTERR
                     MVVTEADPRRRVVRQINAEPAAHEYARLVGKDPQQLSPFTFAAHPVAVRMGTRHHVRA
                     IRQVMDNGDLVFFSAIDEGVVLTITEPADMVGQLKRELAGLCMPERPTAILAFDCILR
                     RLEAEEKQVIGRVSGLLRRHGVVGFSTYGEQFGPMHVNQTMTGVAIYPPGTVLPEKVP
                     E"
     misc_feature    complement(324101..325186)
                     /locus_tag="NGR_b03230"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3287"
                     /db_xref="CDD:225825"
     misc_feature    complement(324527..325126)
                     /locus_tag="NGR_b03230"
                     /note="FIST N domain; Region: FIST; pfam08495"
                     /db_xref="CDD:254834"
     misc_feature    complement(324140..324526)
                     /locus_tag="NGR_b03230"
                     /note="FIST C domain; Region: FIST_C; pfam10442"
                     /db_xref="CDD:255992"
     gene            complement(325314..326036)
                     /locus_tag="NGR_b03240"
                     /db_xref="GeneID:7789860"
     CDS             complement(325314..326036)
                     /locus_tag="NGR_b03240"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_002822541.1"
                     /db_xref="GI:227818570"
                     /db_xref="GeneID:7789860"
                     /translation="MIIIRNSFQTPRTISPVQPLFKPVELRSALIVDDHPLFCDALAM
                     TLSGLVGIQSIESVGTLDAALARLDQDGPPDVVVLDLNLPDVNGLDGVVRLRQAAPQI
                     PIVVVSSLDELRVIRALLKAGINGFVPKHAARDEFRAAFAAIARGEIHAPQMALEPGS
                     PSLSDEAVARLGLLTRQQAKILQLVCAGLMNKQIAYELSIAETTVKAHVTAIMRKLGV
                     QTRMQAVLFAQEARFTALAPED"
     misc_feature    complement(325338..325949)
                     /locus_tag="NGR_b03240"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(325629..325949)
                     /locus_tag="NGR_b03240"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(325644..325649,325656..325658,
                     325713..325715,325773..325775,325797..325799,
                     325935..325940))
                     /locus_tag="NGR_b03240"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(325797..325799)
                     /locus_tag="NGR_b03240"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(325773..325781,325785..325790))
                     /locus_tag="NGR_b03240"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(325641..325649)
                     /locus_tag="NGR_b03240"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(325347..325517)
                     /locus_tag="NGR_b03240"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(325374..325376,325407..325421,
                     325425..325430,325434..325439,325461..325469,
                     325506..325514))
                     /locus_tag="NGR_b03240"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(325347..325352,325359..325361,
                     325368..325376,325467..325469,325473..325475,
                     325479..325481))
                     /locus_tag="NGR_b03240"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(326127..327893)
                     /locus_tag="NGR_b03250"
                     /db_xref="GeneID:7789861"
     CDS             complement(326127..327893)
                     /locus_tag="NGR_b03250"
                     /note="acceptor"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="YP_002822542.1"
                     /db_xref="GI:227818571"
                     /db_xref="GeneID:7789861"
                     /translation="MQRLMLTAVTLLSLAGLASAEVTEEDLAKDATTVGDVLTNGMGR
                     GLQRYSPLETLNKTNVKNLLPAWGFSLGGEKQRGQESQPIVYDGVMYITASYSRLYAI
                     DIKTGKELWQFDARLPEGILPCCDVINRGAAIYGDNIYFGTLDARLVALNRKTGDVVW
                     NKKIANYKEGYSYTAAPLIVNGLIITGNSGGEFGIVGEVQARDAKTGELVWTRPVIEG
                     HVGSYKGKDSSMTGTLNATWPGDLWKTGGGATWLGGSYDADTDTLVFGTGNPAPWNSH
                     LRNAGKPVEGNKGDNLYAASRLGINPENGEIKWHFQTTPREGWDFDGVNEVVPFISKD
                     GTKRFATADRNGFFYVLNREDGKFVAAYPFVKNITWAKGIDETGRPIYAEENRPGDPS
                     SAADGGKGQQVFSVPSFLGGKNWMPMAYSQKSELFYVPSNEWGMDIWNEPISYKKGAA
                     YLGAGFTIKPLFEDYIGSLKAIDPNSGEIKWEYKNAAPLWGGVMATAGGLVFVGTPEG
                     EFKALDDETGEELWSFQTGSGVVGQPITWEQDGEQYVSVISGWGGAVPLWGGEVAKKV
                     NYLNQGGMVWTFRLPKQLALAK"
     misc_feature    complement(326238..327842)
                     /locus_tag="NGR_b03250"
                     /note="PQQ-dependent dehydrogenase, methanol/ethanol
                     family; Region: PQQ_enz_alc_DH; TIGR03075"
                     /db_xref="CDD:234102"
     misc_feature    complement(326154..327815)
                     /locus_tag="NGR_b03250"
                     /note="Ethanol dehydrogenase, a bacterial quinoprotein
                     (PQQ-dependent type I alcohol dehydrogenase); Region:
                     PQQ_ADH_I; cd10277"
                     /db_xref="CDD:199835"
     misc_feature    complement(order(326166..326168,326178..326186,
                     326313..326324,327567..327569,327606..327608,
                     327663..327668,327678..327680,327684..327704,
                     327708..327713))
                     /locus_tag="NGR_b03250"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199835"
     misc_feature    complement(order(326157..326159,326163..326165,
                     326328..326330,326337..326345,326352..326354,
                     326358..326360,326451..326453,326460..326468,
                     326475..326477,326481..326483,326814..326816,
                     326823..326831,326838..326840,326844..326846,
                     326967..326969,326976..326984,326991..326993,
                     326997..326999,327261..327263,327270..327278,
                     327285..327287,327291..327293,327414..327416,
                     327423..327431,327438..327440,327444..327446,
                     327561..327563,327570..327578,327585..327587,
                     327591..327593,327693..327695,327702..327710))
                     /locus_tag="NGR_b03250"
                     /note="Trp docking motif [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199835"
     misc_feature    complement(order(326424..326426,326862..326864,
                     326934..326936,327087..327089,327141..327143,
                     327321..327326,327372..327374,327504..327506,
                     327519..327524,327654..327656))
                     /locus_tag="NGR_b03250"
                     /note="active site"
                     /db_xref="CDD:199835"
     gene            328113..328475
                     /locus_tag="NGR_b03260"
                     /db_xref="GeneID:7789862"
     CDS             328113..328475
                     /locus_tag="NGR_b03260"
                     /note="pyrroloquinoline quinonesynthesis protein A"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ synthesis protein A"
                     /protein_id="YP_002822543.1"
                     /db_xref="GI:227818572"
                     /db_xref="GeneID:7789862"
                     /translation="MPAPTWLLPSARTTGFRSADQFDLNYDHRCEKARRQRRCRVLPV
                     RQKADPAPHPSGVPTNTACSVLDPAATAPARAGPGTKPPEANGENMSWHAPKFIDVSC
                     AMEITRYAPADGSEPVLF"
     misc_feature    328380..328439
                     /locus_tag="NGR_b03260"
                     /note="PqqA family; Region: PqqA; pfam08042"
                     /db_xref="CDD:254599"
     gene            328521..329432
                     /locus_tag="NGR_b03270"
                     /db_xref="GeneID:7789863"
     CDS             328521..329432
                     /locus_tag="NGR_b03270"
                     /note="possibly involved in transport of pyrroloquinoline
                     quinone transport"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqB"
                     /protein_id="YP_002822544.1"
                     /db_xref="GI:227818573"
                     /db_xref="GeneID:7789863"
                     /translation="MKNASDLRVVVLGAAAGGGLPQWNCGCRNCAAAREPGSSLRPQT
                     QSSLAVSLDGEAWAIFNASPDIRQQIQVNAALQPHRLRHSPIKAVVLTNGDIDHLAGL
                     LVLREKQPFTVFSTGAVAEVIADNPVFGVLDPGLVSKSVVAIEEPFSPLPGLEARLFA
                     VPGKVPLFLEDGDPELGLEGEQTVGLELRADGKRVYYIPGCGALSGSLVARLEGADAL
                     FFDGTLFSDDEMIAAGVGQKTGRRMGHMPIAGEDGSLKALGPLKIPRKIYVHINNTNP
                     IWQAGPERECAEAHGFEVGFDGMEVRP"
     misc_feature    328539..329426
                     /locus_tag="NGR_b03270"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqB;
                     Provisional; Region: PRK05184"
                     /db_xref="CDD:235361"
     gene            329429..330196
                     /locus_tag="NGR_b03280"
                     /db_xref="GeneID:7789864"
     CDS             329429..330196
                     /locus_tag="NGR_b03280"
                     /EC_number="1.3.3.11"
                     /note="Required in the synthesis of PPQ, but its exact
                     function is unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqC"
                     /protein_id="YP_002822545.1"
                     /db_xref="GI:227818574"
                     /db_xref="GeneID:7789864"
                     /translation="MTIAADKQAFHARLLSIGSDRYHDKHPFHVMLHGGRCTMTQVRA
                     WVLNRYYYQTRIPMKDAAFLSRCDDPQMRRAWRSRIEDHDGGHDEGGGIRRWLRLAEA
                     VGLDADFVASTKGVLPATRFAVDAYVAFVRQQPLLEAVASSLTELFAPKIHSERIAGL
                     LEHYAFADDAALAYFRQRLVEAPQDVKFGLAYVLDHADTAEKQNAAVAALTFKTEVLW
                     SQLDALYGAYVAPGLIPPGGWDGREGVTAAAAAEAAE"
     misc_feature    329429..330160
                     /locus_tag="NGR_b03280"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqC;
                     Provisional; Region: PRK05157"
                     /db_xref="CDD:235353"
     gene            330193..330486
                     /locus_tag="NGR_b03290"
                     /db_xref="GeneID:7789865"
     CDS             330193..330486
                     /locus_tag="NGR_b03290"
                     /note="Pyrroloquinoline quinonebiosynthesis protein D"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme PQQ synthesis protein D"
                     /protein_id="YP_002822546.1"
                     /db_xref="GI:227818575"
                     /db_xref="GeneID:7789865"
                     /translation="MTEAPAISSSSVVKLARGVRLRDDAVRGQLVLLAPERAMALDEI
                     AARIVQALDGERTLDRIAADFAAEFEAPAEEIANDITIFIQQLAARRMLEIAE"
     misc_feature    330235..330474
                     /locus_tag="NGR_b03290"
                     /note="Coenzyme PQQ synthesis protein D (PqqD); Region:
                     PqqD; cl05126"
                     /db_xref="CDD:262441"
     gene            330483..331607
                     /locus_tag="NGR_b03300"
                     /db_xref="GeneID:7789866"
     CDS             330483..331607
                     /locus_tag="NGR_b03300"
                     /note="Pyrroloquinoline quinonebiosynthesis protein E"
                     /codon_start=1
                     /transl_table=11
                     /product="pyrroloquinoline quinone biosynthesis protein
                     PqqE"
                     /protein_id="YP_002822547.1"
                     /db_xref="GI:227818576"
                     /db_xref="GeneID:7789866"
                     /translation="MSKPITVGSDAARHARPVPPPMAMLAELTHRCPLACPYCSNPID
                     LTHADGELSTGEWIGVFEQAAKLGVLHLHLSGGEPAARRDLAELTRAAASFGLYTNLI
                     TSGVGLTEARIGELADAGLDHVQLSLQGVSPEGADRISGYRGGYDRKMAVAGWVTAAT
                     IPLTVNAVCHRQNMDQIDAMIDLAIGLRARRIEIATVQFHGWAERNKAALLPTRVQVE
                     RATSTVAEARRKYEGVIEIDYVPADYHSNYPKACMGGWGRVGLNVTPSGRVLPCHAAE
                     TIPSLSFDNVRDGSLARIWYEGDAFNAYRGDTWMPELCRSCERKNVDFGGCRCQAMAL
                     AGDASAMDPVCVRSPLRGGLTEDTDRLLALSSAELVFRGR"
     misc_feature    330501..331604
                     /locus_tag="NGR_b03300"
                     /note="pyrroloquinoline quinone biosynthesis protein PqqE;
                     Provisional; Region: PRK05301"
                     /db_xref="CDD:235397"
     misc_feature    330561..331139
                     /locus_tag="NGR_b03300"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(330576..330578,330582..330584,330588..330590,
                     330594..330602,330705..330707,330711..330716,
                     330786..330794,330861..330863,330984..330986,
                     331077..331082)
                     /locus_tag="NGR_b03300"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    331263..331517
                     /locus_tag="NGR_b03300"
                     /note="radical SAM additional 4Fe4S-binding SPASM domain;
                     Region: rSAM_more_4Fe4S; TIGR04085"
                     /db_xref="CDD:234461"
     gene            331872..332903
                     /locus_tag="NGR_b03310"
                     /db_xref="GeneID:7789867"
     CDS             331872..332903
                     /locus_tag="NGR_b03310"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002822548.1"
                     /db_xref="GI:227818577"
                     /db_xref="GeneID:7789867"
                     /translation="MPENSTAHASFQFRGSSFDSMIETLGGAFGTFDAEPISQARDFR
                     WGIDLSACDSAVLITGFHQTDFQFHIEPTADTTEYLSIVVPRSGGMGVTYGPRTAEAG
                     QGELLLYNNFEPNSVIMRGEENVVDELLINWSVVLQTLGQTFEAPFDGSLDLVPQVSL
                     ATPAGQLIGNLTETIMGGIRNDGPLLQSPIAMAHVTQALADVVVRLVPHRLSHLLDKK
                     PCLIAPRHVRRAIEFMQANISRPITMPMVAEAAGVSVRALETGFRAFRDTTPAAYLLR
                     LRLRAARQDLLDPDNNQPMRKICLKWGFFHFGRFSAVYRSTYGENPSDTRRRVGSSTA
                     PYVFSDAQR"
     misc_feature    331938..332471
                     /locus_tag="NGR_b03310"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     misc_feature    332610..332855
                     /locus_tag="NGR_b03310"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     gene            333174..334151
                     /locus_tag="NGR_b03320"
                     /db_xref="GeneID:7789868"
     CDS             333174..334151
                     /locus_tag="NGR_b03320"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_002822549.1"
                     /db_xref="GI:227818578"
                     /db_xref="GeneID:7789868"
                     /translation="MALGDPANRPDWVTFEGSDPDRLAATLTSWTSNVVVRPLSRERI
                     SYKCAWANAGIVSIGSTHFDGQILFESEGAGGQLVLIVPRRGGVDLRMGRQAFCTSPG
                     RGAVIEGNQRIAARSLSSREHMFVAIDQAALYRRLCDVVEMPASGALEFSPEIDLLSG
                     PGTAIASIAATLRAGLDGEAPLRRSPLALTNLSEALIQVILDTLPHRFSEKMRRAASP
                     VPRHVKKAVEFMMANLSKPITLVEVAAVCGVSSRTLQQGFRQFKMTTPMSYLQDLRLK
                     ALREELTQARPGQSIADIAFKWGFTHMGRLATDYRNRFGELPSQTLRSC"
     misc_feature    333279..333776
                     /locus_tag="NGR_b03320"
                     /note="AraC-binding-like domain; Region: AraC_binding_2;
                     pfam14525"
                     /db_xref="CDD:258665"
     misc_feature    333870..333986
                     /locus_tag="NGR_b03320"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    333900..334145
                     /locus_tag="NGR_b03320"
                     /note="Helix-turn-helix domain; Region: HTH_18; pfam12833"
                     /db_xref="CDD:257335"
     gene            334236..334742
                     /locus_tag="NGR_b03330"
                     /db_xref="GeneID:7789869"
     CDS             334236..334742
                     /locus_tag="NGR_b03330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822550.1"
                     /db_xref="GI:227818579"
                     /db_xref="GeneID:7789869"
                     /translation="MREPETISFQPSEWVPNHPRLPVLVYRQALPSVERDVAAEFERR
                     FAEAGWQGLWRNGVFSYQHYHIGAHEVLGIARGIARLLIGGSEGAVLEVGPGDSLVLP
                     AGTGHMNLGASDGFLVVGGYPPGQTADIQTKAASRSALQTIADLPLPPADPLYGANGP
                     LTRLWHSA"
     misc_feature    334239..334730
                     /locus_tag="NGR_b03330"
                     /note="Uncharacterized protein containing double-stranded
                     beta helix domain [Function unknown]; Region: COG4297"
                     /db_xref="CDD:226747"
     gene            334952..335125
                     /locus_tag="NGR_b03340"
                     /db_xref="GeneID:7789870"
     CDS             334952..335125
                     /locus_tag="NGR_b03340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822551.1"
                     /db_xref="GI:227818580"
                     /db_xref="GeneID:7789870"
                     /translation="MTVTLDQAIAKMEATGDWEFDEDTLWSDKDIADYEAETGLLKGA
                     DLPGRTTRASPAA"
     gene            complement(335100..336164)
                     /locus_tag="NGR_b03350"
                     /db_xref="GeneID:7789871"
     CDS             complement(335100..336164)
                     /locus_tag="NGR_b03350"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylate class-3/4/guanylyl cyclase"
                     /protein_id="YP_002822552.1"
                     /db_xref="GI:227818581"
                     /db_xref="GeneID:7789871"
                     /translation="MDLPTPLAWLVDEAGASPGPDRFLADLGGRLLADRLPLAGGALT
                     LAVPHPIIARRTWLWRAESGAVIESLGFAGGPPSQAERDWLAALGPVLEDRIGAAPDK
                     PVLAWAGTRGFDDDEAGRLRQAARFAAAPLAALSEKAALSALLEAYLGRRSAARVQAG
                     ALTRGTGETIRAALLYADLRNFTALSEATEPTEMIAALDAWFDRVAGAIHAFGGEVLK
                     FIGDGLLAIFPVTGWAPEACEAALRAVVAARAGMAHLDAVRQAQGLPPLPFGTALHLG
                     DVLWGNIGAVDRLDFTAIGPAVNLVSRLEGLCRPLGQSVLISGAVAAEASSPLVPLGE
                     HVLRGIQAPCPVFTLPATRA"
     misc_feature    complement(335211..335756)
                     /locus_tag="NGR_b03350"
                     /note="Adenylyl- / guanylyl cyclase, catalytic domain;
                     Region: CYCc; smart00044"
                     /db_xref="CDD:214485"
     misc_feature    complement(335118..335654)
                     /locus_tag="NGR_b03350"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(335151..335153,335256..335261,
                     335268..335273,335283..335291,335490..335492,
                     335499..335507,335511..335513,335616..335633,
                     335637..335639))
                     /locus_tag="NGR_b03350"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(335499..335501,335631..335633))
                     /locus_tag="NGR_b03350"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(335151..335153,335268..335270,
                     335277..335288,335319..335321,335328..335330,
                     335508..335513,335547..335549,335559..335561,
                     335568..335573,335580..335582,335616..335618))
                     /locus_tag="NGR_b03350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     gene            336402..336857
                     /locus_tag="NGR_b03360"
                     /db_xref="GeneID:7789872"
     CDS             336402..336857
                     /locus_tag="NGR_b03360"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822553.1"
                     /db_xref="GI:227818582"
                     /db_xref="GeneID:7789872"
                     /translation="MQESLVVRRETHIAAPPAAVFALLTDPEKILRWMGTEAEIEPQP
                     EGLYLVNVTGARFARGAFREVVPVHRLAYSFGWEGSEVVPPGSSLVEIDLIEQPDGTL
                     LRLTHTGLPSAEQCAGHAEGWAHYLDRLGEAAAGRDPGPDPWHGRTGSD"
     misc_feature    336420..336809
                     /locus_tag="NGR_b03360"
                     /note="Putative hydrophobic ligand-binding SRPBCC domain
                     of Micromonospora echinospora CalC, human Aha1, and
                     related proteins; Region: SRPBCC_CalC_Aha1-like; cd07814"
                     /db_xref="CDD:176856"
     misc_feature    order(336420..336422,336426..336428,336432..336434,
                     336459..336467,336471..336476,336489..336491,
                     336513..336515,336537..336539,336543..336545,
                     336549..336551,336555..336557,336576..336581,
                     336585..336587,336594..336596,336612..336614,
                     336618..336623,336666..336671,336675..336677,
                     336681..336683,336711..336713,336717..336719,
                     336723..336725,336729..336731,336744..336770,
                     336774..336782,336789..336791)
                     /locus_tag="NGR_b03360"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176856"
     gene            complement(337138..338229)
                     /locus_tag="NGR_b03370"
                     /db_xref="GeneID:7789873"
     CDS             complement(337138..338229)
                     /locus_tag="NGR_b03370"
                     /note="3-hydroxybutyrate; depolymerase Lpq"
                     /codon_start=1
                     /transl_table=11
                     /product="LpqC, Poly"
                     /protein_id="YP_002822554.1"
                     /db_xref="GI:227818583"
                     /db_xref="GeneID:7789873"
                     /translation="MRTISDTLARTTRLKPGKAEPVHPRSRLLTLTDFGSNPGGLKAK
                     YYLPKSLAKKPALVVVLHGCTQIPADYDAGSGWSKMADEHGFALLYPQQLRDNNGNLC
                     FNWFLPDDFGREKGEALSIRQMIAAMVSRHKLASERIYVTGLSAGGAMANVVLATYPE
                     VFAGGAIIAGLPYATASTVSEAFDRMRGHGIPQARELRTILRAASGHTGPWPTLSVWH
                     GTNDGTVSEANARAIVEQWRGAHGLGSTPDVTETVDGQARNVWKGIDGRDRIALYSIR
                     DMGHGLPLDVASGYGKSGPYMLDVGISSTAHIAHSWGLTRKPARRRQNRSAAKPPSVR
                     VTPADRPFSLGEKIRTVIGYALRTTRLKP"
     misc_feature    complement(337270..338130)
                     /locus_tag="NGR_b03370"
                     /note="Prolyl oligopeptidase family; Region: Peptidase_S9;
                     cl19144"
                     /db_xref="CDD:267497"
     gene            338610..338804
                     /locus_tag="NGR_b03380"
                     /db_xref="GeneID:7789874"
     CDS             338610..338804
                     /locus_tag="NGR_b03380"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822555.1"
                     /db_xref="GI:227818584"
                     /db_xref="GeneID:7789874"
                     /translation="MRYRISAYPEREARSGIPVALMLALIAVLSAYLFVGDMLTEPRQ
                     QTRVYPPDAVTMVENAKKTP"
     gene            339277..339747
                     /locus_tag="NGR_b03390"
                     /db_xref="GeneID:7789875"
     CDS             339277..339747
                     /locus_tag="NGR_b03390"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822556.1"
                     /db_xref="GI:227818585"
                     /db_xref="GeneID:7789875"
                     /translation="MIFVRSNARTNGQKFVAVLCTVTISFVLASLPYKATLTDSALEL
                     SLQSAFAKNGGNGGNGNGGGGNGNGGGNGNGGGNGNGKGGSNSSSSSSSSTGAKAKGT
                     TVGTFGSILKIRHVEGISEEIRNGRYIMKDGRGRTIVNRRATSADQKRLLSLID"
     gene            complement(339737..340390)
                     /locus_tag="NGR_b03400"
                     /db_xref="GeneID:7789876"
     CDS             complement(339737..340390)
                     /locus_tag="NGR_b03400"
                     /codon_start=1
                     /transl_table=11
                     /product="CitB, response regulator containing a CheY-like
                     receiver domain and an HTH DNA-binding domain CitB"
                     /protein_id="YP_002822557.1"
                     /db_xref="GI:227818586"
                     /db_xref="GeneID:7789876"
                     /translation="MTAAIRVAVIDDHPLFREGVTRSLSEIDGFEIVAEGGSRDDALR
                     IAENLAPDVMLLDISMPGSGLEAVPLILQIAPSQKIVMLTVSEAGDDVKAALQGGAKG
                     YVLKGIGSRALADVIRSVASGESYVAPTLSAKLLSNSAPTPGSKFDGIGELTTREREV
                     LKLVASGMSNKQVARNLNLHEKTIKHHMTQIMAKLDVANRTEAAMVLRDALDRPLSQ"
     misc_feature    complement(339764..340378)
                     /locus_tag="NGR_b03400"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(340028..340366)
                     /locus_tag="NGR_b03400"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(340070..340075,340082..340084,
                     340139..340141,340199..340201,340220..340222,
                     340355..340360))
                     /locus_tag="NGR_b03400"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(340220..340222)
                     /locus_tag="NGR_b03400"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(340199..340204,340208..340213))
                     /locus_tag="NGR_b03400"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(340067..340075)
                     /locus_tag="NGR_b03400"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(339779..339934)
                     /locus_tag="NGR_b03400"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(339791..339793,339824..339838,
                     339842..339847,339851..339856,339878..339886,
                     339923..339931))
                     /locus_tag="NGR_b03400"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(339785..339793,339884..339886,
                     339890..339892,339896..339898))
                     /locus_tag="NGR_b03400"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(340387..341877)
                     /locus_tag="NGR_b03410"
                     /db_xref="GeneID:7789877"
     CDS             complement(340387..341877)
                     /locus_tag="NGR_b03410"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor protein kinase"
                     /protein_id="YP_002822558.1"
                     /db_xref="GI:227818587"
                     /db_xref="GeneID:7789877"
                     /translation="MTHLPEAVVISASNQTMCRQRIERTGPRFVVRAKNLITRWNAQP
                     LAKQFLTAGGIVATVAMLVVGAFVTSLIEEAVTRNSAATTALYVDSVIAPLLPDMQTT
                     EVLDDTVSRALDETLGQGALGNRLLAFRLWRADGTILYANEEAMVGKRFELSPELQAA
                     FDGQVGAQFKPVDELDNETERAANKPLLEIYNPVLQPWSGQVVAVSEFHEIANDFELS
                     LHRARLMTWFAVAGFTLAFFIVLSAIVMRGGRTIEKQRLALKQRIDELSASLSQNETL
                     RGRLQQASQRTTALNEQMLRRIGADLHDGPAQLLAYASLRLDSDAVMNPLVPAEKRER
                     EVASIKASLDEAMHEIRTLCNGLVLPQIETASLPEILERCIHAHKQRTGSAVDLSLSR
                     PPDRLSPSAKICIYRFVQEALNNAYRHGGGVGQRVVQSIDGNRIRIEVADGGPGFDPN
                     KVTPTSLGLAGLRERIESLGGTFELNAAAPGTVVRMSLGIEEIAQI"
     misc_feature    complement(340408..341517)
                     /locus_tag="NGR_b03410"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    complement(340807..340992)
                     /locus_tag="NGR_b03410"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    complement(340414..340665)
                     /locus_tag="NGR_b03410"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(340426..340428,340432..340437,
                     340450..340452,340453..340455,340501..340512,
                     340537..340542,340546..340548,340552..340554,
                     340558..340560,340624..340626,340633..340635,
                     340645..340647))
                     /locus_tag="NGR_b03410"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(340633..340635)
                     /locus_tag="NGR_b03410"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(340504..340506,340510..340512,
                     340540..340542,340546..340548))
                     /locus_tag="NGR_b03410"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            342058..343200
                     /locus_tag="NGR_b03420"
                     /db_xref="GeneID:7789878"
     CDS             342058..343200
                     /locus_tag="NGR_b03420"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822559.1"
                     /db_xref="GI:227818588"
                     /db_xref="GeneID:7789878"
                     /translation="MAISRTIGRSVVALSIAVAPLAAVTFGATETAFAKSGNGGGNGG
                     GNGGGNGGGNGKGNGNGGSHGGGQSKSHSGSGKQGTTRAGKSNGDNLLKSLFSRGTKS
                     KKTIKAAKPAKTGNVAKIKTKSVDPETPGLRPAFSSLNRNYHAYLNSNDPRMAAIAAY
                     ALSYAEFEAENGTDAIPSDPALSDEALREALESFSKDGVVTDSDLLEAKEILGVGPAY
                     GKIDEIRGTLPDTSDVSDVSDTSDDGLDTSDDGLDTAEDTSEDIPDELPEVDGHRPGF
                     NSLNRNYHAYLNSNDPRMAGISDYAVAYAEFEAENGTDAVPTDPALSDEALREALESF
                     SKDGFVTDEDLLEAKAILGVGPTFGKIDEIRGTLPETTTDDLGVAE"
     gene            343269..344078
                     /locus_tag="NGR_b03430"
                     /db_xref="GeneID:7789879"
     CDS             343269..344078
                     /locus_tag="NGR_b03430"
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction protein"
                     /protein_id="YP_002822560.1"
                     /db_xref="GI:227818589"
                     /db_xref="GeneID:7789879"
                     /translation="MNLETRDDAIGGAVRAMQHGRIGFSLQKINAVDDPSTILYSECL
                     GRFVEPDGTVRTRGEFSAFPEASQVDLAFGPDLLGLAFEWLACHPSYVLGCDISAENM
                     ADERTCTVLYDLLSRHRALATRMVLEVTENLRPNGLSVAADLLKGARAIGYRIAIDKF
                     GTGNSRLSIPADAVKIDACFAQHRRGDAAPILRDMVALASCAATTVVVEGIETYDQLE
                     AARIAGATHVQGFLLSEPTLPPIYSRSVRAFRRRHRPVSPRSQPLQPSWPL"
     misc_feature    343311..343976
                     /locus_tag="NGR_b03430"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(344064..345191)
                     /locus_tag="NGR_b03440"
                     /db_xref="GeneID:7789880"
     CDS             complement(344064..345191)
                     /locus_tag="NGR_b03440"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_002822561.1"
                     /db_xref="GI:227818590"
                     /db_xref="GeneID:7789880"
                     /translation="MERERLTSFHRTETVRPVAASAVSCEDDVIVASLQKCQATDRSS
                     PDMAEDARSALHSCIERYIEFVLSSAMPHPDLNLLVTLDVLLAEGSVARAARRLRLSP
                     SAMSRQLARLRETTGDPLLVRAGRGLVLTPRALELSERVGHLVEEAGAMLRPAEQLDL
                     RRLAGTFTLRASDGFVENFGPALIDSVGAEAPGVRLRFVPKLDKDSTPLRDGSVDLET
                     GVVGGSQGPEVRAQALFRDRFVGVVRVGHELCQGEVTPVRYAAGRHILVARHRLDKGP
                     IDDALEMLGLEREIAATVGGFSPALALARNSDMIATVPERHTGNLRAGLFSFTLPIPI
                     AEITVSMLWHPRLDADPAHRWLRECVRAMCVKPLASPLQRP"
     misc_feature    complement(344100..344972)
                     /locus_tag="NGR_b03440"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(344790..344966)
                     /locus_tag="NGR_b03440"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(344100..344696)
                     /locus_tag="NGR_b03440"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     similar to DntR, which is involved in the catabolism of
                     dinitrotoluene; contains the type 2 periplasmic binding
                     fold; Region: PBP2_DntR_like_1; cd08460"
                     /db_xref="CDD:176149"
     misc_feature    complement(order(344175..344177,344370..344372,
                     344481..344483,344655..344657,344667..344672,
                     344676..344678))
                     /locus_tag="NGR_b03440"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176149"
     misc_feature    complement(order(344232..344234,344274..344276,
                     344283..344288,344295..344300,344307..344321,
                     344403..344405,344592..344594,344598..344612,
                     344616..344621,344628..344633,344637..344642,
                     344649..344654,344661..344666,344673..344675))
                     /locus_tag="NGR_b03440"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176149"
     gene            345103..346560
                     /locus_tag="NGR_b03450"
                     /db_xref="GeneID:7789881"
     CDS             345103..346560
                     /locus_tag="NGR_b03450"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane efflux protein"
                     /protein_id="YP_002822562.1"
                     /db_xref="GI:227818591"
                     /db_xref="GeneID:7789881"
                     /translation="MTSSSQDTADAATGRTVSVRWKLVSLSLSMLLASLGTSIANVGL
                     PTLAETFSASFQQVQWVVLAYLLAVTTLIVSIGRLGDIVGRRRLLLAGIALFTLASAC
                     CGSAPHLVWLVAARAVQGLGAAVMLALAVALVSETVPKEKTGSAMGLLGTMSAIGTAL
                     GPSLGGALIAGFGWWAMFLVTVPVGLLVLFLAYHALPADRPASKAGRSGFDAIGTLVL
                     ALTLGAYALAMTIGHGAIGTTNLALMLAALLGIFLFLFVETRAASPLVELAMLRETPL
                     RSGLITSMLVATVMMTTLVVGPFYLSRGLGLDAALVGLVMSAGPVVSALAGVPAGRLV
                     DRFGVRHVSVAGLGAMATGCLALSVVPQLFGVAGYLLPLVILTAGYALFQAANTTGVM
                     KDALPEQRGIVSGLLNLSRNLGLITGASVMGAIFSLAAASEAVTASPAAAAAGMAATF
                     AVATALVVLAAAIAAASRAPAVRPTAPEAQQAGGG"
     misc_feature    345208..346383
                     /locus_tag="NGR_b03450"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(345211..345213,345220..345228,345232..345237,
                     345286..345288,345295..345300,345307..345309,
                     345319..345324,345328..345333,345469..345474,
                     345481..345486,345493..345498,345505..345507,
                     345541..345546,345553..345558,345574..345576,
                     345961..345963,345970..345975,345982..345987,
                     345994..345996,346036..346038,346048..346050,
                     346060..346062,346069..346071,346081..346083,
                     346231..346233,346240..346245,346252..346254,
                     346264..346269,346276..346278,346309..346314,
                     346321..346326,346333..346338,346345..346347)
                     /locus_tag="NGR_b03450"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    345235..346359
                     /locus_tag="NGR_b03450"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     gene            complement(346821..347729)
                     /locus_tag="NGR_b03460"
                     /db_xref="GeneID:7789882"
     CDS             complement(346821..347729)
                     /locus_tag="NGR_b03460"
                     /note="S-methylmethionine-dependent; MHT"
                     /codon_start=1
                     /transl_table=11
                     /product="MHT1, Homocysteine/selenocysteine methylase"
                     /protein_id="YP_002822563.1"
                     /db_xref="GI:227818592"
                     /db_xref="GeneID:7789882"
                     /translation="MNQIRILDGGMSRELSRLGAELRQPEWSALALMENPEIVGQVHR
                     EFIEAGADVITTNSYALVPFHIGEERFRSEGPSLTELAGKLAREAADGSADRKVLVAG
                     SLPPIFGSYEPERFDPSRVQDYLKVLVEGLAPYVDVWLGETLSLIAEGDAVRAAVAAT
                     GKPFWVSFTLADDAEALASDMPKLRSGESVAAAADWAAGSGAEALLFNCSRPEVMAGA
                     VAAAAATFRQRQANIGIGVYANAFEAEETDGAANETLHHTRADLTADRYSRFACDWVE
                     AGASIVGGCCGIGARHIHNLAYSLKG"
     misc_feature    complement(346827..347729)
                     /locus_tag="NGR_b03460"
                     /note="Homocysteine/selenocysteine methylase
                     (S-methylmethionine-dependent) [Amino acid transport and
                     metabolism]; Region: MHT1; COG2040"
                     /db_xref="CDD:224951"
     gene            complement(347844..349121)
                     /gene="metB"
                     /locus_tag="NGR_b03470"
                     /db_xref="GeneID:7789883"
     CDS             complement(347844..349121)
                     /gene="metB"
                     /locus_tag="NGR_b03470"
                     /EC_number="2.5.1.48"
                     /note="CGS; O-succinylhomoserine (Thiol)-lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="cystathionine gamma-synthase"
                     /protein_id="YP_002822564.1"
                     /db_xref="GI:227818593"
                     /db_xref="GeneID:7789883"
                     /translation="MPSKLAGPLAKAESRSPTMARPHTAGHPSLAWETLALDGGLTID
                     PATKAIAPNISMSVNNLLVPGDGAFSADGVEDLTALPFLYARWTNPTVRQLELRMAAL
                     EGADDALATATGVAAIAATFLTCLKRGDHLIISDVCYAGANELARRMLPDYGIEVTAV
                     NMSRLDEVAAAFRPNTRLVHCESPCNPILRLTDLSAVAALAHRHGALVSVDSTLATPV
                     ATRPLALGVDLVIHSLTKFINGHGDALGGIVCGRKELVEKIRSRAGVYLGASLSAQNA
                     WLIMRGIDTLFPRLKAMSDSAMRIAHFLRDHPGVRSVTYPGLETHPQHALARRQMRIF
                     GGIVTFQTDDPQKIALRLAERLRVVHYAFSLGHQRSIVVLLDTKEMMNSTYGLEGPQL
                     DDYRAFAGDGVFRLSVGLESVDDIIADLDRALR"
     misc_feature    complement(347847..348881)
                     /gene="metB"
                     /locus_tag="NGR_b03470"
                     /note="CGS_like: Cystathionine gamma-synthase is a PLP
                     dependent enzyme and catalyzes the committed step of
                     methionine biosynthesis. This pathway is unique to
                     microorganisms and plants, rendering the enzyme an
                     attractive target for the development of...; Region:
                     CGS_like; cd00614"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(348060..348062,348297..348302,
                     348306..348308,348339..348341,348387..348389,
                     348393..348395,348417..348419,348681..348683,
                     348690..348692,348705..348707,348774..348779,
                     348783..348788,348864..348866,348870..348872))
                     /gene="metB"
                     /locus_tag="NGR_b03470"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(348387..348389,348414..348419,
                     348423..348425,348489..348491,348576..348578,
                     348705..348707,348777..348785))
                     /gene="metB"
                     /locus_tag="NGR_b03470"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(order(348414..348419,348423..348425,
                     348480..348482,348489..348491,348705..348707,
                     348777..348785))
                     /gene="metB"
                     /locus_tag="NGR_b03470"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99738"
     misc_feature    complement(348414..348416)
                     /gene="metB"
                     /locus_tag="NGR_b03470"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99738"
     gene            complement(349263..349952)
                     /locus_tag="NGR_b03480"
                     /db_xref="GeneID:7789884"
     CDS             complement(349263..349952)
                     /locus_tag="NGR_b03480"
                     /codon_start=1
                     /transl_table=11
                     /product="ArtM, ABC-type arginine/histidine transport
                     system, permease component ArtM"
                     /protein_id="YP_002822565.1"
                     /db_xref="GI:227818594"
                     /db_xref="GeneID:7789884"
                     /translation="MDFSWIFSYWPLLAAGAVQTVLLLVISVGCGFILAIGLALAQVV
                     GPRWLKLFARGYCTCLRGTPLLIQLWLLYYGVGSLLPMIPGLRASFLWPILREGFFFA
                     AVSFTLNYAAYEAEVLRGALLAVPKGELEAGRSFGMSSSTLFRRIWLPRAIRIALPTI
                     AGEVVLQLKATPLAFTVTVMDLYAVAYKVRQDTLLVYEPLMVVTVFYVCLTLIITRAF
                     KIVEAQVPVRR"
     misc_feature    complement(349266..349952)
                     /locus_tag="NGR_b03480"
                     /note="ABC-type arginine/histidine transport system,
                     permease component [Amino acid transport and metabolism];
                     Region: ArtM; COG4160"
                     /db_xref="CDD:226634"
     misc_feature    complement(349308..349895)
                     /locus_tag="NGR_b03480"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(349308..349310,349317..349322,
                     349329..349334,349338..349343,349350..349355,
                     349383..349388,349425..349430,349437..349448,
                     349467..349469,349476..349481,349521..349523,
                     349572..349574,349581..349586,349596..349598,
                     349602..349607,349614..349616,349620..349622,
                     349626..349631,349734..349736,349740..349745,
                     349752..349781,349785..349796,349824..349826,
                     349839..349844,349851..349856))
                     /locus_tag="NGR_b03480"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(349431..349448,349734..349778))
                     /locus_tag="NGR_b03480"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(349353..349355,349383..349385,
                     349392..349394,349428..349430,349644..349646,
                     349734..349736))
                     /locus_tag="NGR_b03480"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(349500..349502,349512..349517,
                     349533..349571))
                     /locus_tag="NGR_b03480"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(349962..350684)
                     /locus_tag="NGR_b03490"
                     /db_xref="GeneID:7789885"
     CDS             complement(349962..350684)
                     /locus_tag="NGR_b03490"
                     /codon_start=1
                     /transl_table=11
                     /product="ArtQ, ABC-type arginine transport system,
                     permease component ArtQ"
                     /protein_id="YP_002822566.1"
                     /db_xref="GI:227818595"
                     /db_xref="GeneID:7789885"
                     /translation="MSSSQSLLELLSPYPPGWGGVLLAGALSTVLISLGAYLVGIAIG
                     LAGAIGKLKGNRPVRFVLDLYTTAIRAIPELILIIGLYYAGTDGLNRILAVLGLPAVE
                     INGFVAAVAVLGIVQGAYMTEVFRGAILAIPVGQIEAAAAFGMRPSLRFRRIVLPALM
                     PNALPGLANLWMCVTKDSALIAVVGYQELALATRIAAGNTKHYFLFFLASAALYLAIT
                     LISNVVFSALETRFRRGQPKTA"
     misc_feature    complement(349974..350648)
                     /locus_tag="NGR_b03490"
                     /note="ABC-type arginine transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     ArtQ; COG4215"
                     /db_xref="CDD:226670"
     misc_feature    complement(350016..350600)
                     /locus_tag="NGR_b03490"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(350016..350021,350028..350033,
                     350040..350045,350049..350054,350061..350066,
                     350094..350099,350136..350141,350148..350159,
                     350178..350180,350187..350192,350232..350234,
                     350283..350285,350292..350297,350307..350309,
                     350313..350318,350325..350327,350331..350333,
                     350337..350342,350439..350441,350445..350450,
                     350457..350486,350490..350501,350529..350531,
                     350544..350549,350556..350561))
                     /locus_tag="NGR_b03490"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(350142..350159,350439..350483))
                     /locus_tag="NGR_b03490"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(350064..350066,350094..350096,
                     350103..350105,350139..350141,350355..350357,
                     350439..350441))
                     /locus_tag="NGR_b03490"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(350211..350213,350223..350228,
                     350244..350282))
                     /locus_tag="NGR_b03490"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(350761..351528)
                     /locus_tag="NGR_b03500"
                     /db_xref="GeneID:7789886"
     CDS             complement(350761..351528)
                     /locus_tag="NGR_b03500"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_002822567.1"
                     /db_xref="GI:227818596"
                     /db_xref="GeneID:7789886"
                     /translation="MKLMSILMAGVALSLASAASAEVRFGVMNEAYPPFFTKDPSGKW
                     VGWEIELMDAVCAEMKETCSIVDMSWDGLIPGLEAKKFDVIWSSMSITDERKKTIDFT
                     DKYYNTPSKLIGAKDGKAGAAPDDVADKTIGIQVSTIQSEYYKKYFADKASEQSYATL
                     DEAFQDLAAGRIDYVFGDAIPLAEFLKSDFGKDCCEDKGNVKDDPAILGTGIGGGLRK
                     DDAALRDKLNAAIAAVRASGKYAEISKKYFDFDPYGE"
     misc_feature    complement(350785..351462)
                     /locus_tag="NGR_b03500"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(350785..351462)
                     /locus_tag="NGR_b03500"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(order(350995..350997,351112..351114,
                     351244..351246,351319..351321,351433..351435))
                     /locus_tag="NGR_b03500"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(351016..351018,351034..351036,
                     351046..351048))
                     /locus_tag="NGR_b03500"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(350890..350907)
                     /locus_tag="NGR_b03500"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(351568..352344)
                     /locus_tag="NGR_b03510"
                     /db_xref="GeneID:7789887"
     CDS             complement(351568..352344)
                     /locus_tag="NGR_b03510"
                     /codon_start=1
                     /transl_table=11
                     /product="HisP, ABC-type histidine transport system,
                     ATPase component HisP"
                     /protein_id="YP_002822568.1"
                     /db_xref="GI:227818597"
                     /db_xref="GeneID:7789887"
                     /translation="MTRTAAALQVEDVHKRFGHHHVLKGVSLSAKKGDVISLIGSSGS
                     GKSTFLRCINFLEIADRGRFVINGEEIRMKPGREGRAHPANWRQIERIRTGLAMVFQS
                     FNLWAHMTVLENVTEAPIHVLGTSRKEATEQAEALLSKVGLYDKRHAYPAFLSGGQQQ
                     RASIARALCVDPGVMLFDEPTSALDPELVGEVLKVIRELAEEGRTMLIVTHEMKFARD
                     VSSRVMFLDQGRVEEEGPPAQVFGAPLSARCRAFTGSLSH"
     misc_feature    complement(351577..352335)
                     /locus_tag="NGR_b03510"
                     /note="ABC-type histidine transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     HisP; COG4598"
                     /db_xref="CDD:226961"
     misc_feature    complement(351652..352323)
                     /locus_tag="NGR_b03510"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(352204..352227)
                     /locus_tag="NGR_b03510"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(351712..351714,351808..351813,
                     352042..352044,352201..352209,352213..352218))
                     /locus_tag="NGR_b03510"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(352042..352053)
                     /locus_tag="NGR_b03510"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(351856..351885)
                     /locus_tag="NGR_b03510"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(351808..351825)
                     /locus_tag="NGR_b03510"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(351790..351801)
                     /locus_tag="NGR_b03510"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(351706..351726)
                     /locus_tag="NGR_b03510"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            352955..353386
                     /locus_tag="NGR_b03520"
                     /db_xref="GeneID:7789888"
     CDS             352955..353386
                     /locus_tag="NGR_b03520"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822569.1"
                     /db_xref="GI:227818598"
                     /db_xref="GeneID:7789888"
                     /translation="MEFCLLSPAQLIPTEEVNLDRVDALQTQILQAGSWTAPITVEKD
                     ELFVMDGHHRLTVAHRLRLAMVPVVLLDYDSVRVESWRPDENITPSEIFAMARSGRKF
                     PYKTTRHIFAQGLPRCDVPLELLSSPSPMDVAPVHSAGALS"
     misc_feature    352967..>353176
                     /locus_tag="NGR_b03520"
                     /note="Stage 0 sporulation protein J (antagonist of Soj)
                     containing ParB-like nuclease domain [Transcription];
                     Region: Spo0J; COG1475"
                     /db_xref="CDD:224392"
     misc_feature    352970..353215
                     /locus_tag="NGR_b03520"
                     /note="ParB-like nuclease domain; Region: ParBc;
                     pfam02195"
                     /db_xref="CDD:251149"
     gene            353383..354756
                     /locus_tag="NGR_b03530"
                     /db_xref="GeneID:7789889"
     CDS             353383..354756
                     /locus_tag="NGR_b03530"
                     /codon_start=1
                     /transl_table=11
                     /product="LysA, diaminopimelate decarboxylase LysA"
                     /protein_id="YP_002822570.1"
                     /db_xref="GI:227818599"
                     /db_xref="GeneID:7789889"
                     /translation="MTLHGHKIGFGLPPILRSATADLLTRHGPLLLDWVTCYGSPLNL
                     VWPDALQKNLAALKGVLTERRVGHAVYYGVKVNKSLGLMRAALSAGAGLDVSSLCELR
                     DARRLGAEGVRLVATGPAKTSAFHKELIDCSALISVDSPEELEDLIDGLPADAGPQPI
                     LLRLRPRDQSKSRFGMPGDAVVHCLARLTAENRLRFDGLHFHLSGYRWETRVAALSEA
                     ADLITKARRMGFSPRMIDIGGGLPIQYVDQVKYRAHLAAQAPEDYRTGKIPDSFYPYG
                     GTLSPADWLHRLLEAEMSQGQSVAGYLAREGLTLAMEPGRALTDQAAITVFRISRVKA
                     LGPDSHVIFVEGSSFSACETWFASEFLVDPILVPVTRPAAQSPPIRAYLAGHSCLDED
                     VISNRWLTFPIAPQAGDLLVYANTGGYQMDLLENEFHRHPMPARLCVIDDAEGRATLV
                     PDTIGEV"
     misc_feature    353452..354699
                     /locus_tag="NGR_b03530"
                     /note="Diaminopimelate decarboxylase [Amino acid transport
                     and metabolism]; Region: LysA; COG0019"
                     /db_xref="CDD:223098"
     misc_feature    353473..354699
                     /locus_tag="NGR_b03530"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzyme Y4yA; Region: PLPDE_III_Y4yA_like; cd06842"
                     /db_xref="CDD:143509"
     misc_feature    order(353500..353502,353605..353607,353668..353673,
                     353677..353682,353746..353748,353797..353799,
                     353806..353808,353818..353820,353896..353907,
                     354370..354381,354403..354405,354409..354411,
                     354415..354417,354424..354426,354535..354537,
                     354541..354549,354556..354558,354646..354654,
                     354664..354672)
                     /locus_tag="NGR_b03530"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143509"
     misc_feature    order(353599..353601,353605..353607,353662..353664,
                     353731..353733,353869..353871,353986..353988,
                     353995..353997,354097..354102,354319..354330,
                     354544..354549,354637..354639,354649..354651,
                     354664..354666)
                     /locus_tag="NGR_b03530"
                     /note="active site"
                     /db_xref="CDD:143509"
     misc_feature    order(353599..353601,353605..353607,353662..353664,
                     353731..353733,353869..353871,353986..353988,
                     353995..353997,354097..354102,354319..354330,
                     354544..354546,354637..354639)
                     /locus_tag="NGR_b03530"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143509"
     misc_feature    order(353605..353607,354544..354546)
                     /locus_tag="NGR_b03530"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143509"
     misc_feature    order(353995..353997,354328..354330,354544..354549,
                     354637..354639,354649..354651,354664..354666)
                     /locus_tag="NGR_b03530"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143509"
     gene            354757..355767
                     /locus_tag="NGR_b03540"
                     /db_xref="GeneID:7789890"
     CDS             354757..355767
                     /locus_tag="NGR_b03540"
                     /codon_start=1
                     /transl_table=11
                     /product="CysK, Cysteine synthase CysK"
                     /protein_id="YP_002822571.1"
                     /db_xref="GI:227818600"
                     /db_xref="GeneID:7789890"
                     /translation="MLHTTVTQLIGQTPVMSIDVPERDATLVLKIEKNNPGGSMKDRM
                     ARSMVVAALEDGRLAPGGTIVESSSGNTGTGLALAALEFGLRFIAVVDHHAAPDKIRM
                     MRALGAEIRYVEGDFAEDQVAVVERQRLAAQLGAQLPGAMFMNQSDNPANPDGYAGLV
                     DELIAQLPGGIDAFVGCVGTGGSMTGIAQRLKRHNPAVRTIAVEPAGSIVFGKPGHPY
                     YQSGTGTPAGDEVGKVLDYGCIDEGVQVTDVQAFETARYIARRKGLLVGGSTGGAIFK
                     ALEFIVEGKLTGTVVTTVADGGEKYLGTIFDDEWMAKRRLLEPAIAAQLDGWLAGRAR
                     AA"
     misc_feature    354772..355680
                     /locus_tag="NGR_b03540"
                     /note="cysteine synthase; Region: PLN02565"
                     /db_xref="CDD:166206"
     misc_feature    354787..355662
                     /locus_tag="NGR_b03540"
                     /note="CBS_like: This subgroup includes Cystathionine
                     beta-synthase (CBS) and Cysteine synthase. CBS is a unique
                     heme-containing enzyme that catalyzes a pyridoxal
                     5'-phosphate (PLP)-dependent condensation of serine and
                     homocysteine to give cystathionine; Region: CBS_like;
                     cd01561"
                     /db_xref="CDD:107204"
     misc_feature    order(354799..354807,354838..354840,354856..354858,
                     354862..354864,354988..354990,354997..354999,
                     355045..355050,355057..355062,355069..355074,
                     355249..355254,355531..355539,355543..355551,
                     355621..355623,355651..355653,355660..355662)
                     /locus_tag="NGR_b03540"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    order(354877..354879,354967..354969,355288..355305,
                     355420..355422,355561..355563,355639..355644)
                     /locus_tag="NGR_b03540"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107204"
     misc_feature    354877..354879
                     /locus_tag="NGR_b03540"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107204"
     gene            355764..356903
                     /locus_tag="NGR_b03550"
                     /db_xref="GeneID:7789891"
     CDS             355764..356903
                     /locus_tag="NGR_b03550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822572.1"
                     /db_xref="GI:227818601"
                     /db_xref="GeneID:7789891"
                     /translation="MKVTICGAGRTGHLNAVLFKQRPGIEVSVLTSSTEVAEAWADGD
                     GLWYAQTPNDQLLSARPDHVGTDPGMALERADVVVITQPAQARPALLSQMAPHLPRDR
                     SVYVGAIPGFCGFDWLAAGALEGRDNVVVWGMKDVPHTAFDLVPGQRVRMGGGKAELF
                     AALHRRESAESAAALGAMLNRLYDAPVTMLDDYLEITLTPGNPLMHPAVLYALIGPGA
                     PFEDRPFAEPICWWSDCPLAGAELLEALDAENQAIRRASEARLGIDLSSVKPLRQELI
                     EAYGDQIGDDRTMYSLLRTNRAYAGIQAPLVPNPDGPGLVIDRESRTFHEDIAFGQAL
                     LVSIAARLGVAVPTISKTYNWARHYHGQLAGGAPDYVPTGWPEAQ"
     misc_feature    355767..>356099
                     /locus_tag="NGR_b03550"
                     /note="NAD-dependent glycerol-3-phosphate dehydrogenase
                     N-terminus; Region: NAD_Gly3P_dh_N; pfam01210"
                     /db_xref="CDD:250446"
     misc_feature    356322..356846
                     /locus_tag="NGR_b03550"
                     /note="NAD/NADP octopine/nopaline dehydrogenase,
                     alpha-helical domain; Region: Octopine_DH; pfam02317"
                     /db_xref="CDD:251217"
     gene            356900..358789
                     /locus_tag="NGR_b03560"
                     /db_xref="GeneID:7789892"
     CDS             356900..358789
                     /locus_tag="NGR_b03560"
                     /codon_start=1
                     /transl_table=11
                     /product="siderophore biosynthesis protein"
                     /protein_id="YP_002822573.1"
                     /db_xref="GI:227818602"
                     /db_xref="GeneID:7789892"
                     /translation="MMDDRTSFAADPVSGDDLALLSNASRNAINRLVRCLFAERLLDP
                     DALLWARDGRQAWFPLWASRRVLHFTDLRLAPAGTLRNRGQIEVLDAANGRQRIDDPA
                     ALMREVAPSLTFTPAPDGIEHLLRDIDNSMSNDILARRARESWSATLRQQIAVAGARG
                     FLAYLEEALPTHLAAMTLDQWGALEGHPFYPTWKAKPGLAPKDVAALSPEFGARVPLR
                     IAALRSDWAYVEKMPQVGSYLEWFAANFPDLWYEWAEGLKARGKAPEDWLPLPIHGWH
                     LENFVRREFAAEIESGVLDPQGPEIVTLPAMSFRTMLPETEAPRPFIKLPVAIWMTSE
                     QRTLQGKSIHMGPRLSTLISDILSKEDDLRLGLEIFTEELGAILRHPETGDEHPGRFL
                     SVVYRNVDALARQDRMLPVTVAALLTAGPLDGRPLICELIARAGSESEATVTAFFRAY
                     ARTVVRPALAMYLLYGIAFEAHQQNSTVLFDDHGMPQKLLIRDFGDARSFTPLFKELG
                     YDLKPFSRKGILPTTFDDDISPVRSFVIDACFVCHLHEIALCLTGEYSLTGDSLWRIL
                     REETESAFEALRPRMQSDAFWIEEREAFLERPWPTRSVLRMHLERYRDYRVEHHLPNP
                     LASAQ"
     misc_feature    356957..358777
                     /locus_tag="NGR_b03560"
                     /note="Siderophore synthetase component [Secondary
                     metabolites biosynthesis, transport, and catabolism];
                     Region: RhbC; COG4264"
                     /db_xref="CDD:226715"
     misc_feature    357428..358159
                     /locus_tag="NGR_b03560"
                     /note="IucA / IucC family; Region: IucA_IucC; pfam04183"
                     /db_xref="CDD:252432"
     misc_feature    358232..358750
                     /locus_tag="NGR_b03560"
                     /note="Ferric iron reductase FhuF-like transporter;
                     Region: FhuF; pfam06276"
                     /db_xref="CDD:253652"
     gene            358786..360015
                     /locus_tag="NGR_b03570"
                     /db_xref="GeneID:7789893"
     CDS             358786..360015
                     /locus_tag="NGR_b03570"
                     /codon_start=1
                     /transl_table=11
                     /product="transporter"
                     /protein_id="YP_002822574.1"
                     /db_xref="GI:227818603"
                     /db_xref="GeneID:7789893"
                     /translation="MTGAVAVLRGFGPVFALLFALQFISMGAMEMSGPFWPIQIRALS
                     PSEGVFALAGIGVYVCPMLGVSLTSAFWGRMGDRFGNRLMMVRALAGLAVTQLLVAFA
                     QDVWTILALRFLQGACAGYIAPAQAYGVQVTGGRDRAALFAWLQVATNVGSLGGAFLG
                     GLILDALPFAAVNLTAGVICALCAGVAWASLPVPPQGTGGVGPAKATAASGAVSTGIS
                     VSGLLVLMGLLLTSRMVLQVPFALYMSEVYGAQHWIAGLSYGLLALGFVVGAPVWARI
                     FAWRAPAFVLGWSVLIVAGCLLVTGLAGSTRNIGLFAVLYLAWGALLGGTTPVLLSLV
                     SAATLSDRQGSILGLAQTCQQGASVVGIIAGVVATQRFGLEVAFPLVASLYGLSFLVA
                     LALWLKSRRSFDKGEIS"
     misc_feature    358828..359973
                     /locus_tag="NGR_b03570"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    358837..359868
                     /locus_tag="NGR_b03570"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(358870..358872,358879..358887,358891..358896,
                     358957..358959,358966..358971,358978..358980,
                     358990..358995,358999..359004,359137..359142,
                     359149..359154,359161..359166,359173..359175,
                     359209..359214,359221..359226,359242..359244,
                     359473..359475,359482..359487,359494..359499,
                     359506..359508,359548..359550,359560..359562,
                     359572..359574,359581..359583,359593..359595,
                     359743..359745,359752..359757,359764..359766,
                     359776..359781,359788..359790,359821..359826,
                     359833..359838,359845..359850,359857..359859)
                     /locus_tag="NGR_b03570"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            360012..361178
                     /locus_tag="NGR_b03580"
                     /db_xref="GeneID:7789894"
     CDS             360012..361178
                     /locus_tag="NGR_b03580"
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="YP_002822575.1"
                     /db_xref="GI:227818604"
                     /db_xref="GeneID:7789894"
                     /translation="MRRIRSAFLAVGAMLALWMPAPAFAEEQAATEGQAPITVTDIAG
                     REVTVNAPVKRILLGEGRHLYLIASLDTEDPLSRVVAWRNDLIEADPATYAQYLQAFP
                     KLAKLPASPGQENGLIEIESTIVQKPDVVLLNLEAMRANEDAKYIEKLAELKIPVLYI
                     DFRHYPLKNTEPTIRLLGKIMGREARAEEIIEFRHKAMARVTDVLALAKPERPRVFVE
                     RIGGYADDCCLSFGAENFGKYVELAGGHNIGSDILPTTFGQLNPEQVIAANPEHVVVT
                     SADWEAYVPGGHWIPLGPGADPRVTRQKLEWFTSRSAYTDIAAEKTRNFHGIWHQFYN
                     SPYEFFAVQQLAKWFHPDLFADLDPDATFAEYHRRFLPIPYRPGYAISLADSTE"
     misc_feature    360018..361079
                     /locus_tag="NGR_b03580"
                     /note="ABC-type Fe3+-hydroxamate transport system,
                     periplasmic component [Inorganic ion transport and
                     metabolism]; Region: FepB; COG0614"
                     /db_xref="CDD:223687"
     misc_feature    360120..361148
                     /locus_tag="NGR_b03580"
                     /note="Periplasmic binding protein TroA_f.  These proteins
                     are predicted to function as initial receptors in the ABC
                     metal ion uptake in eubacteria and archaea.  They belong
                     to the TroA superfamily of helical backbone metal receptor
                     proteins that share a...; Region: TroA_f; cd01139"
                     /db_xref="CDD:238559"
     misc_feature    order(360192..360197,360267..360269,360351..360353,
                     360408..360410,360414..360416,360627..360629,
                     360735..360737)
                     /locus_tag="NGR_b03580"
                     /note="putative ligand binding residues [chemical
                     binding]; other site"
                     /db_xref="CDD:238559"
     gene            complement(361479..363620)
                     /locus_tag="NGR_b03590"
                     /db_xref="GeneID:7789895"
     CDS             complement(361479..363620)
                     /locus_tag="NGR_b03590"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB dependent/Ligand-Gated channel TonB"
                     /protein_id="YP_002822576.1"
                     /db_xref="GI:227818605"
                     /db_xref="GeneID:7789895"
                     /translation="MELRVGLLAVLLATVSRVALAQDATALERLEVRASNANATIGTA
                     VEDYAGGQVARGGRVGFLGNRDFMDTPFNITSYTAATIENQNAKTVADVLANDPSVRS
                     THASGGMLDSFYIRGFPLNEGNFGEVAFDGVYGVAPTYRLFTDYIERVEVLKGPTALL
                     YGISPNSSVGGTVNIVPKRASDVDLTRVTTDYASDLYGGGHLDVSRRFGDQRQFGVRF
                     NGSYHGGDTAIDNHSLDVAVGALALDYEGEDFRATLDVVGQRQDIDAPLRPFFPFGSF
                     EIPDAPAGRSNIQEPWEWARTDDLSWLGRVEYDVSDAVTVFAAVGGGNSRVERLFGTP
                     LLLNSAGDVSVTPQNFVFDVDRLTAEAGVRAEFETAAIDHSVTFQVSGLQQSLARGSN
                     SGTAQLTNIFDPLPRPEQDVPQPTHVPRVSENIFHGFALSDTMSMFDERVQLTLGGRW
                     QHIDTENYSPVTGDVSSSSDESALTPLAGIVVKPWENVAFYANYVEGLSVGDTAPTTA
                     VNSGETLAPYRSRQYEVGTKVDLGRVAVTVSAFQIEKPFGVLEARGSDLVFVEGGEQR
                     NRGVELNVFGEVTPEIRVLGGVTFIHGEITKTNDDATRGNTPIGVPSLQVNLGAEWDT
                     PFLTGLTLTGNVIHTDEQFVNTANTQEIPSWTRLDLGARYLTEISERPVTLRANVENV
                     FDLDYWSGVASFGTISQGAPLTVKVSMTTDF"
     misc_feature    complement(361482..363416)
                     /locus_tag="NGR_b03590"
                     /note="TonB-dependent siderophore receptor; Region:
                     TonB-siderophor; TIGR01783"
                     /db_xref="CDD:233575"
     misc_feature    complement(361482..363404)
                     /locus_tag="NGR_b03590"
                     /note="TonB dependent/Ligand-Gated channels are created by
                     a monomeric 22 strand (22,24) anti-parallel beta-barrel.
                     Ligands apparently bind to the large extracellular loops.
                     The N-terminal 150-200 residues form a plug from the
                     periplasmic end of barrel; Region: ligand_gated_channel;
                     cd01347"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(363090..363116,363159..363182,
                     363216..363239,363267..363284,363318..363347,
                     363375..363404))
                     /locus_tag="NGR_b03590"
                     /note="N-terminal plug; other site"
                     /db_xref="CDD:238657"
     misc_feature    complement(order(362565..362567,362640..362642))
                     /locus_tag="NGR_b03590"
                     /note="ligand-binding site [chemical binding]; other site"
                     /db_xref="CDD:238657"
     gene            complement(364023..364784)
                     /locus_tag="NGR_b03600"
                     /db_xref="GeneID:7789896"
     CDS             complement(364023..364784)
                     /locus_tag="NGR_b03600"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase/reductase family
                     oxidoreductase"
                     /protein_id="YP_002822577.1"
                     /db_xref="GI:227818606"
                     /db_xref="GeneID:7789896"
                     /translation="MILKDRIAIVTGAGSGIGQAGAAIMAREGAHVVVVDRSAKAAVE
                     TVTSIAAKGGSAEALAIDVTNDEALAGGIADVAARHGRIDILHNHAGAQVAGDLEQVE
                     VAGFDRSWNLNVRAHFMAARFVMPAMKAAGRGVIVNTSSSSGVLYDREMIAYTTTKHA
                     VIAMTRQMAGDYAKYGVRVNALCPGWVDTPFNEPFINQMGGRSAIDAYIRKKVPLGRW
                     ASVDEIAESILFLVSDRSSYMTGQILVVDGGETVV"
     misc_feature    complement(364032..364784)
                     /locus_tag="NGR_b03600"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06138"
                     /db_xref="CDD:235712"
     misc_feature    complement(364044..364763)
                     /locus_tag="NGR_b03600"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(364215..364220,364224..364235,
                     364311..364313,364323..364325,364362..364370,
                     364449..364451,364512..364520,364596..364604,
                     364671..364679,364734..364745,364749..364751))
                     /locus_tag="NGR_b03600"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(364311..364313,364323..364325,
                     364362..364364,364446..364448))
                     /locus_tag="NGR_b03600"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(364789..365607)
                     /locus_tag="NGR_b03610"
                     /db_xref="GeneID:7789897"
     CDS             complement(364789..365607)
                     /locus_tag="NGR_b03610"
                     /codon_start=1
                     /transl_table=11
                     /product="PotC, ABC-type spermidine/putrescine transport
                     system, permease component II PotC"
                     /protein_id="YP_002822578.1"
                     /db_xref="GI:227818607"
                     /db_xref="GeneID:7789897"
                     /translation="MRALVSSVYLFLYAPIVLVVLFSFNAGRNASEFTGFSTAWYGKA
                     LGNTFLVSALQNSLMIAFTSAALAAVFGTMAALGMERLGIRTRAVFDALFAAAIVVPG
                     VVIGIATLVALVAVFSFVNPALATIWPGDHPPQLGLGYGSIIAAHGLFSMALVAMIVK
                     ARIASLGRDIVEASSDLYATPLTTFRLIVLPQILPSILAGFLLAFTFSFDDFIIAFFV
                     AGSKTTLPIYVFASIRRGVTPEINAIATLVLVASLLLILTARLLMREKKSKSGE"
     misc_feature    complement(364795..365607)
                     /locus_tag="NGR_b03610"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    complement(364858..365448)
                     /locus_tag="NGR_b03610"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(364861..364866,364870..364875,
                     364882..364887,364915..364920,364957..364962,
                     364969..364980,364999..365001,365008..365013,
                     365053..365055,365104..365106,365113..365118,
                     365128..365130,365134..365139,365146..365148,
                     365152..365154,365158..365163,365278..365280,
                     365284..365289,365296..365325,365329..365340,
                     365368..365370,365383..365388,365395..365400))
                     /locus_tag="NGR_b03610"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(364963..364980,365278..365322))
                     /locus_tag="NGR_b03610"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(364885..364887,364915..364917,
                     364924..364926,364960..364962,365176..365178,
                     365278..365280))
                     /locus_tag="NGR_b03610"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(365032..365034,365044..365049,
                     365065..365103))
                     /locus_tag="NGR_b03610"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(365607..366572)
                     /locus_tag="NGR_b03620"
                     /db_xref="GeneID:7789898"
     CDS             complement(365607..366572)
                     /locus_tag="NGR_b03620"
                     /codon_start=1
                     /transl_table=11
                     /product="PotB, ABC-type spermidine/putrescine transport
                     system, permease component I PotB"
                     /protein_id="YP_002822579.1"
                     /db_xref="GI:227818608"
                     /db_xref="GeneID:7789898"
                     /translation="MMGEGTGGCRECPSPCCRRRWGPGSRAFLTDHSMRKAMKTKRNL
                     VTAALVAPAAAWLTVFLVLPFIAMLVFAFGERAPEGGYQAAFTFAQFANLPTRAAAFW
                     NTLLLAPAGALLCLLVAYPVAYYLALKANPRFRLILVSLVVVPFWTSLLVRTYAWMYI
                     LGSRGIPHLLAMIGIEDVRLLNTPGAVLLGIVYGYLPLMIMPIYVSLEKLDRRLLEAS
                     ADLGAKPVSSFFGVTLPLSLPGVMTGVALVTILLLGEYLIPQLLGGGKVFFIGNALVD
                     LFLQSRNWPFGSAIAVTLVAVVVIVLMVAMRIAWKVAGTRQVDLV"
     misc_feature    complement(365739..366272)
                     /locus_tag="NGR_b03620"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(365748..365753,365790..365795,
                     365802..365813,365832..365834,365841..365846,
                     365886..365888,365937..365939,365946..365951,
                     365961..365963,365967..365972,365979..365981,
                     365985..365987,365991..365996,366099..366101,
                     366105..366110,366117..366146,366150..366161,
                     366192..366194,366207..366212,366219..366224))
                     /locus_tag="NGR_b03620"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(365796..365813,366099..366143))
                     /locus_tag="NGR_b03620"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(365748..365750,365757..365759,
                     365793..365795,366009..366011,366099..366101))
                     /locus_tag="NGR_b03620"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(365865..365867,365877..365882,
                     365898..365936))
                     /locus_tag="NGR_b03620"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(366621..367781)
                     /locus_tag="NGR_b03630"
                     /db_xref="GeneID:7789899"
     CDS             complement(366621..367781)
                     /locus_tag="NGR_b03630"
                     /codon_start=1
                     /transl_table=11
                     /product="PotD, Spermidine/putrescine-binding periplasmic
                     protein PotD"
                     /protein_id="YP_002822580.1"
                     /db_xref="GI:227818609"
                     /db_xref="GeneID:7789899"
                     /translation="MTKWYRKNAPITADKLADELMRLKRGSVTRRHFLGVTGLGLATA
                     VLARQPGIFNATAFAEDLGTQMSIATWPNYHDPATFEAFKAATGVAVEVNVFGSNEEM
                     LAKLQAGGTGWDLFVPTNYTISTYVKLGLIDELDMSKLPNYDASTENPRFTNEGIVDG
                     KTYALPKNWGTTGIALNSDKIKKPVTSWKDFFEVAMAEADGRAMVHDYQLTTIGNALV
                     SLGFSFNSIKPDELAKAEEVLIKVKPHLYAINSDYQPAMRATDAWMTMCWTNDGAQLN
                     RDMPEIKFVLGKDGGEIWSDFYAIPKSAANKAAGYALLNYLMAPENAVKEHIANGAPT
                     TDSRVLKLLPAEVTSNKIVYPDEAALTPLEFGAAVTLTDPGRAELMARFKAA"
     misc_feature    complement(366687..367697)
                     /locus_tag="NGR_b03630"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     gene            complement(367833..368912)
                     /locus_tag="NGR_b03640"
                     /db_xref="GeneID:7789900"
     CDS             complement(367833..368912)
                     /locus_tag="NGR_b03640"
                     /codon_start=1
                     /transl_table=11
                     /product="PotA, ABC-type spermidine/putrescine transport
                     system, ATPase component PotA"
                     /protein_id="YP_002822581.1"
                     /db_xref="GI:227818610"
                     /db_xref="GeneID:7789900"
                     /translation="MTSASTNDIEFRSVTKRYGSVTAVSDINLTVPRGAFVALLGPSG
                     CGKTTCLRMIGGFEQPSEGAVYIGGDPMNGVPAYRRPVNMVFQQYALFPHLDVEQNVA
                     YGLKQMRPRIAPVEIARRTQEALELVRLGGYDKRRIHELSGGQQQRVALARAIVNKPK
                     VLLLDEPLAALDKKLRTAMQIELQSLQRELGITFVLVTHDQEEALSMSDLVCVMSTGR
                     IVQIGPPQEIYDRPASLFVADFVGKTNRIAATIEPDASAIRFANGVSLQKPSRANGTV
                     GPALVALRPEAISIVRAGDATLQGIVTHRIFLGSSVEYSVEVDGLGDFLVTADRRSLD
                     ESALAEPGERIGLVFDPNAMHVFPA"
     misc_feature    complement(367836..368903)
                     /locus_tag="NGR_b03640"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    complement(368187..368888)
                     /locus_tag="NGR_b03640"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(368769..368792)
                     /locus_tag="NGR_b03640"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(368316..368318,368415..368420,
                     368652..368654,368766..368774,368778..368783))
                     /locus_tag="NGR_b03640"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(368652..368663)
                     /locus_tag="NGR_b03640"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(368463..368492)
                     /locus_tag="NGR_b03640"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(368415..368432)
                     /locus_tag="NGR_b03640"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(368397..368408)
                     /locus_tag="NGR_b03640"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(368310..368330)
                     /locus_tag="NGR_b03640"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(367842..368072)
                     /locus_tag="NGR_b03640"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            369086..369889
                     /locus_tag="NGR_b03650"
                     /db_xref="GeneID:7789901"
     CDS             369086..369889
                     /locus_tag="NGR_b03650"
                     /codon_start=1
                     /transl_table=11
                     /product="LuxR family transcriptional regulator"
                     /protein_id="YP_002822582.1"
                     /db_xref="GI:227818611"
                     /db_xref="GeneID:7789901"
                     /translation="MGIDLEKLFEILAPLINGTPMNDEAVGSTFRRLMSALMTFDYVV
                     VFAYRGKERPLDLYSTFDAKDHVLFVSLYQAGPYLLDPFYHAACAPKPGVWRMRELAP
                     DRFFSSEYYRTYYVRTGLAEEVGFFVTVSEQVTVVLSLMRREATGVFGPAEFALLKKA
                     EPMVAALVRHHWADLDRRFDAALANMGRSRRKAVHPPADGVWQHLNLTEREAAIIELV
                     LQGHSSESIGLKLGISTGTVKVHRRNVYRKLGISSQTQLLSLYIKNLGQ"
     misc_feature    <369464..369877
                     /locus_tag="NGR_b03650"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    369704..369865
                     /locus_tag="NGR_b03650"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    order(369707..369715,369752..369760,369782..369787,
                     369791..369796,369800..369814,369845..369847)
                     /locus_tag="NGR_b03650"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    order(369740..369742,369746..369748,369752..369754,
                     369845..369853,369860..369862)
                     /locus_tag="NGR_b03650"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            complement(370317..371612)
                     /locus_tag="NGR_b03660"
                     /db_xref="GeneID:7789902"
     CDS             complement(370317..371612)
                     /locus_tag="NGR_b03660"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822583.1"
                     /db_xref="GI:227818612"
                     /db_xref="GeneID:7789902"
                     /translation="MSRENYVTKVEKTSPRLRRRAHCLLKDDAGAVAVVAAIVFPVLV
                     GAMGLGAESGYWYMEQRKLQHAADVSAHAAAIRHRAGDPKPALENTALRIASASGYSP
                     GTMTVSTKPGLSAGSSKITVELTETHPRLFSSIFVGEPVTLSARAVAEVKGGSKACVL
                     ALSGSASGAVTVTGSTQVQLSGCSVVSNSSAADAFLMRNGSAVMSTDCVYTVGEAVTT
                     TGLTMTGCSEPIERVPPTPDPFASVAEPDRLQVQLLPCRTLDHVSNSSYVLDHLLSGV
                     PAIRFCGGLDIKGTITLKPGLYIIDGGDFTVTAGAKLSGEGVTFYFTNSATAKLLGNG
                     DIDLTAPTTGPYAGLLFFGSRRDAGVVHQVTGNSESTLEGNIYIPTGRIEFTGNSTVS
                     GGCTQIVANEITFTGNSAMETCASRTDEIIVGKTVMLVE"
     misc_feature    complement(371166..371372)
                     /locus_tag="NGR_b03660"
                     /note="Putative Tad-like Flp pilus-assembly; Region:
                     Tad_C; pfam09977"
                     /db_xref="CDD:255671"
     gene            371818..372330
                     /gene="cpaA2"
                     /locus_tag="NGR_b03670"
                     /db_xref="GeneID:7789903"
     CDS             371818..372330
                     /gene="cpaA2"
                     /locus_tag="NGR_b03670"
                     /codon_start=1
                     /transl_table=11
                     /product="CpaA2 pilus assembly protein"
                     /protein_id="YP_002822584.1"
                     /db_xref="GI:227818613"
                     /db_xref="GeneID:7789903"
                     /translation="MISTTATWLAFLLFAGTMTYAGIKDVMTMTISNRLVGFLLVAFA
                     VLAPLAGVDLPMIWSSILVASAVLAFTFTFFALGWIGGGDAKLLPVAVLWLGAGLALP
                     FVVCASVLGAVLTLSLMQFRKMPLPVLLQKRAWSSRLHTPQTGIPYGAAMAPAALLLL
                     PESHWFAALL"
     misc_feature    371824..372327
                     /gene="cpaA2"
                     /locus_tag="NGR_b03670"
                     /note="Flp pilus assembly protein, protease CpaA
                     [Posttranslational modification, protein turnover,
                     chaperones / Intracellular trafficking and secretion];
                     Region: CpaA; COG4960"
                     /db_xref="CDD:227295"
     gene            372365..373156
                     /gene="cpaB2"
                     /locus_tag="NGR_b03680"
                     /db_xref="GeneID:7789904"
     CDS             372365..373156
                     /gene="cpaB2"
                     /locus_tag="NGR_b03680"
                     /codon_start=1
                     /transl_table=11
                     /product="CpaB2, Flp pilus assembly protein CpaB"
                     /protein_id="YP_002822585.1"
                     /db_xref="GI:227818614"
                     /db_xref="GeneID:7789904"
                     /translation="MIRLVILLFALASGGAASWLALGFADQPTVEAAEVQQSPSQEVL
                     VAAQELARGTTLEEPHLRWQAWEGEIPPVFISRSARPDAKESLKGLLAQSSFVAGEPI
                     REDKLAQRGAGFLSSMLPSGKRAIAVRVTAESTAGGFILPNDHVDVIHTVARPDSSGK
                     DGKVVSRAVLSNIRVLAVDQTISEGADGTSVVGKTATLEADPGQIDIIAAAEASGTVS
                     LALRAVADNLEAPVVETEGSRPGVVRIVSGGRLSMIEVPSRSGGS"
     misc_feature    372488..372685
                     /gene="cpaB2"
                     /locus_tag="NGR_b03680"
                     /note="SAF domains of the flagella basal body P-ring
                     formation protein FlgA and the flp pilus assembly CpaB;
                     Region: SAF_CpaB_FlgA_like; cd11614"
                     /db_xref="CDD:212159"
     gene            373182..374924
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /db_xref="GeneID:7789905"
     CDS             373182..374924
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /codon_start=1
                     /transl_table=11
                     /product="CpaE2 pilus assembly protein"
                     /protein_id="YP_002822586.1"
                     /db_xref="GI:227818615"
                     /db_xref="GeneID:7789905"
                     /translation="MKQLGKIIQEAPREPVAPLLSIPKVDIAVFCRSEALMGTVRTAA
                     IDRRMARATVTINEGGIEEAAALYGGVTSPNLVVVESGDEEDRLMRALEDLAMECITG
                     TKVIVVGRSNDVGLYKRLLDAGVSDYLVTPLDPMDFVAAVHRCFRDSVDGKLGRIVAF
                     IGAKGGTGSSTLAHNVALAMSKRIASDVLVADLDLQFGTLGLDFDVEAVQGMTDVLSS
                     PDRLDDVLLRRLTVPYTEHLHLLPTTTDLNRFFYLKEEHVDHLLDVARSSSWQIVVDL
                     PHIWMQWTRKILLEADEVVITATPDLASMRNVKNLVDLLKKARPNDPPPRLVLNRTDT
                     PKLAEIKPKDFVAAVGLEESISVPFDPQLFGKAANNGQLVIESAPESKAGQAIVSLAW
                     RVGGTRERRTRKKGLAGLVQRYMQQRKQKAAAGLRNKAQDLKKSEAGASAVEFALFAP
                     VLALGLVAMADVALALHERMTIDHVLRAGAQAAMADPGATQVDKVLQSTLAQSAKPAN
                     VTLAPVKRYCACPENADVKPEAAPQCGTTPCADAVQQLVFYRLEAAKYYQPMSLPEVL
                     PPFQLNSSMQVQVR"
     misc_feature    373347..>373622
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    <373485..373607
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cl19078"
                     /db_xref="CDD:267431"
     misc_feature    373644..374420
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /note="Antiactivator of flagellar biosynthesis FleN, an
                     ATPase [Cell motility]; Region: flhG; COG0455"
                     /db_xref="CDD:223531"
     misc_feature    373650..374174
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /note="This protein family consists of proteins similar to
                     the cpaE protein of the Caulobacter pilus assembly and the
                     orf4 protein of Actinobacillus pilus formation gene
                     cluster. The function of these proteins are unkown. The
                     Caulobacter pilus assembly contains...; Region: CpaE_like;
                     cd03111"
                     /db_xref="CDD:239385"
     misc_feature    374484..374918
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /note="Flp pilus assembly protein TadG [Intracellular
                     trafficking and secretion]; Region: TadG; COG4961"
                     /db_xref="CDD:227296"
     misc_feature    374496..374621
                     /gene="cpaE2"
                     /locus_tag="NGR_b03690"
                     /note="TadE-like protein; Region: TadE; pfam07811"
                     /db_xref="CDD:254446"
     gene            374921..375343
                     /gene="tadE2"
                     /locus_tag="NGR_b03700"
                     /db_xref="GeneID:7789906"
     CDS             374921..375343
                     /gene="tadE2"
                     /locus_tag="NGR_b03700"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus associated TadE family protein"
                     /protein_id="YP_002822587.1"
                     /db_xref="GI:227818616"
                     /db_xref="GeneID:7789906"
                     /translation="MTLSLFLRRAWRSQSGATAVEFALVCFPLLLLVLGVIEFGRAFY
                     VRNDMSYAADVAAREVLIGKIARDAPDSEAQAKLASAVRDSFDSGDPARLEIAVTKQT
                     VDGIDFRVLSIRYPLEFLLPGMTETSFSLALSRRIPIG"
     misc_feature    374927..375340
                     /gene="tadE2"
                     /locus_tag="NGR_b03700"
                     /note="Flp pilus assembly protein TadG [Intracellular
                     trafficking and secretion]; Region: TadG; COG4961"
                     /db_xref="CDD:227296"
     misc_feature    374966..375094
                     /gene="tadE2"
                     /locus_tag="NGR_b03700"
                     /note="TadE-like protein; Region: TadE; pfam07811"
                     /db_xref="CDD:254446"
     gene            complement(375362..375880)
                     /gene="pilQ2"
                     /locus_tag="NGR_b03710"
                     /db_xref="GeneID:7789907"
     CDS             complement(375362..375880)
                     /gene="pilQ2"
                     /locus_tag="NGR_b03710"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus protein PilQ1"
                     /protein_id="YP_002822588.1"
                     /db_xref="GI:227818617"
                     /db_xref="GeneID:7789907"
                     /translation="MRVVPRHVVPGHIGAGWLVPALLACTLFGAAQAAEDRPPTTALE
                     PTRQTEGVVRVIVDFARPLILARPASTLIIGNPTIAQATLSDDKTVILTGKTPGSTNL
                     IVMDAAGAEVANIILDVAAAGGRLITVDGGSGRATYSCTERCDPVQSNDETTAPPPPA
                     SPAPPINEGGEP"
     misc_feature    complement(375521..375733)
                     /gene="pilQ2"
                     /locus_tag="NGR_b03710"
                     /note="Pilus formation protein N terminal region; Region:
                     T2SS-T3SS_pil_N; pfam13629"
                     /db_xref="CDD:257939"
     gene            376149..376310
                     /gene="pilA2"
                     /locus_tag="NGR_b03720"
                     /db_xref="GeneID:7789908"
     CDS             376149..376310
                     /gene="pilA2"
                     /locus_tag="NGR_b03720"
                     /codon_start=1
                     /transl_table=11
                     /product="PilA2 pilus assembly protein"
                     /protein_id="YP_002822589.1"
                     /db_xref="GI:227818618"
                     /db_xref="GeneID:7789908"
                     /translation="MKNLLVRFVRNESGATAIEYGLIAGLIAVVIISAVQLVGTDIGA
                     KFTAISTAL"
     misc_feature    376149..376307
                     /gene="pilA2"
                     /locus_tag="NGR_b03720"
                     /note="Flp pilus assembly protein, pilin Flp
                     [Intracellular trafficking and secretion]; Region: Flp;
                     COG3847"
                     /db_xref="CDD:226366"
     gene            376494..377837
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /db_xref="GeneID:7789909"
     CDS             376494..377837
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /codon_start=1
                     /transl_table=11
                     /product="CpaF protein secretory protein kinase"
                     /protein_id="YP_002822590.1"
                     /db_xref="GI:227818619"
                     /db_xref="GeneID:7789909"
                     /translation="MPREVPKPAVVPAAAKAEKADQYYSFKKEIFSALIATIDVAALS
                     TMDGDEARTEIGAIVNDIVAAKKAGISMAEQNELLRDICNDILGYGPLEPLLARDDIA
                     DIMVNGADQVFIEVGGRVQQTGIRFRDNEQLLNICQRIVSQVGRRVDEASPICDARLA
                     DGSRVNVIAPPLAIDGPSLTIRKFKKEKLNLDQLVRFGSISPEGAEILKIIGRVRCNV
                     LISGGTGSGKTTLLNCLTGYIDDGERIITCEDAAELQLQQPHVVRLETRPPNIEGQGE
                     ITMRSLVKNCLRMRPERIIVGEVRGPEAFDLLQAMNTGHDGSMGTLHANSPREAISRV
                     EAMITMGGHSLPGKAIREMLVSSVDVIVQAARLRDGSRRITHITEVLGMEGDVVTTQD
                     LFVYDILGEDGKGNIIGRHRSTGIGRPAFWDRARYYGEEARLAAALDAAEIKAAA"
     misc_feature    377064..377621
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /note="Type IV secretory pathway component VirB11, and
                     related ATPases. The homohexamer, VirB11 is one of eleven
                     Vir proteins, which are required for T-pilus biogenesis
                     and virulence in the transfer of T-DNA from the Ti
                     (tumor-inducing) plasmid of bacterial to...; Region:
                     VirB11-like_ATPase; cd01130"
                     /db_xref="CDD:238550"
     misc_feature    order(377073..377075,377166..377183,377598..377600)
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238550"
     misc_feature    377142..377624
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    order(377157..377162,377172..377180)
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238550"
     misc_feature    order(377163..377168,377223..377225,377247..377249,
                     377268..377279,377283..377288,377355..377363,
                     377367..377369,377406..377408,377418..377420,
                     377427..377432,377460..377468,377478..377480,
                     377487..377489,377589..377591)
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238550"
     misc_feature    377370..377387
                     /gene="cpaF1"
                     /locus_tag="NGR_b03730"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238550"
     gene            377882..378880
                     /gene="tadB1"
                     /locus_tag="NGR_b03740"
                     /db_xref="GeneID:7789910"
     CDS             377882..378880
                     /gene="tadB1"
                     /locus_tag="NGR_b03740"
                     /codon_start=1
                     /transl_table=11
                     /product="pilus assembly protein TadB"
                     /protein_id="YP_002822591.1"
                     /db_xref="GI:227818620"
                     /db_xref="GeneID:7789910"
                     /translation="MLSASLFPVLIFFLASSFVGGLMLAAFYPRTVKASAYRQRFERV
                     AGHTQINRTGSADESRDRRRSVEKTLRDIEEQQKAHVRKGRKPKLEARLRQAGLGWST
                     RAYWVACAGTGLAIYVLVALLGLGAFAALGFATAGGLYLPHFHVNTTRNRRLKRFTAE
                     FPNAVDVIVRGLKAGLPMTDCLRVIAAEAQEPVKGEFLTIAHDQTLGLPVDEAVERLC
                     ERMPLPEARFFAIVITIQSRTGGSLSEALGNLSKVLRERKKMKAKIKAMSAEAKSSAG
                     IIGALPFFVAGAVYLTSPDYMSLLFTTMTGKMVLVGSALWMGIGTLLMRKMINFDF"
     misc_feature    377900..378877
                     /gene="tadB1"
                     /locus_tag="NGR_b03740"
                     /note="Flp pilus assembly protein TadB [Intracellular
                     trafficking and secretion]; Region: TadB; COG4965"
                     /db_xref="CDD:227300"
     gene            378889..379860
                     /gene="tadC2"
                     /locus_tag="NGR_b03750"
                     /db_xref="GeneID:7789911"
     CDS             378889..379860
                     /gene="tadC2"
                     /locus_tag="NGR_b03750"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus protein TadC"
                     /protein_id="YP_002822592.1"
                     /db_xref="GI:227818621"
                     /db_xref="GeneID:7789911"
                     /translation="MNLGAHIPDPDQLSAMLTGIAAFSAVVAVSWPYVFRNTLAERMR
                     KVESERERIRQRERTRLNAEKSKVALRAEPRRFFQAIVDRFNLAKQAENSDILRQLSM
                     AGYRGYAPVTTFLAFRLIAPIVLFAACLLYILLVLRPQAPLLAVIAMAGAMGSLGYFA
                     PAIFIRNRITKRQQAIRRAWPEALDLLLITVESGMGIESAFRKVGEEIGAQSPEVAEE
                     ILLTTAELSYLQDRRQAFENLGQRTGVEGVRAVVTSLIQAEKYGTPLGQALRVMAQEN
                     RDMRMSEAEKKAAALPPKLTVPMIVFFLPVLFAVIVTPAAIQISGIQ"
     misc_feature    379090..379851
                     /gene="tadC2"
                     /locus_tag="NGR_b03750"
                     /note="Flp pilus assembly protein TadC [Cell motility and
                     secretion / Intracellular trafficking and secretion];
                     Region: TadC; COG2064"
                     /db_xref="CDD:224975"
     gene            complement(380015..381061)
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /db_xref="GeneID:7789912"
     CDS             complement(380015..381061)
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /codon_start=1
                     /transl_table=11
                     /product="CheB, chemotaxis response regulator containing a
                     CheY-like receiver domain and a methylesterase domain
                     CheB"
                     /protein_id="YP_002822593.1"
                     /db_xref="GI:227818622"
                     /db_xref="GeneID:7789912"
                     /translation="MVRILLATSRVDLQELVERAVRSDASAELLGVARSFAEAVTMAR
                     QLSPDIVTMELRLGEHDSVEAVREIMVSAPAPIVMVSRVEELGSVAARALDAGALAVI
                     PAPPPVDGRLEKAATEKFLSTIKAMAHVKVVRQWRKKSGGDGRNDQGDLAAAHAPIGI
                     VGIAASTGGPAAIRSILMNVSSKFPAPILIVQHMSSGFIDRVAASLDATVPLNVKVAT
                     DGERLRAGMVYLAPDGRQLGVSGRSRIRVVNDAPVDGFKPSGSYLFGSIARAFKGEAL
                     AVILTGMGNDGTEGLRALREAGGKAIAQDEESSVVFGMPKSAIGAGLVDFVLPLESIG
                     GKIVALAEGRESGT"
     misc_feature    complement(380018..381061)
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /note="Chemotaxis response regulator containing a
                     CheY-like receiver domain and a methylesterase domain
                     [Cell motility and secretion / Signal transduction
                     mechanisms]; Region: CheB; COG2201"
                     /db_xref="CDD:225111"
     misc_feature    complement(380747..>380971)
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(380747..380752,380759..380761,
                     380819..380821,380876..380878,380900..380902))
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(380900..380902)
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(380876..380884,380888..380893))
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(380747..380752)
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(380042..380584)
                     /gene="cheB1"
                     /locus_tag="NGR_b03760"
                     /note="CheB methylesterase; Region: CheB_methylest;
                     pfam01339"
                     /db_xref="CDD:250544"
     gene            complement(381070..383196)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /db_xref="GeneID:7789913"
     CDS             complement(381070..383196)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /EC_number="2.7.3.-"
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheA"
                     /protein_id="YP_002822594.1"
                     /db_xref="GI:227818623"
                     /db_xref="GeneID:7789913"
                     /translation="MKAEELDRQLLTIFAREVRLRSSDMARILIGIDEAGDAEDKRRL
                     QDELLRMAHSLKGAAGLVEVRGIESICHWMEEVLMRASKEQSALSRLELDVLLRAADA
                     IKEAGRLLAGGEMPSSAKTGSVVRELEATVTPGVAYGNMPPGPPPPSAEHQVPVRSTD
                     LDGSMRVSADRLDALLHRSGELLAFDAVVRTHAERASDLREQAGRLRTVGSFSETDAA
                     GIENGLRELAASLHSNGRLLHSAVTALSHEVRRARTQPFAAACKGLERIVRDMAAHVN
                     KSATLEIRGGEIDIDRSILAGLQDSLRHLVRNAVAHGIQSPEERRLAGKPEKGRIVVS
                     ASVSGDRVQVVVKDDGRGLDMASLRKLADRAPIASEDEGDLLQRVFEPGISTSASVDR
                     LAGRGIGLDIVRRAVEDMRGTAAVAQVPEGGAAFTLTLPLTLATVRALVVHVAGHVLT
                     IDTSCVERVIRVSAENIGFEQERQVVTTEVGTFSLVDLAHWLGLRAAGEPISREARPA
                     IIIRAGGREAAVLVDEIAAEQELLARSLGPRLEKVRRYCGAMVLPDGRIALLLNTSLL
                     CAPAPESFAASIPDAAQFRKPKRRKVLVVDDSKYIRTLVRLILQAAGYDVAMASDGQE
                     ALQHLHHQEVDVVVADVDMPSMNGFELTQAIRRSERLAGLPIILVTGREAPEDKAHGL
                     ELGANAYVAKNQFDAHQFLETVSQVV"
     misc_feature    complement(381499..383190)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="Chemotaxis protein histidine kinase and related
                     kinases [Cell motility and secretion / Signal transduction
                     mechanisms]; Region: CheA; COG0643"
                     /db_xref="CDD:223716"
     misc_feature    complement(382879..383178)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="Histidine Phosphotransfer domain, involved in
                     signalling through a two part component systems in which
                     an autophosphorylating histidine protein kinase serves as
                     a phosphoryl donor to a response regulator protein; the
                     response regulator protein is...; Region: HPT; cd00088"
                     /db_xref="CDD:238041"
     misc_feature    complement(order(382972..382974,382981..382983,
                     383026..383031,383038..383040))
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="putative binding surface; other site"
                     /db_xref="CDD:238041"
     misc_feature    complement(383038..383040)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="active site"
                     /db_xref="CDD:238041"
     misc_feature    complement(381919..382293)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(381919..381921,381925..381930,
                     381943..381945,381949..381951,381997..382008,
                     382138..382143,382147..382149,382153..382155,
                     382159..382161,382264..382266,382273..382275,
                     382285..382287))
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(382273..382275)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(order(382000..382002,382006..382008,
                     382141..382143,382147..382149))
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    complement(381499..381885)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="CheW-like domain; Region: CheW; pfam01584"
                     /db_xref="CDD:250722"
     misc_feature    complement(381076..381420)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(381115..381117,381121..381123,
                     381130..381132,381187..381189,381253..381255,
                     381277..381279,381406..381411))
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(381277..381279)
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(381253..381261,381265..381270))
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(381112..381117,381121..381123))
                     /gene="cheA1"
                     /locus_tag="NGR_b03770"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(383193..384827)
                     /locus_tag="NGR_b03780"
                     /db_xref="GeneID:7789914"
     CDS             complement(383193..384827)
                     /locus_tag="NGR_b03780"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis protein"
                     /protein_id="YP_002822595.1"
                     /db_xref="GI:227818624"
                     /db_xref="GeneID:7789914"
                     /translation="MKLLRTKSLYGMLGLAMLLFAVASALLVGSSFIALERVRADLAA
                     ASSLSKERIFYQMLYRVGRLPGPNDPNRPAAVSELRDLMQRNEQMLARLAGGDEALGF
                     ALEANPEAIAQLEQLRQLWQHQVKPALERTISQAPPSQAVLEELDRHIRTYAARINEK
                     IDGIEQTAATRLYRSQMLQLGLSALAIVLLFLVLRVVRHYAGRVRILVDVAKGVSAGN
                     LDQRAIVTGYDELSVLGASFNGMTAKLAGMIENERAARERLEDLLATISETSQHLSSS
                     AAEILAGTTQQVEGMRDQSTAVAETVTSVDDVLQTSEQAAQRAQQVAASYETAVKVSS
                     EGRTALDNTVTTMNAVNARTGAIAGNILLLAENSLEIGEIVSVVAEIADQTNLLALNA
                     AIEASRAGEHGRGFSVVASEIRTLADQSKTATTRVRRILMEIQKSTNAAVVGAEEGSK
                     SVGRALETVKEAGETIRQLEAIIGDSARSVAQIAASAGQQKAGMKQIHDAMHYIQQAS
                     SQNLSAIRQAEEAAKDLNELGSRLRDMLADHSNGRR"
     misc_feature    complement(384387..384665)
                     /locus_tag="NGR_b03780"
                     /note="Type IV pili methyl-accepting chemotaxis transducer
                     N-term; Region: PilJ; pfam13675"
                     /db_xref="CDD:257980"
     misc_feature    complement(383217..384407)
                     /locus_tag="NGR_b03780"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    complement(384093..384221)
                     /locus_tag="NGR_b03780"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(384093..384098,384105..384110,
                     384114..384119,384126..384131,384135..384140,
                     384186..384188,384192..384197,384204..384209,
                     384213..384218))
                     /locus_tag="NGR_b03780"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(383313..383954)
                     /locus_tag="NGR_b03780"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    complement(order(383316..383321,383328..383330,
                     383337..383342,383349..383351,383358..383363,
                     383367..383372,383379..383384,383388..383393,
                     383400..383402,383409..383414,383421..383423,
                     383430..383435,383442..383447,383451..383456,
                     383463..383465,383472..383477,383484..383486,
                     383493..383498,383535..383540,383547..383552,
                     383556..383561,383568..383573,383580..383582,
                     383589..383594,383601..383603,383610..383612,
                     383622..383624,383643..383645,383652..383654,
                     383664..383666,383673..383678,383685..383687,
                     383694..383696,383703..383708,383715..383720,
                     383727..383729,383736..383741,383745..383747,
                     383757..383762,383766..383771,383778..383780,
                     383787..383792,383799..383804,383811..383813,
                     383820..383825,383832..383834,383841..383846,
                     383892..383897,383904..383906,383913..383918,
                     383925..383930))
                     /locus_tag="NGR_b03780"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(383577..383678)
                     /locus_tag="NGR_b03780"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(384824..385462)
                     /locus_tag="NGR_b03790"
                     /db_xref="GeneID:7789915"
     CDS             complement(384824..385462)
                     /locus_tag="NGR_b03790"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822596.1"
                     /db_xref="GI:227818625"
                     /db_xref="GeneID:7789915"
                     /translation="MIALDRKIRPDWADVKRRIAMALEETEALLGSAAQDAEAAGQQN
                     FPLTRSDVEMGEEPEGSARFVSFVLSGRRLALEVRYVCEIVSMARVTPLPGMPTYVRG
                     IFDLRGQLLPVFDLRSLLHLPDALSPDSDWVIVCGEMQAELLIVAEGMPEISRVFAPD
                     SASFGNEDGPEWASATASQDTIVLDGALLLSDRRFFLESEQPVGEIAGDERP"
     misc_feature    complement(<384995..385324)
                     /locus_tag="NGR_b03790"
                     /note="Chemotaxis signal transduction protein [Cell
                     motility and secretion / Signal transduction mechanisms];
                     Region: CheW; COG0835"
                     /db_xref="CDD:223905"
     gene            complement(385449..386387)
                     /locus_tag="NGR_b03800"
                     /db_xref="GeneID:7789916"
     CDS             complement(385449..386387)
                     /locus_tag="NGR_b03800"
                     /codon_start=1
                     /transl_table=11
                     /product="CheR, methylase of chemotaxis methyl-accepting
                     proteins CheR"
                     /protein_id="YP_002822597.1"
                     /db_xref="GI:227818626"
                     /db_xref="GeneID:7789916"
                     /translation="MRRAPAKARSTRASLPPSRSVKDEDVENMSGAMLLQAGALAGRI
                     ADRIGLSIAASRKEAAVSAIGRVMARRGLNHVSDLLGQIDADEDLKEEFIDELTVGET
                     HFFRGAAQFDLIRDTILPERCRSRLIGSPLRIWSLGCASGEEPYSLAILCEADNLSSR
                     VEITASDISRKALSDAAEAEYGEWSLRNTGECWRQRYFLRSGSRYRVRPDLARRVTLT
                     KVALGADVLPAPQIGLADFDLILCRNVLVYLDAAAVHRIARQLFTCLVKGGWLMTAPT
                     DPPLWKYAPFETSITSAGAVYRRAVSGRERPADDRP"
     misc_feature    complement(385491..386258)
                     /locus_tag="NGR_b03800"
                     /note="Methylase of chemotaxis methyl-accepting proteins
                     [Cell motility and secretion / Signal transduction
                     mechanisms]; Region: CheR; COG1352"
                     /db_xref="CDD:224271"
     misc_feature    complement(385569..385991)
                     /locus_tag="NGR_b03800"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(385659..385661,385710..385718,
                     385884..385889,385959..385979))
                     /locus_tag="NGR_b03800"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(386495..387178)
                     /locus_tag="NGR_b03810"
                     /db_xref="GeneID:7789917"
     CDS             complement(386495..387178)
                     /locus_tag="NGR_b03810"
                     /codon_start=1
                     /transl_table=11
                     /product="CitB, response regulator containing a CheY-like
                     receiver domain and an HTH DNA-binding domain CitB"
                     /protein_id="YP_002822598.1"
                     /db_xref="GI:227818627"
                     /db_xref="GeneID:7789917"
                     /translation="MNAFGVALVADDDEFFRIALAAILKTKLGFSDVVETGSLDEAIE
                     RLADRDDVSLALFDLTMPGMESAASLGAVREVHPDVKVAVVSASSRRNDILASLAAGI
                     HGYVPKSLGASDLAAALRVILNGAIYVPPSLAGCTPRSAESEPPPAATGHSDEPSRRT
                     IDFLTPRQREVLLLLVEGLSNKEIARKLRLGEGTVKIHMAALFRSLRVRNRQEAAAAG
                     ARLLPIAQR"
     misc_feature    complement(386516..387157)
                     /locus_tag="NGR_b03810"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    complement(386810..387157)
                     /locus_tag="NGR_b03810"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(386852..386857,386864..386866,
                     386921..386923,386981..386983,387005..387007,
                     387143..387148))
                     /locus_tag="NGR_b03810"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(387005..387007)
                     /locus_tag="NGR_b03810"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(386981..386989,386993..386998))
                     /locus_tag="NGR_b03810"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(386849..386857)
                     /locus_tag="NGR_b03810"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    complement(386519..386689)
                     /locus_tag="NGR_b03810"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cd06170"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(386546..386548,386579..386593,
                     386597..386602,386606..386611,386633..386641,
                     386678..386686))
                     /locus_tag="NGR_b03810"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     misc_feature    complement(order(386519..386524,386531..386533,
                     386540..386548,386639..386641,386645..386647,
                     386651..386653))
                     /locus_tag="NGR_b03810"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99777"
     gene            387181..387348
                     /locus_tag="NGR_b03820"
                     /db_xref="GeneID:7789918"
     CDS             387181..387348
                     /locus_tag="NGR_b03820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822599.1"
                     /db_xref="GI:227818628"
                     /db_xref="GeneID:7789918"
                     /translation="MLPQVQVDRISASMEKVGPPMKVTNVLQLTIVPAARFPLSACTV
                     NFFREFLSQLF"
     gene            complement(387737..388198)
                     /locus_tag="NGR_b03830"
                     /db_xref="GeneID:7789919"
     CDS             complement(387737..388198)
                     /locus_tag="NGR_b03830"
                     /codon_start=1
                     /transl_table=11
                     /product="fic family protein"
                     /protein_id="YP_002822600.1"
                     /db_xref="GI:227818629"
                     /db_xref="GeneID:7789919"
                     /translation="MLRQLLLNLSLYFKSRRPDYYRLLQEVREYGTWEAWLEFFLDGV
                     AETADQTFETASRIARLLDDDRGRIVRESERTGSVLQIHDIMRTSPYLTAASAAKRSA
                     LTVPTVNAALDQLQRLGIVEEATGRRRGRVFVYRAYMDILSDGAGTDAARS"
     misc_feature    complement(387794..>388165)
                     /locus_tag="NGR_b03830"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     gene            complement(388255..388647)
                     /locus_tag="NGR_b03840"
                     /db_xref="GeneID:7789920"
     CDS             complement(388255..388647)
                     /locus_tag="NGR_b03840"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822601.1"
                     /db_xref="GI:227818630"
                     /db_xref="GeneID:7789920"
                     /translation="MPLSISCFTGDSSSSRAWLSALLVLRPWTKRFGGHQAARDAGSL
                     IRLYLTGLLLNISNPRMPISYLALLPGVLGTRPLTVYHTAELLVIIAPIEVIVVGGHT
                     LIGYGAETVLADQRPASSTSSLKPFIPS"
     gene            complement(388675..389262)
                     /locus_tag="NGR_b03850"
                     /db_xref="GeneID:7789921"
     CDS             complement(388675..389262)
                     /locus_tag="NGR_b03850"
                     /codon_start=1
                     /transl_table=11
                     /product="[NiFe]-hydrogenase/urease accessory protein"
                     /protein_id="YP_002822602.1"
                     /db_xref="GI:227818631"
                     /db_xref="GeneID:7789921"
                     /translation="MNFKTLTALAIITASLPGQALAHSGNDHVHGVASGLLHPFSGVD
                     HLLAMIAVGLIAGRLGGSALFRLPLAFVSAMVAGAAYVLTGVTVPLVEAAVITSVILL
                     GAALIANANIPATLAITGAATFGFFHGFAHGTEGPAAAPLGHILGFIGGTVILHITGM
                     TVWHALARRGTGPMPAHRIIGTGIIGAGIGLAFIA"
     misc_feature    complement(388753..389232)
                     /locus_tag="NGR_b03850"
                     /note="HupE / UreJ protein; Region: HupE_UreJ; pfam04955"
                     /db_xref="CDD:252902"
     gene            complement(389288..389821)
                     /locus_tag="NGR_b03860"
                     /db_xref="GeneID:7789922"
     CDS             complement(389288..389821)
                     /locus_tag="NGR_b03860"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822603.1"
                     /db_xref="GI:227818632"
                     /db_xref="GeneID:7789922"
                     /translation="MHGGHHHHHGAHSHHRDHDHDHDHHGHQHAGPGHNRQRGTVQWQ
                     VPHRPTRKDLSPPHERDLDLVEASFVENFARASDATSFLRLAGIPFVGIDASGKALHL
                     LRVEIADRTDIGAVVPLLGGNGVRYDVLPARMTSRRHDLSFLYHDGEAVVRLSFAEAR
                     KLEDRTDASHFDIEPTE"
     gene            complement(389832..391037)
                     /locus_tag="NGR_b03870"
                     /db_xref="GeneID:7789923"
     CDS             complement(389832..391037)
                     /locus_tag="NGR_b03870"
                     /codon_start=1
                     /transl_table=11
                     /product="SpeB, Arginase/agmatinase/formimionoglutamate
                     hydrolase, arginase family"
                     /protein_id="YP_002822604.1"
                     /db_xref="GI:227818633"
                     /db_xref="GeneID:7789923"
                     /translation="MREPPSRQARRAGAMHAPVRERRHHPDFNMLDSQGWKALEAEAK
                     LSGKGWGREKQWALEMGLPGSESLTDKSIPTFARGELPHFAGINTFLKAPYVENVRDV
                     GKYDAAVLGIPFDSGTTYRPGTRFGPQGIRRISALYTPYNYEMGVDLREQMTLCDAGD
                     VFTIPANLEKSFDQITRGVSHVFSSGALPIMLGGDHSIGFPCVRGIAECTSKRIGIIH
                     FDRHIDIQQKDLDERMHTTPWYWATNLPNVSPKNLVQLGIGGWQVPRDGVKVARERGT
                     NVLTIDDIEKLGPEKTAEIALELAWKDADAVYISFDVDSIDCGFVPGTGWPEPGGFLP
                     REALKILGLVAAEGLCGLEVVEVSPPYDTSDITALFGVRVVVEALGSMLAHGKLGSHK
                     HLIDKPVSF"
     misc_feature    complement(390855..>390947)
                     /locus_tag="NGR_b03870"
                     /note="Peptidase; Region: DUF3663; pfam12404"
                     /db_xref="CDD:152839"
     misc_feature    complement(389901..390719)
                     /locus_tag="NGR_b03870"
                     /note="Agmatinase-like family; Region: Agmatinase-like;
                     cd09990"
                     /db_xref="CDD:212516"
     misc_feature    complement(order(389970..389972,390096..390098,
                     390102..390104,390330..390335,390366..390374,
                     390378..390380,390450..390452))
                     /locus_tag="NGR_b03870"
                     /note="active site"
                     /db_xref="CDD:212516"
     misc_feature    complement(order(389970..389972,390096..390098,
                     390102..390104,390330..390335,390366..390374,
                     390378..390380,390450..390452))
                     /locus_tag="NGR_b03870"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212516"
     misc_feature    complement(order(390096..390098,390102..390104,
                     390366..390368,390372..390374,390378..390380,
                     390450..390452))
                     /locus_tag="NGR_b03870"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:212516"
     gene            complement(391030..391836)
                     /locus_tag="NGR_b03880"
                     /db_xref="GeneID:7789924"
     CDS             complement(391030..391836)
                     /locus_tag="NGR_b03880"
                     /codon_start=1
                     /transl_table=11
                     /product="TauB, ABC-type nitrate/sulfonate/bicarbonate
                     transport system, ATPase component TauB"
                     /protein_id="YP_002822605.1"
                     /db_xref="GI:227818634"
                     /db_xref="GeneID:7789924"
                     /translation="MSEIRVHNVWMEYGDQIVLEGVSLDIAPGAFVSVVGPSGCGKST
                     FLRMILGQERPTRGIITLDGAGLPGEPGSDRGVVFQRYSVFPHLNVLQNVLIAYEFAE
                     SPFLAKLFGAKRKAASEKAEALLQAVGLSEHAWKYPSALSGGQQQRLAIAQALAKEPK
                     VLLLDEPFGALDPGTRAQMHALIKPLWRERGMTVIMVTHDLKEAFGLGTRLLAFDKPR
                     IDPQAPERYGARIIYDLDLSRDGPVPILGFSRPIEPNTMSQETKRSMPHA"
     misc_feature    complement(391144..391836)
                     /locus_tag="NGR_b03880"
                     /note="ABC-type phosphate/phosphonate transport system,
                     ATPase component [Inorganic ion transport and metabolism];
                     Region: COG3638"
                     /db_xref="CDD:226164"
     misc_feature    complement(391132..391827)
                     /locus_tag="NGR_b03880"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(391708..391731)
                     /locus_tag="NGR_b03880"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(391240..391242,391339..391344,
                     391597..391599,391705..391713,391717..391722))
                     /locus_tag="NGR_b03880"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(391597..391608)
                     /locus_tag="NGR_b03880"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(391387..391416)
                     /locus_tag="NGR_b03880"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(391339..391356)
                     /locus_tag="NGR_b03880"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(391321..391332)
                     /locus_tag="NGR_b03880"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(391234..391254)
                     /locus_tag="NGR_b03880"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(391833..392657)
                     /locus_tag="NGR_b03890"
                     /db_xref="GeneID:7789925"
     CDS             complement(391833..392657)
                     /locus_tag="NGR_b03890"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822606.1"
                     /db_xref="GI:227818635"
                     /db_xref="GeneID:7789925"
                     /translation="MRRAINIVPGSGTRILLALLPFLLIACLYVVVSAERRAANPGDK
                     LLPPIAEMATSMDRLATEPDRRSGDLTLWSDTTASLQRLFIGLGAAAAIGLVLGLTLG
                     LLPVASAGLSPLVAVISMVPPMAILPVLFIILGLGELSKVVLIVIGIAPFLVRDLAMT
                     VAAIPSEQIVKAQTLGASTWQVMLRVALPQAMPRLIEAMRLSLGPAFLFLISAEAIAA
                     ESGLGYRIFLVRRYLAMDVILPYVAWITLIAYVLDWLLARIARRGFPWAYAQEARR"
     misc_feature    complement(391899..392327)
                     /locus_tag="NGR_b03890"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(391905..391910,391917..391922,
                     391926..391931,391938..391943,391971..391976,
                     392013..392018,392025..392036,392055..392057,
                     392064..392069,392109..392111,392160..392162,
                     392169..392174,392184..392186,392190..392195,
                     392202..392204,392208..392210,392214..392219,
                     392265..392267,392271..392276,392283..392312,
                     392316..392327))
                     /locus_tag="NGR_b03890"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(392019..392036,392265..392309))
                     /locus_tag="NGR_b03890"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(391941..391943,391971..391973,
                     391980..391982,392016..392018,392232..392234,
                     392265..392267))
                     /locus_tag="NGR_b03890"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(392088..392090,392100..392105,
                     392121..392159))
                     /locus_tag="NGR_b03890"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(392738..393820)
                     /locus_tag="NGR_b03900"
                     /db_xref="GeneID:7789926"
     CDS             complement(392738..393820)
                     /locus_tag="NGR_b03900"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_002822607.1"
                     /db_xref="GI:227818636"
                     /db_xref="GeneID:7789926"
                     /translation="MRFGNGRFGFRALSVALGLSLTLLASGTRAEPKKEFNIAWTIYV
                     GWMPWPYAADAGIVKKWADKYGITINVKQVNDYIESINQYTAGSFDGVTATNMDGLTI
                     PAAGGVDTTILIVGDFSNGNDGIVSKTAKTPAHLKGESINLVELSVSHYLLARALETA
                     GLSERDVTIVNTSDADMVAAFKSPETSTVVTWNPLLAEVKAEPGSAALFDSTQIPGEI
                     IDTMMVNTEVLKDNPNFGKALAGIWYEIMSVLTDPGEKGKTARTAMGTMSGTDLAGFE
                     AQLAATKLFATPQEAVSFTESEDLVRTMELVRTFSFDHGLLGDGAADKDVVGIAFPGG
                     QVLGSADNVKLRFDASYMKLAADGSL"
     misc_feature    complement(<393086..393805)
                     /locus_tag="NGR_b03900"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(392741..393724)
                     /locus_tag="NGR_b03900"
                     /note="ABC transporter periplasmic binding protein, urea
                     carboxylase region; Region: ABC_peri_uca; TIGR03427"
                     /db_xref="CDD:213811"
     misc_feature    393914..394021
                     /note="NGR_b03910; cis acting element, ykkC-yxkD, RF00442"
     gene            complement(394280..396085)
                     /locus_tag="NGR_b03920"
                     /db_xref="GeneID:7789927"
     CDS             complement(394280..396085)
                     /locus_tag="NGR_b03920"
                     /note="catalyzes the hydrolysis of allophanate"
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase"
                     /protein_id="YP_002822608.1"
                     /db_xref="GI:227818637"
                     /db_xref="GeneID:7789927"
                     /translation="MKDGQAFDIASLHAAYRSGWSVAETIKTVFERIAAVDDLGIFLH
                     LADRSELLDEAAALGAFDPVAKPLWGIPFAVKDNIDVAGMPTTAACPDYAYLAERDAT
                     VVRLLREAGALVVGKTNLDQFATGLVGVRTPYPAPRNAIDPALVPGGSSSGSAVATAH
                     GIVSFALGTDTAGSGRIPAGLNNIVGLKPSIGALSTTGVVPACRTLDCVSIFALAVAD
                     AYQIFQVAARPDATDSYSRDIAPRGGLSLPPVLKVGVPATADRRFFGDVLMESAYADA
                     LQMLRSLGHQIVELPFADFYATAALLYEGAWVSERYAAVKDFFDANETSFHPVTREIY
                     GGAKALSAADAFEGFYALQALKRKVAPLIASVDMICVPTAPTHFTRMEVEAEPIRENA
                     RLGIYTNFVNLLDMCGMAVPTGHRSDGRPASVTLLAPAGKDHLTASLAAELHRLSALP
                     LGATGWPQPANYLPAATDEGQMIELVVVGAHLSGMPLNAQLRDLGARFSRRALTAKCY
                     RLYALSSTEPAKPGLVRCQESEGASIEVEVWKLGAEAFGLFVAAVPSPLAIGTVQLAD
                     GTACKGFLVEPAGLAGAADISRYGGWRAYIASLAA"
     misc_feature    complement(394283..396085)
                     /locus_tag="NGR_b03920"
                     /note="allophanate hydrolase; Provisional; Region:
                     PRK08186"
                     /db_xref="CDD:236177"
     gene            complement(396090..396437)
                     /locus_tag="NGR_b03930"
                     /db_xref="GeneID:7789928"
     CDS             complement(396090..396437)
                     /locus_tag="NGR_b03930"
                     /codon_start=1
                     /transl_table=11
                     /product="allophanate hydrolase"
                     /protein_id="YP_002822609.1"
                     /db_xref="GI:227818638"
                     /db_xref="GeneID:7789928"
                     /translation="MPETTRESLTQGSWRDLEFEPFRDGVMIHWIRHFDGGQPGVALL
                     RYEAGASVPRHRHDGLETILVLTGTQSDESGDYGVGTYIVNAAGTEHSVWSDTGCVVL
                     IQWYRPVTMLEGN"
     misc_feature    complement(396129..396341)
                     /locus_tag="NGR_b03930"
                     /note="ChrR Cupin-like domain; Region: Cupin_7; pfam12973"
                     /db_xref="CDD:193446"
     gene            complement(396430..397098)
                     /locus_tag="NGR_b03940"
                     /db_xref="GeneID:7789929"
     CDS             complement(396430..397098)
                     /locus_tag="NGR_b03940"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="YP_002822610.1"
                     /db_xref="GI:227818639"
                     /db_xref="GeneID:7789929"
                     /translation="MAEIKAEPFPFRLDRDAVALIVIDMQRDFTEEGGFGESLGNDVA
                     RVAKIVPDVKRLIEGFRAAGLPVIHTMECHRPDLSDLPRAKRERGRPHFRIGDEGPMG
                     RILIAGEPGTAILPELAPAVGETVIEKPGKGAFYATPLDYILKERDIGQLVFAGVTTE
                     VCVQTTMREANDRGYECLLVEEATESYFPEFKSATLAMIRAQGAIVGWTAHLADVLRG
                     IAHA"
     misc_feature    complement(396499..397044)
                     /locus_tag="NGR_b03940"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cd00431"
                     /db_xref="CDD:238245"
     misc_feature    complement(order(396613..396615,396712..396714,
                     397027..397029))
                     /locus_tag="NGR_b03940"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    complement(396625..396630)
                     /locus_tag="NGR_b03940"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238245"
     gene            complement(397098..398642)
                     /locus_tag="NGR_b03950"
                     /db_xref="GeneID:7789930"
     CDS             complement(397098..398642)
                     /locus_tag="NGR_b03950"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATPase"
                     /protein_id="YP_002822611.1"
                     /db_xref="GI:227818640"
                     /db_xref="GeneID:7789930"
                     /translation="MIIGEIPAPKSIPAVGIETVEMTMRFGSFTALDQVSIKVPAGTF
                     HALLGENGAGKSTLVKCIMGFYHPTSGQLQVDGREVAIASPRDAAAHGLGMVYQHFTL
                     VPSLTGAENLVISRARVPAIINWSKEKKRLCAFMQTMPFDIPLDRPVSELAAGEKQKL
                     EIIKQLYLGRRFLVLDEPTSVLTPAEADDMLGLVRGMTERGELTVLMISHKFHEVTKF
                     AGAVSVLRRGRLSGTGRVSELSTADMAGMMIGDVKLAELDTRLPVSPDAAPVLAVKKV
                     KAPDRTGLKPIEIDELVVRSGEIVGIAGISGNGQKELSEVLAGQRTAEGAVIVKGKPY
                     GATRPETRANNVRFIPEEPLNNACAQKMTVTENLAFRTFDLAKDGSDAIWLDARGMKK
                     RATALITDFKVKTASPASPIAALSGGNVQRAVLARELSGDVDLLIVSNPCFGLDFSAV
                     AEIRARIMKARNAGAAVLLMSEDLDELMEMSDRIIVMSDGKLVYETPTRDADVAVIGA
                     HMAGHH"
     misc_feature    complement(397107..398600)
                     /locus_tag="NGR_b03950"
                     /note="ABC-type uncharacterized transport systems, ATPase
                     components [General function prediction only]; Region:
                     COG3845"
                     /db_xref="CDD:226364"
     misc_feature    complement(397944..398594)
                     /locus_tag="NGR_b03950"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(398475..398498)
                     /locus_tag="NGR_b03950"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(398013..398015,398112..398117,
                     398349..398351,398472..398480,398484..398489))
                     /locus_tag="NGR_b03950"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(398349..398360)
                     /locus_tag="NGR_b03950"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(398160..398189)
                     /locus_tag="NGR_b03950"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(398112..398129)
                     /locus_tag="NGR_b03950"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(398094..398105)
                     /locus_tag="NGR_b03950"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(398007..398027)
                     /locus_tag="NGR_b03950"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(397167..397844)
                     /locus_tag="NGR_b03950"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(398639..399355)
                     /locus_tag="NGR_b03960"
                     /db_xref="GeneID:7788136"
     CDS             complement(398639..399355)
                     /locus_tag="NGR_b03960"
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine hydrolase"
                     /protein_id="YP_002822612.1"
                     /db_xref="GI:227818641"
                     /db_xref="GeneID:7788136"
                     /translation="MNSLGSLPITSHKLSHIDADPYPWPYNGDLRPENTALIIIDMQT
                     DFCGPGGYVDHMGYDLSLVRAPIEPIRKVLSAMRAKGYHIIHTREGHRPDLADLPANK
                     RWRSQRIKAGIGDAGPCGRILVRGEPGWEIIDALKPIQGETIIDKPGKGSFCATDLEL
                     ILNQKRIDNIVLTGITTDVCVHTTMREANDRGFECLLLEDCCGATDYGNHLAAIKMVK
                     MQGGVFGSVSNSATLVGQLP"
     misc_feature    complement(398702..399250)
                     /locus_tag="NGR_b03960"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cd00431"
                     /db_xref="CDD:238245"
     misc_feature    complement(order(398816..398818,398915..398917,
                     399233..399235))
                     /locus_tag="NGR_b03960"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    complement(398828..398833)
                     /locus_tag="NGR_b03960"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238245"
     gene            complement(399368..400294)
                     /locus_tag="NGR_b03970"
                     /db_xref="GeneID:7788137"
     CDS             complement(399368..400294)
                     /locus_tag="NGR_b03970"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_002822613.1"
                     /db_xref="GI:227818642"
                     /db_xref="GeneID:7788137"
                     /translation="MEATGIGVWGVPLAIFAGAIRVSTPFIFVSLGEAITERTGRINL
                     GLEGTLVFGAMTAYAVAVMTLSPWLGVLAAMAVGACFGLTHGFICKFRKVNDIAIGIA
                     MMQFGLGLAFFLGKPFIQPAAPKLPAIAFGAWSDLPPIQAVLNINVLFLIGAALALFL
                     WWAFRNTRVGLILRVVGDSSDAARAMGLNPDTVRLLATAAGGALAAIGGAYLSLYYPG
                     SWNEGISSGQGLMAVALVIFARWNPIGCFLAALLFGGAGALGPALQSVGVTKGYYLFY
                     AAPYVLTLVIMIATSSPTRSLAGAPGALSITK"
     misc_feature    complement(399434..400228)
                     /locus_tag="NGR_b03970"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(399698..399754)
                     /locus_tag="NGR_b03970"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(400294..401424)
                     /locus_tag="NGR_b03980"
                     /db_xref="GeneID:7788138"
     CDS             complement(400294..401424)
                     /locus_tag="NGR_b03980"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="YP_002822614.1"
                     /db_xref="GI:227818643"
                     /db_xref="GeneID:7788138"
                     /translation="MTLEANSHTLATLDGRVGSLRPFLEWLARRAEPLAITLFAIFVG
                     LALFSLFIALIGRSPIQLFELIYAGGFGTWFSVQNSLSRAAPLLLTALCVALPARLGL
                     VVIGAEGAVVLGGVAGAAIALPLVGDAPAPLVWLIMALAGMLVGAVWFGFAGFLRHYR
                     GVNETIASLLLAYIAIAVMNHLIEGPLRDPASLNKPSTAPLPPDYMLGSIPGTDLHWG
                     LVVGVMACILSWVLIEATSFGFAARIAGGNVRAAQIQGLPVGRLIVGFTALAGAFGGL
                     AGMIEVAAVQGSANASLAAGYGYTGILVAFLARHNPLAIIPVAVLLGGIDASGGLIQR
                     RMGLPDATVLVLQGTLFVVILFCETFYGRFKIFNPDLWKRSA"
     misc_feature    complement(400360..401175)
                     /locus_tag="NGR_b03980"
                     /note="Transmembrane subunit (TM) of Treponema pallidum
                     (Tp) RbsC-1, RbsC-2 and related proteins. This is a
                     functionally uncharacterized subgroup of TMs which belong
                     to a larger group of TMs of Periplasmic Binding Protein
                     (PBP)-dependent ATP-Binding Cassette; Region:
                     TM_PBP1_transp_TpRbsC_like; cd06580"
                     /db_xref="CDD:119322"
     misc_feature    complement(400621..400677)
                     /locus_tag="NGR_b03980"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119322"
     gene            complement(401439..402581)
                     /locus_tag="NGR_b03990"
                     /db_xref="GeneID:7788139"
     CDS             complement(401439..402581)
                     /locus_tag="NGR_b03990"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding
                     protein/surface lipoprotein Med"
                     /protein_id="YP_002822615.1"
                     /db_xref="GI:227818644"
                     /db_xref="GeneID:7788139"
                     /translation="MTKLLHASHAISRRAFLQSSAAGAAVASLAPGLLLSPAAAQSAL
                     TVGFIYVGPKDDYGYNQAHAEGAAAIKALPGVTVVEEENVPETVDVQKTMESMINLDG
                     ATLLFPTSFGYFDPHMLELAKKYPGIQFRHCGGLWQEGKHPGNTGSYFGYIGQGQYLN
                     GIAAGYATRSKKIGFVAAKPIPQVLQNINSFLLGARSVDPAITCQVIFTGEWSLAVKE
                     AEATNALIDQGADVVTCHVDSPKVVVETGAGRGAFICGYHANQSPLAPEKYLTGAEWA
                     WGNVYTDFVTKAQAGQKLGNFVRGGLKEGFVKMSPLGTAVTEEARKKFEATLAAIMAG
                     GFSVFKGSIRDNKGNVVVAVGQSFAENAIELESMDYLVEGVVGSTA"
     misc_feature    complement(401655..402446)
                     /locus_tag="NGR_b03990"
                     /note="Periplasmic binding domain of the basic membrane
                     lipoprotein Med in Bacillus and its close homologs from
                     other bacteria and Archaea; Region: PBP1_BmpA_Med_like;
                     cd06353"
                     /db_xref="CDD:107348"
     misc_feature    complement(order(401757..401759,401808..401810,
                     401946..401948,402030..402032,402180..402182,
                     402402..402404,402426..402431))
                     /locus_tag="NGR_b03990"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107348"
     gene            402894..403598
                     /locus_tag="NGR_b04000"
                     /db_xref="GeneID:7788140"
     CDS             402894..403598
                     /locus_tag="NGR_b04000"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002822616.1"
                     /db_xref="GI:227818645"
                     /db_xref="GeneID:7788140"
                     /translation="MQIPMSNPRVKQPRRREIIRAGTTVDEMVRAIADMIVTGEMQPG
                     EKLDEFSLAARFEVSRTPVRESLRQLCAMGLVDRQPNRSAMVMNVTGEYLASMFEAMA
                     ELERICARLSAERMTVDERRALEKMHGDSMRLVHAGADDDYAAHNIEFHTRLYRGAHN
                     DHIFEMVTQTRARLAPFRRAQFRLPGRLAKSYKEHQGIVTAILRADAEEAAKAAYWHV
                     SNVSDASTVFVSRNKG"
     misc_feature    402921..403505
                     /locus_tag="NGR_b04000"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    402978..403151
                     /locus_tag="NGR_b04000"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(403035..403037,403038..403043,403065..403079,
                     403083..403088,403095..403097,403125..403130,
                     403134..403145)
                     /locus_tag="NGR_b04000"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    403182..403505
                     /locus_tag="NGR_b04000"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            403742..405226
                     /locus_tag="NGR_b04010"
                     /db_xref="GeneID:7788141"
     CDS             403742..405226
                     /locus_tag="NGR_b04010"
                     /codon_start=1
                     /transl_table=11
                     /product="UgpB, ABC-type sugar transport system,
                     periplasmic component UgpB"
                     /protein_id="YP_002822617.1"
                     /db_xref="GI:227818646"
                     /db_xref="GeneID:7788141"
                     /translation="MDAASQRRIALDVFSKVYITKHIAQHEGVRLGHVSNGEFSEADV
                     GRLCIWEEYMRKMTKALMGMSSALLLSTAIPGMAKADELTLCWAAWDPANALVELSKD
                     FTAQTGTAMKFEFVPWPNFADRILNELNSGGKLCDLLIGDSQWIGGSAENGYYVKLND
                     FFDKEGIKMGDFAEAAVNAYSTWPKGTPNYWALPAMGDANGWFYRKDWFAKPELQAEF
                     KQKYGRDLGPPQTWDELKQVAEFFTGREIDGQKVYGAAIFTERASEGITMGATSALYP
                     YGFKYQQTAGKYDMDGAVNSPDAVAGLEAYKALYKCCQPPGYTDSYMGEGLDAFKSGQ
                     VAMAMNWFAFFPGLYKDEKVGGERIGFFVNPKQKVAASTLGGQGISVVANTDNMDGAL
                     AYIKWFAQPEVQKKWWALGGYAVHNAVLNDPSFKASQPFAADFLVAMNQVQDFWQEPS
                     YAILLQAMQKRLHDYVVADQGTAQEALDALVNDWKEIFEDEGKL"
     misc_feature    403898..405208
                     /locus_tag="NGR_b04010"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    404033..405055
                     /locus_tag="NGR_b04010"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_8; pfam13416"
                     /db_xref="CDD:257741"
     gene            405351..406277
                     /locus_tag="NGR_b04020"
                     /db_xref="GeneID:7788142"
     CDS             405351..406277
                     /locus_tag="NGR_b04020"
                     /codon_start=1
                     /transl_table=11
                     /product="UgpA, ABC-type sugar transport systems, permease
                     component UgpA"
                     /protein_id="YP_002822618.1"
                     /db_xref="GI:227818647"
                     /db_xref="GeneID:7788142"
                     /translation="MLARATPSTIAVRVRGLSDRAIAWLFITPTIALLLAINIFPLIW
                     AVYLSFTNFRANRPNAEVEGVGLRNYQRVLNDADIWIAMQTTAHFVFWTILLQTVIGF
                     ALAYLIDRKFRGHAFWTTVILIPMMLSPAVVGNFWRFLYQPQIGLFNYIVSFFTGIPP
                     SSFEMLGSVNLAPWAIIIVDTWMWTPYVMLICLAGLRSIPDYIYEAAEVDRASAWRQF
                     WSITVPMALPFIMLAVLFRGIENFKMFDMVMLLTGGGPGSTTEVASITLKREAFESWL
                     TGRSSAFAIVLFVAVFGLANIYVKALNKVKQR"
     misc_feature    405618..406226
                     /locus_tag="NGR_b04020"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(405645..405650,405657..405662,405675..405677,
                     405702..405713,405717..405746,405753..405758,
                     405762..405764,405891..405896,405903..405905,
                     405909..405911,405918..405923,405927..405929,
                     405939..405944,405951..405953,406002..406004,
                     406044..406049,406056..406058,406077..406088,
                     406095..406100,406143..406148,406176..406181,
                     406188..406193,406197..406202,406209..406214,
                     406221..406226)
                     /locus_tag="NGR_b04020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(405720..405764,406077..406094)
                     /locus_tag="NGR_b04020"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(405762..405764,405876..405878,406095..406097,
                     406137..406139,406146..406148,406176..406178)
                     /locus_tag="NGR_b04020"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(405954..405992,406008..406013,406023..406025)
                     /locus_tag="NGR_b04020"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            406274..407230
                     /locus_tag="NGR_b04030"
                     /db_xref="GeneID:7788143"
     CDS             406274..407230
                     /locus_tag="NGR_b04030"
                     /codon_start=1
                     /transl_table=11
                     /product="UgpE, ABC-type sugar transport system, permease
                     component UgpE"
                     /protein_id="YP_002822619.1"
                     /db_xref="GI:227818648"
                     /db_xref="GeneID:7788143"
                     /translation="MSSVNTTAHSVVEPTPTVKRIAGAIVILYALITMVPLGWIFLTS
                     IKSPPDSISYPPKIVFTPTLEGYCNLFTTRTRQTPDYIQSLPPPTGTCDEITRGRNMV
                     IAGPSNYWPRFGNSLIIAFGSTFLAVSFGTLAAYGFSRFRVPLADDLLFFILSTRMMP
                     PIAVAIPIYLMYRQFGLSDTALGMILLYTAVNVSLAVWLLKGFIDEIPREYEEAAMID
                     GYTRLQAFWKVVLPQATTGIAATAIFCLIFAWNEYAFAVLLTSGSAQTAPPFIPTIIG
                     EGGQDWPAVAAGTTIFLVPILVFTIILRKQLLRGITFGAVRK"
     misc_feature    406328..407221
                     /locus_tag="NGR_b04030"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    406610..407164
                     /locus_tag="NGR_b04030"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(406658..406663,406670..406675,406688..406690,
                     406718..406729,406733..406762,406769..406774,
                     406778..406780,406841..406846,406850..406852,
                     406856..406858,406865..406870,406874..406876,
                     406886..406891,406898..406900,406949..406951,
                     406991..406996,407003..407005,407024..407035,
                     407042..407047,407084..407089,407114..407119,
                     407126..407131,407135..407140,407147..407152,
                     407159..407164)
                     /locus_tag="NGR_b04030"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(406736..406780,407024..407041)
                     /locus_tag="NGR_b04030"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(406778..406780,406826..406828,407042..407044,
                     407078..407080,407087..407089,407114..407116)
                     /locus_tag="NGR_b04030"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(406901..406939,406955..406960,406970..406972)
                     /locus_tag="NGR_b04030"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            407227..407439
                     /locus_tag="NGR_b04040"
                     /db_xref="GeneID:7788144"
     CDS             407227..407439
                     /locus_tag="NGR_b04040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822620.1"
                     /db_xref="GI:227818649"
                     /db_xref="GeneID:7788144"
                     /translation="MTNPQEMTRATRQKRPVFLRRGPMENIATALIAAGFLMLFQPFL
                     LVLYTYSLAMLLTGTVMFIIVSKFPE"
     gene            407443..408540
                     /locus_tag="NGR_b04050"
                     /db_xref="GeneID:7788145"
     CDS             407443..408540
                     /locus_tag="NGR_b04050"
                     /codon_start=1
                     /transl_table=11
                     /product="MalK, ABC-type sugar transport systems, ATPase
                     component MalK"
                     /protein_id="YP_002822621.1"
                     /db_xref="GI:227818650"
                     /db_xref="GeneID:7788145"
                     /translation="MSEIKIVNLRKQFGDFIAVQDSSFTVEDGEFLALLGPSGCGKTT
                     TLRMIAGLELPTSGRIYLDGEDVTFNRASARDIAFVFQLFALYPHMNVRRNIGFPLLS
                     QGVPKAEIRARVEETARLLRIDHILDRSVSGLAGGDRQRVALGRAIIRRPKCFLMDEP
                     LGTLDAEFREVMVHELRELHNRIHATTVYVTHDQHEAMAMADKIAVMNHGVIEQYGTP
                     REIYDRPASMYVADFIGSPPMNFMRFHSGLNKGMRSIFLDDVEVAVPEVGEDVAPGEM
                     ALGIRPEHIRFSDQSPIRGAVYGSEYLGTNQIVAVETAVGIVKARVSADHSFRLGEAV
                     GLEFNPANIAVFDCVSGRAIASSLYAEARHG"
     misc_feature    407443..408483
                     /locus_tag="NGR_b04050"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    407452..408090
                     /locus_tag="NGR_b04050"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    407548..407571
                     /locus_tag="NGR_b04050"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(407557..407562,407566..407574,407686..407688,
                     407914..407919,408016..408018)
                     /locus_tag="NGR_b04050"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    407677..407688
                     /locus_tag="NGR_b04050"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    407842..407871
                     /locus_tag="NGR_b04050"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    407902..407919
                     /locus_tag="NGR_b04050"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    407926..407937
                     /locus_tag="NGR_b04050"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    408004..408024
                     /locus_tag="NGR_b04050"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    408274..408480
                     /locus_tag="NGR_b04050"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            408533..409540
                     /locus_tag="NGR_b04060"
                     /db_xref="GeneID:7788146"
     CDS             408533..409540
                     /locus_tag="NGR_b04060"
                     /codon_start=1
                     /transl_table=11
                     /product="MalK, ABC-type sugar transport systems, ATPase
                     component MalK"
                     /protein_id="YP_002822622.1"
                     /db_xref="GI:227818651"
                     /db_xref="GeneID:7788146"
                     /translation="MAEVVLHGIGKTFGDTVAVDDLSLTVRDGEFVVLLGPTGAGKTT
                     TLRLIAGLERPDCGRIAIGGRDVGAHSPADRDVAFVFQQYSLYPHLSVYDNLAFPLRS
                     PARRLGAEEIDRRVREVARMVRIEHKLQNRSTRLSGGEMQRVAIGRALVRRPAIYLMD
                     EPLSSLDAKLRAELRLELKRIQKELSSTLLYVTHDQVEAMTMADRIGILSEGKLVQIG
                     TPREIYADPANLHVAARLGQPHINLLPIDLLPGATPPSGALTIGARTEHLEIATNARG
                     NAEVDWIEHLGDQNHLHIRVKGHKLVTLADPHLSIKPGDQISLTLRQPLYFGSEGERL
                     R"
     misc_feature    408533..409498
                     /locus_tag="NGR_b04060"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    408542..409186
                     /locus_tag="NGR_b04060"
                     /note="The N-terminal ATPase domain of the maltose
                     transporter, MalK; Region: ABC_MalK_N; cd03301"
                     /db_xref="CDD:213268"
     misc_feature    408638..408661
                     /locus_tag="NGR_b04060"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    order(408647..408652,408656..408664,408776..408778,
                     409010..409015,409112..409114)
                     /locus_tag="NGR_b04060"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213268"
     misc_feature    408767..408778
                     /locus_tag="NGR_b04060"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213268"
     misc_feature    408938..408967
                     /locus_tag="NGR_b04060"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213268"
     misc_feature    408998..409015
                     /locus_tag="NGR_b04060"
                     /note="Walker B; other site"
                     /db_xref="CDD:213268"
     misc_feature    409022..409033
                     /locus_tag="NGR_b04060"
                     /note="D-loop; other site"
                     /db_xref="CDD:213268"
     misc_feature    409100..409120
                     /locus_tag="NGR_b04060"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213268"
     misc_feature    409322..409498
                     /locus_tag="NGR_b04060"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            409573..411216
                     /locus_tag="NGR_b04070"
                     /db_xref="GeneID:7788147"
     CDS             409573..411216
                     /locus_tag="NGR_b04070"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase"
                     /protein_id="YP_002822623.1"
                     /db_xref="GI:227818652"
                     /db_xref="GeneID:7788147"
                     /translation="MSTMKHFFNRRENIVTEALDGLLQTAPAGSLARLDTYPDIKVVL
                     RGDWDKAKVAVISGGGAGHEPSHAGFVGRGMLTAAVSGEIFASPSVEAVLTAIRAATG
                     PKGCLLIVKNYTGDRLNFGLAAEKARVEGFRVEMVIVADDIALPDIVQPRGVAGTLFV
                     HKIAGHLAECGAGLETVAAAARSAARDIVSLGVSLSSCSIPGQAHAERLEADEGELGL
                     GIHGEPGVERIALQEARSIVATMSERLSRALRGGGGYALLINNLGAVPPIEMGLIAHT
                     VLSSSLAERVKLTIGPAPLMTALNMNGFSLSLMRLDGEREAALKAPVGPHAWVPAVER
                     HDVTVLPAIAALAKQPVPASHDPAADRLIAAICDHLLSLEAELNHLDARAGDGDTGST
                     VATGSRSVLAQIERLPLKDVAATLSSIGSILSTSMGGSSGVLLSIFFTAAAKAYLDTK
                     DMAGALLAGLERMTFYGGAGVGDRTMVDALDPALRALKAGGLAAAASAARAGADATRA
                     MKKAKAGRASYVGERDLDGIPDPGAMAVAAVFEVAAGLR"
     misc_feature    409582..410556
                     /locus_tag="NGR_b04070"
                     /note="Dak1 domain; Region: Dak1; cl10557"
                     /db_xref="CDD:263999"
     misc_feature    409585..411168
                     /locus_tag="NGR_b04070"
                     /note="dihydroxyacetone kinase, ATP-dependent; Region:
                     dak_ATP; TIGR02361"
                     /db_xref="CDD:233835"
     misc_feature    410722..411168
                     /locus_tag="NGR_b04070"
                     /note="DAK2 domain; Region: Dak2; pfam02734"
                     /db_xref="CDD:251502"
     gene            411352..411975
                     /locus_tag="NGR_b04080"
                     /db_xref="GeneID:7788148"
     CDS             411352..411975
                     /locus_tag="NGR_b04080"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase domain of the dihydroxyacetone
                     kinase family"
                     /protein_id="YP_002822624.1"
                     /db_xref="GI:227818653"
                     /db_xref="GeneID:7788148"
                     /translation="MLVVLANAALIGGLIEVCREAIAANADHLSELDRAIGDGDHGIN
                     MRRGLEAVYAERNRLAELALPKALEEIGLTLVMSVGGAAGPLYGTLLIAIGRQLGGAN
                     GQQDFARALEHAIDAVARRGRASPGDKTLLDVLYPVHAEVVRRAGLAGISEQAERAAS
                     LTFGMRAMRGRAAFLGDRSIGHVDPGAKSCALLTAAICRFLEEQCPA"
     misc_feature    411382..411945
                     /locus_tag="NGR_b04080"
                     /note="DAK2 domain; Region: Dak2; cl03685"
                     /db_xref="CDD:261838"
     gene            411963..412370
                     /locus_tag="NGR_b04090"
                     /db_xref="GeneID:7788149"
     CDS             411963..412370
                     /locus_tag="NGR_b04090"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannnose-specific transporter subunit
                     IIA"
                     /protein_id="YP_002822625.1"
                     /db_xref="GI:227818654"
                     /db_xref="GeneID:7788149"
                     /translation="MSGMIPKSANVGIVIVSHSPLVAEGAADMVRQMVGDCVPLAWSG
                     GNAVGGLGTHAAGILAAIERAWSDAGVAVFVDLGGAETNSEMAIEMLGEPRSGKVIIC
                     DAPLVEGAVMAAAEASGGAVLARVVATAQELSP"
     misc_feature    411990..412367
                     /locus_tag="NGR_b04090"
                     /note="phosphotransferase mannnose-specific family
                     component IIA; Provisional; Region: PRK14484"
                     /db_xref="CDD:184702"
     misc_feature    order(412014..412016,412059..412064,412095..412097,
                     412203..412205,412296..412298)
                     /locus_tag="NGR_b04090"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    order(412014..412016,412188..412190,412203..412205)
                     /locus_tag="NGR_b04090"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    412014..412016
                     /locus_tag="NGR_b04090"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            412370..412714
                     /locus_tag="NGR_b04100"
                     /db_xref="GeneID:7788150"
     CDS             412370..412714
                     /locus_tag="NGR_b04100"
                     /note="HPr-like protei"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine-containing phosphocarrier protein"
                     /protein_id="YP_002822626.1"
                     /db_xref="GI:227818655"
                     /db_xref="GeneID:7788150"
                     /translation="MDNRSRREAPEAVDTHGYYKAEIEVTHGFGLHARPSVIFTRLAK
                     SFPCSVEIEVNDSHVWLNGKSIVKIMGAKIRRGSMLKIRARGLRAAEAIHALKALVER
                     DFDEAKKHGRSA"
     misc_feature    412433..412669
                     /locus_tag="NGR_b04100"
                     /note="Histidine-containing phosphocarrier protein
                     (HPr)-like proteins. HPr is a central component of the
                     bacterial phosphoenolpyruvate sugar phosphotransferase
                     system (PTS). The PTS catalyses the phosphorylation of
                     sugar substrates during their translocation...; Region:
                     PTS-HPr_like; cd00367"
                     /db_xref="CDD:238217"
     misc_feature    412433..412444
                     /locus_tag="NGR_b04100"
                     /note="dimerization domain swap beta strand [polypeptide
                     binding]; other site"
                     /db_xref="CDD:238217"
     misc_feature    order(412460..412462,412466..412471,412475..412480,
                     412490..412492,412499..412501,412559..412570,
                     412577..412582)
                     /locus_tag="NGR_b04100"
                     /note="regulatory protein interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238217"
     misc_feature    412463..412465
                     /locus_tag="NGR_b04100"
                     /note="active site"
                     /db_xref="CDD:238217"
     misc_feature    412562..412564
                     /locus_tag="NGR_b04100"
                     /note="regulatory phosphorylation site [posttranslational
                     modification]; other site"
                     /db_xref="CDD:238217"
     gene            412698..414311
                     /locus_tag="NGR_b04110"
                     /db_xref="GeneID:7788151"
     CDS             412698..414311
                     /locus_tag="NGR_b04110"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate protein kinase"
                     /protein_id="YP_002822627.1"
                     /db_xref="GI:227818656"
                     /db_xref="GeneID:7788151"
                     /translation="MAEALEIAGTAASPGVGLGPVHRATDVTAEVLALPDTVAAERDK
                     LRQAVATALAELQALADRSDEESAGILGFQIEMLLDPALAEMAEDRIVAGDGAALAWI
                     GALDEYIAGIKEAPDEQLRARAVDIVDIRNRVMSALTGRPLDGFAPGSVFVGKDLEPS
                     RFLAHDWTAGGGIVLFEGSVSSHVAMLARGRCVPMVVATGQFEVADGARVLIDANNGR
                     VVVAPDDSHVRQAKPARAEATPIAARRAGGVVETADGVAIRLSAIINDPAELKAVDPA
                     SFAGIGLMRTEFLVASPADAVDEQRHYDIYRQALEWAGDAPAIVRMLDLGGEKTLPGM
                     GDRKSESFLGLRGIRLLLARPALARAQVRALLRAAVHGDLGVLLPMVTVPDELDAMRT
                     YFEEERADLFRHGVETRMPEIGMMVEVPAAALMLERFSHSAFFSFGTNDLAQYLMAAA
                     RDDQSVAALYDAATSAVLRVIAQGVGHAEAMKKPIGICGEMASDPRHIPALMAAGLRH
                     FSVAPNRVTDIRSTIGGFYSDGRAAAEMK"
     misc_feature    412713..414266
                     /locus_tag="NGR_b04110"
                     /note="Phosphoenolpyruvate-protein kinase (PTS system EI
                     component in bacteria) [Carbohydrate transport and
                     metabolism]; Region: PtsA; COG1080"
                     /db_xref="CDD:224006"
     misc_feature    412716..413069
                     /locus_tag="NGR_b04110"
                     /note="PEP-utilizing enzyme, N-terminal; Region:
                     PEP-utilizers_N; pfam05524"
                     /db_xref="CDD:253237"
     misc_feature    413139..413345
                     /locus_tag="NGR_b04110"
                     /note="PEP-utilizing enzyme, mobile domain; Region:
                     PEP-utilizers; pfam00391"
                     /db_xref="CDD:249825"
     misc_feature    413451..414266
                     /locus_tag="NGR_b04110"
                     /note="PEP-utilizing enzyme, TIM barrel domain; Region:
                     PEP-utilizers_C; pfam02896"
                     /db_xref="CDD:251603"
     gene            414312..414722
                     /locus_tag="NGR_b04120"
                     /db_xref="GeneID:7788152"
     CDS             414312..414722
                     /locus_tag="NGR_b04120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822628.1"
                     /db_xref="GI:227818657"
                     /db_xref="GeneID:7788152"
                     /translation="MSRETVEDPIIAYKTILAQIIDNRPSGTRQRLAEALGKHRSFVT
                     QVTSPAYSTPLPARHLAAIFRVCHFSLGEQERFLQAYQSAHPGKLPDFGSAQKLRQLS
                     LIVPDLGDEKKNRLFDEAIAELVRNMAKLVGTMD"
     gene            414838..415833
                     /locus_tag="NGR_b04130"
                     /db_xref="GeneID:7788153"
     CDS             414838..415833
                     /locus_tag="NGR_b04130"
                     /note="with DhaL and DhaM forms dihydroxyacetone kinase,
                     which is responsible for phosphorylating dihydroxyacetone;
                     DhaK is the dihydroxyacetone binding subunit of the
                     dihydroxyacetone kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase subunit DhaK"
                     /protein_id="YP_002822629.1"
                     /db_xref="GI:227818658"
                     /db_xref="GeneID:7788153"
                     /translation="MKKFMNRAETLVAESLAGLVSAHERLVTFGADGKFVRRRSLRPG
                     KVSLISGGGAGHEPMHVGFVGRGMLDAACTGHVFTSPTPDQIVAAIRETDRGEGCLLI
                     VKNYDGDVMNFEMAAELVAAEHRIATVVVRDDVDPGGSKRSQGRRGVAGTVVMEKLLG
                     AAAEAGWRLDELSALGESLNGRIRTMGVSLRGVTVPDTERETFVLPEDEMEIGVGIHG
                     EPGRARVKFATADEIVETMLEAILGELASERDENLLMFINGYGGTPASELYLVYNSAK
                     AQCERLGLTIARPLVGTYVTSLDMAGLSITVARLAERELSLWDAPVDTAALRWGG"
     misc_feature    414838..415827
                     /locus_tag="NGR_b04130"
                     /note="dihydroxyacetone kinase subunit DhaK; Provisional;
                     Region: PRK14481"
                     /db_xref="CDD:237724"
     gene            complement(416595..418229)
                     /locus_tag="NGR_b04140"
                     /db_xref="GeneID:7788154"
     CDS             complement(416595..418229)
                     /locus_tag="NGR_b04140"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="YP_002822630.1"
                     /db_xref="GI:227818659"
                     /db_xref="GeneID:7788154"
                     /translation="MSLEGHLSDQKSLRAVTGNTANWAELAKDCIAFANAAGGTLKIG
                     IEDGHELPPAEQRVQSDLPDLLRRKLAERTVNVIGLPNIVTAINGGQYIELTVPRSLA
                     VASTTDGRYYLRVADQSKPVTGDDVMRLASERAALPWETQISLQIPRSELDAVKVDAI
                     VTGLRASDRVKSSVKEKTPNELLDHYLLAQGEYLTNLGVLCVGKQFRRAQLITAPVLQ
                     FIKFDDHGQKVNKIVWDDHALNPMELVEAVWQEVPDFKESYELPDGLFRQNVPAFDEV
                     VVRELLVNALVHRPYTQRGDIFLNLHPDRLEVVNPGLLPLGVTPQNVLHTTVRRNEHL
                     ARLFHDLKLMEREGSGYDKVYEVLLSQGRPAPELVEQHDRVQVTIRRRILKPEIIDFI
                     AKADDTYQLTQRERIALGLLAQHDALTARELAAQIELPSIDALQPWIKRLLEWQLVRS
                     AGRTQATRYFVDPEMLRRHDFIGGTTLKRIEPHRLFALIVEDVGRYPQSKIGDIHKRV
                     GSEIPRSRIRRSVEQLVKDGRLISSGIRSGTRYSIP"
     misc_feature    complement(417861..418157)
                     /locus_tag="NGR_b04140"
                     /note="Divergent AAA domain; Region: AAA_4; pfam04326"
                     /db_xref="CDD:252528"
     misc_feature    complement(416865..418154)
                     /locus_tag="NGR_b04140"
                     /note="Predicted transcriptional regulator containing an
                     HTH domain and an uncharacterized domain shared with the
                     mammalian protein Schlafen [Transcription]; Region:
                     COG2865"
                     /db_xref="CDD:225420"
     misc_feature    complement(417093..417347)
                     /locus_tag="NGR_b04140"
                     /note="ATP-dependent DNA helicase recG C-terminal; Region:
                     HATPase_c_4; pfam13749"
                     /db_xref="CDD:258042"
     gene            418465..419052
                     /locus_tag="NGR_b04150"
                     /db_xref="GeneID:7788155"
     CDS             418465..419052
                     /locus_tag="NGR_b04150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822631.1"
                     /db_xref="GI:227818660"
                     /db_xref="GeneID:7788155"
                     /translation="MRHEFSEGDLAFRFTSHRLCLDFLSTIGEVGHRDIERIGTPTSY
                     SRWIAASGILDREPLVSVTDVEDAVEFRRILRSFFSDVTAEIRPPANVIRAINDTSRR
                     PIPWMELADDGYTVSRRAVAPAQAALASVARDALLLVSEGLLPRVKQCNDPTCNMFFL
                     DNSRGNNRIWCSTEGRGCGNKAKKRAFRKRHSEPS"
     misc_feature    418492..419034
                     /locus_tag="NGR_b04150"
                     /note="Conserved protein containing a Zn-ribbon-like
                     motif, possibly RNA-binding [General function prediction
                     only]; Region: COG5516"
                     /db_xref="CDD:227803"
     misc_feature    418510..418896
                     /locus_tag="NGR_b04150"
                     /note="Protein of unknown function (DUF1470); Region:
                     DUF1470; pfam07336"
                     /db_xref="CDD:254162"
     misc_feature    418900..419037
                     /locus_tag="NGR_b04150"
                     /note="CGNR zinc finger; Region: zf-CGNR; pfam11706"
                     /db_xref="CDD:256560"
     gene            complement(419024..419752)
                     /locus_tag="NGR_b04160"
                     /db_xref="GeneID:7788156"
     CDS             complement(419024..419752)
                     /locus_tag="NGR_b04160"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_002822632.1"
                     /db_xref="GI:227818661"
                     /db_xref="GeneID:7788156"
                     /translation="MLAMDHQKQNNAALVRRTLRQRILRCELQPGERIVINDVCEEFG
                     VSLGAVREALSGLEGEGLLHAYAKRGFQVTGVSLEDMFDLTQARIEVECACLRLSIAQ
                     GDLAWESQVVAALYRLNGTPREQRGSDDEMSAAWSEAHANFHVALVAGCRNQTLLGIR
                     QTLFDRAERYRRLSIPVDADHRDVAAEHDALAQAALQRDPENACRLMETHLSRTAMLI
                     SEAAGRRLDGGGEEPIKMVPSDAS"
     misc_feature    complement(419090..419731)
                     /locus_tag="NGR_b04160"
                     /note="DNA-binding transcriptional regulator CsiR;
                     Provisional; Region: PRK11534"
                     /db_xref="CDD:183181"
     misc_feature    complement(419531..419710)
                     /locus_tag="NGR_b04160"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    complement(order(419540..419551,419555..419560,
                     419588..419590,419597..419602,419606..419620,
                     419642..419647,419648..419650))
                     /locus_tag="NGR_b04160"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    complement(419114..419506)
                     /locus_tag="NGR_b04160"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            419856..420731
                     /locus_tag="NGR_b04170"
                     /db_xref="GeneID:7788157"
     CDS             419856..420731
                     /locus_tag="NGR_b04170"
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxopent-3-ene-1,2,5-tricarboxylate
                     decarboxylase"
                     /protein_id="YP_002822633.1"
                     /db_xref="GI:227818662"
                     /db_xref="GeneID:7788157"
                     /translation="MRFLAYTQGNQTGVAVLSNGEWRGAADAGTTYAGSIQAWIEQGG
                     EALWLAGDRLSREPIVDLANVDLLPPILRPGKIVCVGLNYADHTEESGYKQPDHPTLF
                     PRFTSSLIAAGEPIVRPFVSETLDFEGELVAVIGRRGRHISKHDALDHVAGYSIFNDA
                     SIREFQHRTPQWTLGKNFDGTGSFGPWFVTADELPRGAAGLRIETRLNGEVVQASNTD
                     QLIFDVATLVSTISEAITLEPGDLIVTGTPSGIGHARNPRLYMRAGDVVEVEIQSIGT
                     LRNPVVDEPLQRAAS"
     misc_feature    419949..420707
                     /locus_tag="NGR_b04170"
                     /note="4-hydroxyphenylacetate degradation bifunctional
                     isomerase/decarboxylase, C-terminal subunit; Region:
                     HpaG-C-term; TIGR02303"
                     /db_xref="CDD:131356"
     misc_feature    420081..420701
                     /locus_tag="NGR_b04170"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            420756..421709
                     /locus_tag="NGR_b04180"
                     /db_xref="GeneID:7788158"
     CDS             420756..421709
                     /locus_tag="NGR_b04180"
                     /note="dioxygenase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="glyoxalase"
                     /protein_id="YP_002822634.1"
                     /db_xref="GI:227818663"
                     /db_xref="GeneID:7788158"
                     /translation="MTANRGQIGAEAVNGLLGAHSLDTFSFGVPDLDKAEEFHRAFGL
                     VTRERGGALELRTEGNDHVWARLTEGPKKALSYLSFGIYEEDLERFKRHLKSNGVLET
                     DAPPGLESNGIWLRDFEGTLVELKVAAKSSPDQKSHGVMNSSPAGIAGAPKRSAAGLV
                     MPSRMSHILLFTSDVDRAVDFYTRVLGLGLSDRAGSNIAFLHGRHGSDHHMVAFVRSH
                     APGIHHTSWDVPSVHHVGLGAMCMADRGFSQGWGVGRHVLGSNYFHYVRDPWGSYAEY
                     SCDMDFIPKNIDWSAADHDDEDAFYVWGPKPPADFGVNHEA"
     misc_feature    420813..421148
                     /locus_tag="NGR_b04180"
                     /note="N-terminal domain of MhqB, a type I extradiol
                     dioxygenase, and similar proteins; Region: MhqB_like_N;
                     cd08344"
                     /db_xref="CDD:176692"
     misc_feature    420840..421688
                     /locus_tag="NGR_b04180"
                     /note="3,4-dihydroxyphenylacetate 2,3-dioxygenase; Region:
                     HpaD; TIGR02295"
                     /db_xref="CDD:213698"
     misc_feature    421239..421640
                     /locus_tag="NGR_b04180"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     misc_feature    order(421254..421256,421266..421268,421347..421349,
                     421392..421394,421398..421400,421425..421427,
                     421548..421550,421572..421574,421578..421580)
                     /locus_tag="NGR_b04180"
                     /note="active site"
                     /db_xref="CDD:211348"
     misc_feature    order(421254..421256,421425..421427,421578..421580)
                     /locus_tag="NGR_b04180"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:211348"
     gene            421741..422496
                     /locus_tag="NGR_b04190"
                     /db_xref="GeneID:7788159"
     CDS             421741..422496
                     /locus_tag="NGR_b04190"
                     /EC_number="1.1.1.10"
                     /note="XR; Dicarbonyl/L-xylulosereductase"
                     /codon_start=1
                     /transl_table=11
                     /product="L-xylulose reductase"
                     /protein_id="YP_002822635.1"
                     /db_xref="GI:227818664"
                     /db_xref="GeneID:7788159"
                     /translation="MENRVEGAATAAPRPLIGKRIVLTGATGGLGRAMAVAFAAAGAD
                     VIPVARGGEALETLADELGSAPLAVDLTDPAVISSAMNGIGPVDVLVNNSGTNRPGPF
                     EAVTVQDFDLLVNLNLRGTFFATQSLLPHIRAGGAILNVGSQMGHVGAENRTVYCATK
                     HAIEGFTKALAIELAPRAIRVVSIAPTFIETPMTAPMFADPTFRSQVLTNIPMGRMGR
                     PEDVAAAAVFLASDAAGMITGTSLLIDGGWTAH"
     misc_feature    421792..422484
                     /locus_tag="NGR_b04190"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    421801..422475
                     /locus_tag="NGR_b04190"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(421813..421815,421819..421830,421885..421893,
                     421945..421953,422017..422025,422086..422088,
                     422161..422169,422206..422208,422218..422220,
                     422296..422307,422311..422316)
                     /locus_tag="NGR_b04190"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(422089..422091,422167..422169,422206..422208,
                     422218..422220)
                     /locus_tag="NGR_b04190"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            422519..422995
                     /locus_tag="NGR_b04200"
                     /db_xref="GeneID:7788160"
     CDS             422519..422995
                     /locus_tag="NGR_b04200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822636.1"
                     /db_xref="GI:227818665"
                     /db_xref="GeneID:7788160"
                     /translation="MTCANRDRSSEPQRSTMSGDNPAFATLKRFYAAETVYLAPGGGD
                     FGPIAETLDPGCVLYQPATLPYGGEWRGPEGFRAWMEAFGRVWSHLEVRDPQFYPSGD
                     EVIVSRSHVHATVRATGQAVDWPLMQFFRVRNNRIVELRPFYWDTAALLAGIGGRS"
     misc_feature    422597..422935
                     /locus_tag="NGR_b04200"
                     /note="SnoaL-like domain; Region: SnoaL_2; pfam12680"
                     /db_xref="CDD:257217"
     gene            422992..423810
                     /locus_tag="NGR_b04210"
                     /db_xref="GeneID:7788161"
     CDS             422992..423810
                     /locus_tag="NGR_b04210"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="YP_002822637.1"
                     /db_xref="GI:227818666"
                     /db_xref="GeneID:7788161"
                     /translation="MSKREVVIVTGASSGIGRATAVHLAEFGYDVGLTFGSNEAAGEE
                     TARRVRAAGGRAEVRQMSLGDPASIERALGGLIEAFRGVAAFVNNAGTLALASFTDIS
                     LADWRGVIDVNLTGSFLAGQLIARHMIETKTPGRIVNVSSVHEAVPLLGGAAYCTSKA
                     GIGMLTKCMALDLAPHGIRVNAVGPGETATPMIGVAEGEDIMGRRRPETPLGRPGTPG
                     EMAGAIAYLLAPEARFTTGTTLFVDGGLTLMAAIGNQRTIMESMRQGEVTNGNS"
     misc_feature    422998..423735
                     /locus_tag="NGR_b04210"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    423001..423738
                     /locus_tag="NGR_b04210"
                     /note="oxidoreductase; Provisional; Region: PRK12743"
                     /db_xref="CDD:237187"
     misc_feature    order(423022..423024,423028..423033,423037..423039,
                     423094..423102,423256..423264,423409..423417,
                     423454..423456,423466..423468,423544..423555)
                     /locus_tag="NGR_b04210"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(423328..423330,423415..423417,423454..423456,
                     423466..423468)
                     /locus_tag="NGR_b04210"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            423797..424537
                     /locus_tag="NGR_b04220"
                     /db_xref="GeneID:7788162"
     CDS             423797..424537
                     /locus_tag="NGR_b04220"
                     /EC_number="1.1.1.-"
                     /note="2,5-DDOL dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="2,5-dichloro-2,5-cyclohexadiene-1,4-diol
                     dehydrogenase"
                     /protein_id="YP_002822638.1"
                     /db_xref="GI:227818667"
                     /db_xref="GeneID:7788162"
                     /translation="MGILDGKTAIVTGGAGGVGSAVASLFAQEGAKVAVFDMKEDGPQ
                     GIDFYRKVDITDEGAVRAAVATVVEVLGLPDVLVNAAAIAGTGAPTHEATSEDFDRVF
                     AINVKGTFLCTKHVIAGLLATGRPGSIVNISSTYGVVGNADIPLYHGTKAAVRLLSKC
                     DAVTYAEKGIRSNAIILGSTRTDMTVAAMKASPEGEAYVRNLIAAHPMKRQAEPVEIA
                     RVIAFLASDLASFVTGADIPVDGGYTAQ"
     misc_feature    423806..424534
                     /locus_tag="NGR_b04220"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    423806..424534
                     /locus_tag="NGR_b04220"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK07231"
                     /db_xref="CDD:235975"
     misc_feature    order(423833..423835,423839..423844,423848..423850,
                     423905..423913,424034..424042,424190..424198,
                     424235..424237,424247..424249,424325..424336)
                     /locus_tag="NGR_b04220"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(424109..424111,424196..424198,424235..424237,
                     424247..424249)
                     /locus_tag="NGR_b04220"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            424566..425618
                     /locus_tag="NGR_b04230"
                     /db_xref="GeneID:7788163"
     CDS             424566..425618
                     /locus_tag="NGR_b04230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822639.1"
                     /db_xref="GI:227818668"
                     /db_xref="GeneID:7788163"
                     /translation="MKLRNYFAALLVSMAILPGSVRAQEVRIDVGDGITVPLKTEGPL
                     KIAFFSEGANNSAMQASIDGATRAATELGWQIDVFDGKFDAVTQLNQLQNALTRGYDA
                     WVLKAVEGNTMCEIATKDAPAKGIVVVISVLSICGRGANEGEALWSPGTLAYVGGAET
                     PKAFFQVLDRMGRENPGPQKLGVITGPELNPITKNHEAALRMFEAKYPDVEVVAVART
                     DYSTPSALEKAAPMVQANPDITLYYTAFSNLAKGLVPVLEQAGLIDKAKIYDNGATAW
                     AAGAIMEGAVKLSSANRLGSNAYNAVMAIDRARKGENLPRAIGDLGEPLVDGTPPTDP
                     YLIDSANVASYQPEVE"
     misc_feature    424698..425513
                     /locus_tag="NGR_b04230"
                     /note="Periplasmic sugar-binding domain of active
                     transport systems that are members of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_ABC_sugar_binding_like; cd01536"
                     /db_xref="CDD:107249"
     misc_feature    424701..425501
                     /locus_tag="NGR_b04230"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    order(424734..424736,424959..424961,425151..425153,
                     425379..425381,425439..425441)
                     /locus_tag="NGR_b04230"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107249"
     gene            425615..426412
                     /locus_tag="NGR_b04240"
                     /db_xref="GeneID:7788164"
     CDS             425615..426412
                     /locus_tag="NGR_b04240"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="YP_002822640.1"
                     /db_xref="GI:227818669"
                     /db_xref="GeneID:7788164"
                     /translation="MSTVGASIVYNVPVHSMMSLAGRRALVTGGSGGIGRAIVDEFLD
                     LGAAIGVTDLVAPEVDLASGAVFCAADITDETDVQRMFDTLTTSLDGAFDILVNCAAI
                     AGTGRPTHLASAEDFDHVFAVNVKGAFLCGGQFIARCLERDAEGVIVNVSSINGVIGS
                     ADIPLYHATKAALQLLSKCDAITYADRKIRSNCVLPGSTRTELTLRAQAESDDPDGYV
                     RRLVQAHPIGRQALPEEIARVVAFLASDASAFVTGADVAADGGYTAQ"
     misc_feature    425666..426409
                     /locus_tag="NGR_b04240"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK07231"
                     /db_xref="CDD:235975"
     misc_feature    425687..426391
                     /locus_tag="NGR_b04240"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(425699..425701,425705..425716,425771..425776,
                     425822..425830,425909..425917,425981..425983,
                     426065..426073,426110..426112,426122..426124,
                     426200..426211,426215..426220)
                     /locus_tag="NGR_b04240"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(425984..425986,426071..426073,426110..426112,
                     426122..426124)
                     /locus_tag="NGR_b04240"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            426434..427495
                     /locus_tag="NGR_b04250"
                     /db_xref="GeneID:7788165"
     CDS             426434..427495
                     /locus_tag="NGR_b04250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822641.1"
                     /db_xref="GI:227818670"
                     /db_xref="GeneID:7788165"
                     /translation="MRKFKSLKSSLSIASLLAALAAPAAAEDVSIDVGTDKPIVVQKG
                     ALKRIALFIEMGTNTAVQSTVTGAQEAAALHSITVDVFDARFDIGRQVNQMQNALIGG
                     YDAWIVAAIEGEQVCNMAASEAPKAGIPVAVVTMAICGRSINEGEAMWSPGTLTYIGG
                     NESPNSFERVMQQAVIDHPGPQKIAVLTGQPLHPITLAFDKALKKFLAENPQVTLAAT
                     HRTDYSPEMNQQKVQTTLQATPDLDAIIGVYTNMSKGAVPALEAAGLQGKIRLYEAGG
                     TVWSVDALKSGAIAATTGYYRGTAAETAVEMLVKAFNGEPVPRAVMNDGHALIPGQSP
                     GQVGIVTVANVDQYVPQSP"
     misc_feature    426575..427390
                     /locus_tag="NGR_b04250"
                     /note="Periplasmic sugar-binding domain of active
                     transport systems that are members of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_ABC_sugar_binding_like; cd01536"
                     /db_xref="CDD:107249"
     misc_feature    426578..427381
                     /locus_tag="NGR_b04250"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    order(426611..426613,426836..426838,427028..427030,
                     427256..427258,427316..427318)
                     /locus_tag="NGR_b04250"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107249"
     gene            427503..427850
                     /locus_tag="NGR_b04260"
                     /db_xref="GeneID:7788166"
     CDS             427503..427850
                     /locus_tag="NGR_b04260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822642.1"
                     /db_xref="GI:227818671"
                     /db_xref="GeneID:7788166"
                     /translation="MTNTTDQIVLIVAFDPMPGRKEAFREHLFALVRAMSKEPHFVNT
                     IVHDDLNHADRLVLYEIWSGTRERWLREEPQKPYRKTYEEGLPGLLADRIVQWMVPVA
                     EWGSSLTAHIQGE"
     misc_feature    427524..>427688
                     /locus_tag="NGR_b04260"
                     /note="Antibiotic biosynthesis monooxygenase; Region: ABM;
                     cl10022"
                     /db_xref="CDD:263948"
     gene            427852..428889
                     /locus_tag="NGR_b04270"
                     /db_xref="GeneID:7788167"
     CDS             427852..428889
                     /locus_tag="NGR_b04270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822643.1"
                     /db_xref="GI:227818672"
                     /db_xref="GeneID:7788167"
                     /translation="MKHAAIAAFLLAAGSASAEEIKVDVGLDKPVVIDTEQPLKLALF
                     IEIGTNSAVQSTITGVEKMAAKYGFSYDVFDARFDVARQINQMETALFNGYNAWIVVP
                     VEGSQVCDMVTKRAPAENVLVAHATGTACGRSSMEGEDLWSPGTLTYVGGNETPGAFK
                     AIMEKAAADNPGRQKVGILTGPNLHPITVSFDKALDEIKKEYPDFEVVALHRTDYSPP
                     DNQMKTQTMLQANPDLSIMVGAYTNMSKGAVPALEAAGKQGQVKVYEAGGTEWSVEAL
                     KSGAIQATTGFYRQTAAEAAAQAILDARAGKKVPRVILNDGHALIPGQEAGKVGLVTR
                     DNVAQYTPESP"
     misc_feature    427969..428793
                     /locus_tag="NGR_b04270"
                     /note="Periplasmic sugar-binding domain of active
                     transport systems that are members of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_ABC_sugar_binding_like; cd01536"
                     /db_xref="CDD:107249"
     misc_feature    order(428005..428007,428227..428229,428422..428424,
                     428650..428652,428710..428712)
                     /locus_tag="NGR_b04270"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107249"
     misc_feature    428011..428703
                     /locus_tag="NGR_b04270"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     gene            428920..430458
                     /locus_tag="NGR_b04280"
                     /db_xref="GeneID:7788168"
     CDS             428920..430458
                     /locus_tag="NGR_b04280"
                     /codon_start=1
                     /transl_table=11
                     /product="MglA, ABC-type sugar transport system, ATPase
                     component MglA"
                     /protein_id="YP_002822644.1"
                     /db_xref="GI:227818673"
                     /db_xref="GeneID:7788168"
                     /translation="MSTLAAQRPPAIRLRGVRKSFGMVEALKPVTLDVEAGKIHALVG
                     QNGAGKSTTLGILAGRIAASGGDIEIGGSRVELGDPRRARAAGVVAIYQELTIVPALS
                     AVANVFLGQTYARRGLLAEAAMRRRFHELTARLGVTISAEAEARSLSVADQQTLEILR
                     ALEANARIILFDEPTTALAPPEREALFKVMRDLRAAGHTLIYVSHNLDEVLDISDAIS
                     VFRNGRLIETRPRPDWTKSRLVAAMLGEDMGDIYHRRPAARPLGGPPALSVLGCSLPG
                     AIEGIGFSVRAGEVLGIGGLVGSGRSSLLRAVAGLEPQSSGSMEIGGKAVEWPRTPRA
                     ARRLGIALVPEDRKHQGLVLGLPAADNVTLPNFGAVAPFGLINNRYMTDRSAVATRAF
                     GFDPRRLAAPVGTLSGGNQQKVLLARWAYERPKILLVDEPTRGIDVGAKSEILNSLRA
                     FADQGLAVIIVSSELEEICALADRVVVLAEGRLVDHIDSNRAELSVHLVLNSAFGVER
                     HHHD"
     misc_feature    428932..430434
                     /locus_tag="NGR_b04280"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    428953..429603
                     /locus_tag="NGR_b04280"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    429049..429072
                     /locus_tag="NGR_b04280"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(429058..429063,429067..429075,429196..429198,
                     429433..429438,429532..429534)
                     /locus_tag="NGR_b04280"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    429187..429198
                     /locus_tag="NGR_b04280"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    429361..429390
                     /locus_tag="NGR_b04280"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    429421..429438
                     /locus_tag="NGR_b04280"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    429445..429456
                     /locus_tag="NGR_b04280"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    429520..429540
                     /locus_tag="NGR_b04280"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    429706..430368
                     /locus_tag="NGR_b04280"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            430451..431431
                     /locus_tag="NGR_b04290"
                     /db_xref="GeneID:7788169"
     CDS             430451..431431
                     /locus_tag="NGR_b04290"
                     /codon_start=1
                     /transl_table=11
                     /product="AraH, Ribose/xylose/arabinose/galactoside
                     ABC-type transport system, permease components AraH"
                     /protein_id="YP_002822645.1"
                     /db_xref="GI:227818674"
                     /db_xref="GeneID:7788169"
                     /translation="MTDSLAIAAQPIATGRRHFVDIALRYGLIIVLVVLVAVSQFLYP
                     RFLDPQNIKNILSQNAPLGIVAVGMTLVMITRGFDLSVGASYAAGATVFASLAVAGWS
                     LWWAGAVTLLIGLVAGLINGTIITRINVNPFVATLGTTSVFSGLALLYSNSSPFVVSD
                     KTFAMIGRGSFLDVPISIWILAAVLVVGELVLARTVYGRSLYAIGGNDEAARLAGLPT
                     AMLRTSTYVICGVCAALGGMIIASRLSIGQADIGTSMALDSIAVVVIGGTSLMGGEGS
                     VWRSAIGLMIVAVLTNLLDSLAVDSNYQLVIKGTIVVAAVALDAFARSRR"
     misc_feature    430625..431407
                     /locus_tag="NGR_b04290"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    431075..431131
                     /locus_tag="NGR_b04290"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            431446..431811
                     /locus_tag="NGR_b04300"
                     /db_xref="GeneID:7788170"
     CDS             431446..431811
                     /locus_tag="NGR_b04300"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822646.1"
                     /db_xref="GI:227818675"
                     /db_xref="GeneID:7788170"
                     /translation="MSRSPSTISPQASPSTGSSACGRRNGRNCPMAGCWSSCEGTAVE
                     LVWSNTTTRSVPLPLPDDLRRTGVKHVAFQSDNLDADLGRLADLGIRPVVGPSHSPYG
                     LRFVFLNDPAGNRVEIMGN"
     misc_feature    <431617..431799
                     /locus_tag="NGR_b04300"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cd06587"
                     /db_xref="CDD:211348"
     gene            431860..432240
                     /locus_tag="NGR_b04310"
                     /db_xref="GeneID:7788171"
     CDS             431860..432240
                     /locus_tag="NGR_b04310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822647.1"
                     /db_xref="GI:227818676"
                     /db_xref="GeneID:7788171"
                     /translation="MSKFLKSGKAADARAEDDAKVRATVEGILSDIERRGDLAVRDLS
                     EKFDRWSPENFRLSEQDIERLIGEVPAQDLAAIRFAQDQVRRFAEHQKAALRDVEVET
                     LPGVVLGHRNIPVNSVGCYAPGGK"
     misc_feature    431860..>432237
                     /locus_tag="NGR_b04310"
                     /note="Histidinol dehydrogenase, HisD, E.C 1.1.1.23.
                     Histidinol dehydrogenase catalyzes the last two steps in
                     the L-histidine biosynthesis pathway, which is conserved
                     in bacteria, archaea, fungi, and plants. These last two
                     steps are (i) the NAD-dependent...; Region: Histidinol_dh;
                     cl10029"
                     /db_xref="CDD:263949"
     misc_feature    complement(432284..433410)
                     /note="potential frameshift: common BLAST hit:
                     gi|148656619|ref|YP_001276824.1| oxidoreductase
                     domain-containing protein"
     gene            complement(432284..432844)
                     /locus_tag="NGR_b04320"
                     /db_xref="GeneID:7788172"
     CDS             complement(432284..432844)
                     /locus_tag="NGR_b04320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822648.1"
                     /db_xref="GI:227818677"
                     /db_xref="GeneID:7788172"
                     /translation="MTVYALHGMTGIFGPARAVTALSGVRIPERRFVERVIPTEADDN
                     TLLLLDFGSGLFAKVYGTAAGAVKHSLDFSGTYFGTQGKIEGLKLNGEYFDYPGREIA
                     VTAPDGGTQPGFGGNEWILPNVEGVHRTIGEQHVFADLMQLVDWVREGKRSVATAEHA
                     RHVVEIIEAAYKSAATGQRQTLQTSF"
     misc_feature    complement(432296..>432844)
                     /locus_tag="NGR_b04320"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     gene            complement(433087..433410)
                     /locus_tag="NGR_b04330"
                     /db_xref="GeneID:7788173"
     CDS             complement(433087..433410)
                     /locus_tag="NGR_b04330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822649.1"
                     /db_xref="GI:227818678"
                     /db_xref="GeneID:7788173"
                     /translation="MKAPLKFGVVGCETVSLRGLIPHLAQDDIADRVQLTALCDPISD
                     RVEHAAHEYGVPHAFSSFDDFLERGDVDAITIASPIGLHFEQGMKALNAGKHVHFNKT
                     MSVTT"
     misc_feature    complement(<433120..433401)
                     /locus_tag="NGR_b04330"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    complement(433093..433398)
                     /locus_tag="NGR_b04330"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     gene            complement(433444..434181)
                     /gene="fabG1"
                     /locus_tag="NGR_b04340"
                     /db_xref="GeneID:7788174"
     CDS             complement(433444..434181)
                     /gene="fabG1"
                     /locus_tag="NGR_b04340"
                     /EC_number="1.1.1.100"
                     /note="3-ketoacyl-acyl carrier protein reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_002822650.1"
                     /db_xref="GI:227818679"
                     /db_xref="GeneID:7788174"
                     /translation="MKVALVTGASRGLGAVMAQELASAGWAVAVNYASDTAGAESVAA
                     KIRDGGGRAHAARFSVIDQSEITRGIEEIKNSLGPVDLIVNNATGPQPEMPLMEQSWR
                     TYLDQLEFFVKAPLEMLQAVLPDWRERKAGRVINIGSEIAELGNPYFGNYASAKGAML
                     SMTRSWAKELAPEGITVNLVAPGWIPVERHAESPKERIDWYLDRTPAGHFGTPADIAH
                     MVVFLASEKADFITGQKLAVNGGRTLL"
     misc_feature    complement(433450..434178)
                     /gene="fabG1"
                     /locus_tag="NGR_b04340"
                     /note="putative beta-ketoacyl acyl carrier protein
                     [ACP]reductase (BKR), subgroup 2, classical (c) SDR;
                     Region: BKR_2_SDR_c; cd05349"
                     /db_xref="CDD:187607"
     misc_feature    complement(433459..434178)
                     /gene="fabG1"
                     /locus_tag="NGR_b04340"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05557"
                     /db_xref="CDD:235500"
     misc_feature    complement(order(433618..433623,433627..433638,
                     433714..433716,433726..433728,433765..433773,
                     433852..433854,433918..433926,434002..434010,
                     434080..434088,434143..434154,434158..434160))
                     /gene="fabG1"
                     /locus_tag="NGR_b04340"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187607"
     misc_feature    complement(order(433714..433716,433726..433728,
                     433765..433767,433849..433851))
                     /gene="fabG1"
                     /locus_tag="NGR_b04340"
                     /note="active site"
                     /db_xref="CDD:187607"
     gene            complement(434208..435215)
                     /gene="idhA1"
                     /locus_tag="NGR_b04350"
                     /db_xref="GeneID:7788175"
     CDS             complement(434208..435215)
                     /gene="idhA1"
                     /locus_tag="NGR_b04350"
                     /EC_number="1.1.1.18"
                     /codon_start=1
                     /transl_table=11
                     /product="myo-inositol 2-dehydrogenase"
                     /protein_id="YP_002822651.1"
                     /db_xref="GI:227818680"
                     /db_xref="GeneID:7788175"
                     /translation="MFTKQSHLRVAVFGAGRMGAIHAATLVRRSDACLAGIVDAHLPS
                     AERLAAEHGVRVLEEDAVFDDEDVDAVVIASAADSHPHLILRSVAARKAIFCEKPLAR
                     DLEAVQSVAKVVEATKLPFLLAFNRRFDPDFVALASRLRGGEIGAVELAILTSRDPSP
                     PPIDYVVKSGGVFRETTIHDIDVARWLTGEEPISVHATASALTTVAMKEAKLPDTVVV
                     TMTMPSGAIVSINNSWRAAYGYDQRVEVLGELGMLKLANRLQNGVTQMGASGTWKSNP
                     EPFFLERYANAYNAELDYFISALWEGRTISPGVADGVKALQIAYAAEQSARTGQTVTL
                     G"
     misc_feature    complement(434214..435194)
                     /gene="idhA1"
                     /locus_tag="NGR_b04350"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    complement(434841..435194)
                     /gene="idhA1"
                     /locus_tag="NGR_b04350"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    complement(434481..434795)
                     /gene="idhA1"
                     /locus_tag="NGR_b04350"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            complement(435227..436228)
                     /locus_tag="NGR_b04360"
                     /db_xref="GeneID:7788176"
     CDS             complement(435227..436228)
                     /locus_tag="NGR_b04360"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter permease"
                     /protein_id="YP_002822652.1"
                     /db_xref="GI:227818681"
                     /db_xref="GeneID:7788176"
                     /translation="MNFIQMATSYNSRERKSEFKRISSRRLLRMLVVPLVTLLLICAV
                     ITFFQPRFLSLRALTAVATDAAPLLMLVVGSAVVILIGGIDLSVATMASFSAVLLVII
                     SPTTGDLGIVVVLSLAAFIGYLQGVIHHRAQIPSFVVSFGTLGVLYGTAHYITQATAA
                     PLGSSLIIPFLGAKTAGVPHGLVVAVLCAVGLSLTLRFTRLGRDLFAVGSSERAALVA
                     GVKVGPVKAIAFALSSFFAAGAGLMFLSQTGYSSPAMANNYLLPAIVGVVVGGNAISG
                     GVGGVGCALIGGLIAVMVRLGTVMLGLNPAFQNILFGIMVLVSVALTIDREKIGIIK"
     misc_feature    complement(435260..436036)
                     /locus_tag="NGR_b04360"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(435536..435592)
                     /locus_tag="NGR_b04360"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(436225..437742)
                     /locus_tag="NGR_b04370"
                     /db_xref="GeneID:7788177"
     CDS             complement(436225..437742)
                     /locus_tag="NGR_b04370"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter ATP-binding protein"
                     /protein_id="YP_002822653.1"
                     /db_xref="GI:227818682"
                     /db_xref="GeneID:7788177"
                     /translation="MSVLAARHVSKSYPGVRALADVSMELRENEILGLIGQNGSGKST
                     LLKIFTGVEQPTEGSLLLRGQQTIIRSPLAAAALGIGMVHQEQSLITNLTVAENIFFD
                     KHALGKRYGFYNWRSLNKAAERQLAKLECEIPPDLKVEKLSFPERQLVEFAKVLAVEE
                     LIDDQLVILFDEPTSLLSPSEIEGLFRQIRRLKERASIVFVSHRMDEVLEISDRVHVM
                     SNGENVAERTPSETDHKELYHLMVGSRRSEDYFLEERRRPTSAAPPRLETHRLSAPGA
                     FKDVSFAIRQGEILALTGVAGSGAEEFCRALFGLEEGVTGKIIFNGKEHPVDARPSDL
                     IAEGIGYVAAERKLEGVVTGRTIVDNIVLSFGSKLGKGLFIDRDREISSALHWIARLK
                     VKTPNAAEYVERLSGGNQQKVSLAKWLLSENLQLLILDHPTRGLDPGAKADLFEAIRD
                     LSDQGISILFVSETLEETLGMADTIVVMRDGQVSATFSDLFHAKPAPEAIVEAMV"
     misc_feature    complement(436231..437742)
                     /locus_tag="NGR_b04370"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    complement(437065..437733)
                     /locus_tag="NGR_b04370"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(437614..437637)
                     /locus_tag="NGR_b04370"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(437134..437136,437227..437232,
                     437488..437490,437611..437619,437623..437628))
                     /locus_tag="NGR_b04370"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(437488..437499)
                     /locus_tag="NGR_b04370"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(437290..437319)
                     /locus_tag="NGR_b04370"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(437227..437244)
                     /locus_tag="NGR_b04370"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(437209..437220)
                     /locus_tag="NGR_b04370"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(437128..437148)
                     /locus_tag="NGR_b04370"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(436294..436959)
                     /locus_tag="NGR_b04370"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(437739..438776)
                     /locus_tag="NGR_b04380"
                     /db_xref="GeneID:7788178"
     CDS             complement(437739..438776)
                     /locus_tag="NGR_b04380"
                     /codon_start=1
                     /transl_table=11
                     /product="Ribose/xylose/arabinose/galactoside ABC-type
                     transport system, permease components AraH"
                     /protein_id="YP_002822654.1"
                     /db_xref="GI:227818683"
                     /db_xref="GeneID:7788178"
                     /translation="MAQLPSTAASIAPRYDEGRLFSGTTEKAMKINIKELGPAFTLVV
                     LALAFSILSAQFFSMSNVQAILESAAIPVVLAVGITFIIVQGSIDLSIEGVMAASSMA
                     VALLIANSITTFDYGWLAIAAGPVFGLAFGLSNGLLYTYLRLPSLIVTLATWFIGLGV
                     ATLLFPGRQPEILDGRITMLAIYKPFGLSFLVCIAFVVATIGVVLQNYSQFGRMSFAI
                     GIDEKTTRLSGNSVRLHKILAFSFMGVLAGMGGAMISAQLAVGNPSAGQGFLFPTISA
                     AVIGGTLLSGGKGGVLHSVNGVLILEVLRNGMVQLGVDPYLRHVVEGIIIIAALVVGN
                     WQLRARTRVVK"
     misc_feature    complement(437781..438572)
                     /locus_tag="NGR_b04380"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(438054..438110)
                     /locus_tag="NGR_b04380"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(438790..439854)
                     /locus_tag="NGR_b04390"
                     /db_xref="GeneID:7788179"
     CDS             complement(438790..439854)
                     /locus_tag="NGR_b04390"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC transporter ribose-binding protein"
                     /protein_id="YP_002822655.1"
                     /db_xref="GI:227818684"
                     /db_xref="GeneID:7788179"
                     /translation="MRKLTMALVSSVAALALAASAHANDVGDVYLGVGSASSEYWAAY
                     IEGAKAVASSLGKDVNVIPSEFDGQKLLEQFGAVFAAGCEDCVVTVDPASNAFTKAMI
                     ERADTAGAKYVNLWNRPDEIHPWDTVPNTWIANISFDGVDSGYQNGMALCNALGGKGN
                     IVALNGIPDNPPAKQRIAGLHKALQECPGLKLLDTQVGNWDQTQGQSITRAWLAKYGD
                     ELNGIFSANDGMALGAVAALREKGLVGKILVTGSDGSSDVIKLIEKGEMLSTMHIDGY
                     VQGAYAVALAAAAVKGDIKMDELKQDQRDFFLSQTLVTKDNAASVLNSKKDASQFSYD
                     ALKGNFWAASVGQIPAGANK"
     misc_feature    complement(439018..439770)
                     /locus_tag="NGR_b04390"
                     /note="Periplasmic sugar-binding domain of active
                     transport systems that are members of the type I
                     periplasmic binding protein (PBP1) superfamily; Region:
                     PBP1_ABC_sugar_binding_like; cd01536"
                     /db_xref="CDD:107249"
     misc_feature    complement(439018..439770)
                     /locus_tag="NGR_b04390"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    complement(order(439036..439038,439096..439098,
                     439327..439329,439507..439509,439735..439737))
                     /locus_tag="NGR_b04390"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107249"
     gene            complement(440278..441351)
                     /locus_tag="NGR_b04400"
                     /db_xref="GeneID:7788180"
     CDS             complement(440278..441351)
                     /locus_tag="NGR_b04400"
                     /codon_start=1
                     /transl_table=11
                     /product="PurR family transcriptional regulator"
                     /protein_id="YP_002822656.1"
                     /db_xref="GI:227818685"
                     /db_xref="GeneID:7788180"
                     /translation="MDVSLSMARIWCYEVIASFHRLSEKLSMELRMKPTAKQVAHAAG
                     VSVAAVSRAFSPGAPIEAGKKKRILAAAEEIGYVSPARRTANVIAAGTITLVSGDLLN
                     PFYPTVVDTLAHSLQESGRQLIVYALPAHANVDLATDQVLASRPSAIIVTSAQLTSRM
                     TRACRQHQIKVVLLNRVQRDIRINAVACDNYQGGRDAGRILLDRGRRKIGFIGGIANT
                     STHAERLRGFRDVLAEAGLSIHAQTSGEFDYQRGYRAGETLMSANDPPDAIFCCNDIM
                     ALALIDVARQRGIRVPEDVAVVGFDDIPMASWNAYRLTTIRQPVERMVQEALSLIVDP
                     AIKPGDDGITRMFSGLLIRRDSA"
     misc_feature    complement(440284..441252)
                     /locus_tag="NGR_b04400"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(<441118..441243)
                     /locus_tag="NGR_b04400"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(441121..441123,441160..441162,
                     441169..441174,441187..441189,441196..441201,
                     441205..441219,441241..441243))
                     /locus_tag="NGR_b04400"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(440284..441078)
                     /locus_tag="NGR_b04400"
                     /note="Ligand-binding domain of uncharacterized
                     DNA-binding regulatory proteins that are members of the
                     LacI-GalR family of bacterial transcription repressors;
                     Region: PBP1_LacI_like_2; cd06278"
                     /db_xref="CDD:107273"
     misc_feature    complement(order(440494..440499,440506..440508,
                     440518..440520,440602..440604,440917..440925,
                     440932..440934,440941..440943,440971..440973,
                     440977..440991,441010..441015,441019..441024,
                     441031..441039,441076..441078))
                     /locus_tag="NGR_b04400"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107273"
     misc_feature    complement(order(440398..440400,440449..440451,
                     440611..440613,440680..440682,440788..440790,
                     440827..440829,440896..440898,441028..441030,
                     441037..441042))
                     /locus_tag="NGR_b04400"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107273"
     gene            441350..442660
                     /locus_tag="NGR_b04410"
                     /db_xref="GeneID:7788181"
     CDS             441350..442660
                     /locus_tag="NGR_b04410"
                     /note="catalyzes the oxidation of L-histidinol to
                     L-histidinaldehyde and then to L-histidine in histidine
                     biosynthesis; functions as a dimer"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="YP_002822657.1"
                     /db_xref="GI:227818686"
                     /db_xref="GeneID:7788181"
                     /translation="MAITYLKRGKPEAARSEDDAKVRTTVEGILKDIETRGDAAVREL
                     SEKFDRYSPPSFRLSEGEIEVLMNKVSARDMEDIRFAQRQVRTFAQAQRDSMRNIEVE
                     TLPGVILGHRNIPVQSVGCYIPGGKFPMVASAHMSVATASVAGVPRIIAATPPFKGEP
                     NPAVIAAMKLGGAHEIYVMGGIQAIGAMAIGTETIKPVDMLVGPGNAFVAEAKRQLYG
                     RVGIDLFAGPTETMVIADDTVDAEICATDLLGQAEHGYNSPAVLLTNSRKLADATLVE
                     IDRLLSILPTADTARRSWEDYGEIIVCHTHKEMLEVANDIASEHVQVMTDRDDWYLQN
                     MHSYGALFLGARTNVANGDKVIGTNHTLPTKKAGRYTGGLWVGKYLKTHSYQKVLTDE
                     AAALIGAYGSRLCMLEGFVGHAEQCNVRVRRYGGRNVGYGQAAE"
     misc_feature    441413..442588
                     /locus_tag="NGR_b04410"
                     /note="Histidinol dehydrogenase, HisD, E.C 1.1.1.23.
                     Histidinol dehydrogenase catalyzes the last two steps in
                     the L-histidine biosynthesis pathway, which is conserved
                     in bacteria, archaea, fungi, and plants. These last two
                     steps are (i) the NAD-dependent...; Region: Histidinol_dh;
                     cd06572"
                     /db_xref="CDD:119329"
     misc_feature    441425..442615
                     /locus_tag="NGR_b04410"
                     /note="histidinol dehydrogenase; Region: hisD; TIGR00069"
                     /db_xref="CDD:232808"
     misc_feature    order(441491..441493,441713..441715,441719..441724,
                     441746..441748,441809..441811,441887..441892,
                     441896..441898,441959..441967,441971..441976,
                     442109..442111)
                     /locus_tag="NGR_b04410"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(441566..441571,441578..441583,441587..441589,
                     441596..441601,441608..441613,441620..441625,
                     441650..441652,441656..441658,441668..441682,
                     441689..441691,441695..441697,441731..441745,
                     441944..441946,441989..441991,442001..442003,
                     442073..442078,442085..442090,442094..442102,
                     442106..442111,442319..442321,442334..442336,
                     442343..442348,442352..442378,442382..442384,
                     442388..442393,442397..442411,442415..442417,
                     442421..442423,442451..442456,442460..442474,
                     442478..442483,442490..442510,442514..442516,
                     442559..442564,442568..442588)
                     /locus_tag="NGR_b04410"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(441737..441739,441743..441745,442034..442036,
                     442109..442111,442304..442309,442394..442396,
                     442406..442411,442427..442429,442571..442573,
                     442577..442579,442586..442588)
                     /locus_tag="NGR_b04410"
                     /note="product binding site; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(441743..441745,442034..442036,442100..442102,
                     442109..442111,442304..442309,442394..442396,
                     442406..442411,442427..442429,442571..442573,
                     442577..442579,442586..442588)
                     /locus_tag="NGR_b04410"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(442100..442102,442109..442111,442406..442408,
                     442586..442588)
                     /locus_tag="NGR_b04410"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    442304..442309
                     /locus_tag="NGR_b04410"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:119329"
     gene            complement(442669..443847)
                     /locus_tag="NGR_b04420"
                     /db_xref="GeneID:7788182"
     CDS             complement(442669..443847)
                     /locus_tag="NGR_b04420"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase for insertion sequence NGRIS-14a"
                     /protein_id="YP_002822658.1"
                     /db_xref="GI:227818687"
                     /db_xref="GeneID:7788182"
                     /translation="MEIYVGIDVAKETHWACALDARAQVLLDRAVDNDQAAIERFVAD
                     LRGLGGDVVVGLDITGSLARFLEAILLAEGLRLVHVPGIAVNRAGQGFPGGESKSDPR
                     DARTIAELVRTRDLRPILPDDETAIALRLKVTRRRELSDDQTRRISRMRQLLGAIHPG
                     LERRLDLTAKGPLVLVTRYVTPTEIRRAGLKRLMAHLKRTPHLHAVEALAQRALEAAE
                     GQSIAVPGEASFADMIRELAAEALRAREAIARIDRDLEALLERHPDGALIRSLPGMGA
                     VLSAELIANIGTIERFHSADALASAAGLTPVIRQSGKSRNWRRAFGGDKALKRVFFQS
                     AFCAVSTRDPLSKAFYDRKRREGKHHTQAIIALARRRVTVLWTMLRTRQTFDPTQKAA
                     "
     misc_feature    complement(443401..443838)
                     /locus_tag="NGR_b04420"
                     /note="Transposase; Region: DEDD_Tnp_IS110; pfam01548"
                     /db_xref="CDD:250699"
     misc_feature    complement(442711..>443316)
                     /locus_tag="NGR_b04420"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     misc_feature    complement(442795..443052)
                     /locus_tag="NGR_b04420"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     gene            444068..444841
                     /locus_tag="NGR_b04430"
                     /db_xref="GeneID:7788183"
     CDS             444068..444841
                     /locus_tag="NGR_b04430"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_002822659.1"
                     /db_xref="GI:227818688"
                     /db_xref="GeneID:7788183"
                     /translation="MTSSALPRTPSFRLDGKTALVVGASSGIGQAAAVALAEAGANVT
                     LAARSIDKLERTVEALQHMELSATALALDVEDVEATELTIESGAAFDILVNSAGLACH
                     GPALETTIADFDTVMGINVRGAYFVTRAVARKLVATGRTGSLINISSQMAHVGGIDRA
                     VYSATKHAVEGFTKSMAIEWGMHGIRVNTICPTFIRTPLAERTFANPERVRWIEEKIK
                     LGRIGELEDIMGPVTFLASEAAAMITGSALMVDGGWTAD"
     misc_feature    444098..444835
                     /locus_tag="NGR_b04430"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK07060"
                     /db_xref="CDD:180817"
     misc_feature    444101..444835
                     /locus_tag="NGR_b04430"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(444134..444136,444140..444145,444149..444151,
                     444206..444214,444353..444361,444506..444514,
                     444551..444553,444563..444565,444641..444652)
                     /locus_tag="NGR_b04430"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(444425..444427,444512..444514,444551..444553,
                     444563..444565)
                     /locus_tag="NGR_b04430"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            444864..446438
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /db_xref="GeneID:7788184"
     CDS             444864..446438
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="forms a tetramer composed of 2 alpha subunits and 2
                     beta subunits in the inner membrane; involved in
                     catalyzing transfer of hydride ion equivalents between NAD
                     and NADP; stereospecific (AB-specific); functions as a
                     proton pump by translocating protons from cytoplasm to
                     periplasm"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P) transhydrogenase subunit alpha"
                     /protein_id="YP_002822660.1"
                     /db_xref="GI:227818689"
                     /db_xref="GeneID:7788184"
                     /translation="MKIATPSEVFGGEARVAMTPDSALHLQKLGYECLIETGAGKLAG
                     YSDDAYRAAGVKVVEDPSALYAAGDVIAKVRPPEPSEVAHLLPGQTLISFFYPAQNNE
                     LLELARSNGANIIAMDMVPRISRAQKMDALSSMANIAGYRAVIEAGSNFGRFFTGQVT
                     AAGKVPPAKVLIIGAGVAGLAAIGTATSLGAVTYAFDVRPEVAEQIESMGAEFVYLDF
                     PDQQQDGAATGGYAAPSSPEFREKQLAKFREMAPEIDIVITTALIPGRAAPKLWLADM
                     VAAMKPGSVVVDLAAERGGNCDLTVPDQKVVSANGVTVIGYTDFPSRMAAQASTLYAT
                     NVRHMVSDLTPAKDGVIVHNMDDDVIRGATVTKDGEITYPPPPPKIQAIAAQKPREKV
                     KELTPEEKRAAEVAAFKAQTKTQGILLFVATALLLVVGAVAPASFMGHFVVFVLSCFV
                     GFQVIWNVSHSLHTPLMAVTNAVSGIVILGALLQIGSGNWLVVTLAALSVLVATINIV
                     GGFLVTRRMLAMFQKS"
     misc_feature    444864..446432
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="NAD(P) transhydrogenase subunit alpha; Provisional;
                     Region: pntA; PRK09424"
                     /db_xref="CDD:236507"
     misc_feature    444864..445970
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="Rubrum transdehydrogenase NAD-binding and catalytic
                     domains; Region: Rubrum_tdh; cd05304"
                     /db_xref="CDD:240629"
     misc_feature    order(444906..444908,445086..445088,445143..445145,
                     445737..445739,445818..445820,445824..445826)
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(444993..444995,445242..445247,445272..445277,
                     445284..445289,445296..445301,445305..445310,
                     445314..445331,445335..445337,445341..445349,
                     445356..445358,445425..445430,445707..445712,
                     445839..445844,445854..445856,445863..445868)
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(445227..445232,445242..445244,445251..445253,
                     445260..445262,445383..445394,445452..445460,
                     445557..445559,445590..445592,445641..445649,
                     445668..445670,445674..445676)
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:240629"
     misc_feature    order(445233..445238,445242..445244,445272..445274,
                     445401..445406,445425..445427,445473..445478,
                     445482..445493)
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="trimer interface B [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    order(445332..445346,445353..445355,445362..445364,
                     445431..445433,445437..445439)
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="trimer interface A [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240629"
     misc_feature    446175..446432
                     /gene="pntA"
                     /locus_tag="NGR_b04440"
                     /note="Domain of unknown function (DUF3814); Region:
                     DUF3814; pfam12769"
                     /db_xref="CDD:257285"
     gene            446455..447900
                     /locus_tag="NGR_b04450"
                     /db_xref="GeneID:7788185"
     CDS             446455..447900
                     /locus_tag="NGR_b04450"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP transhydrogenase subunit beta PntB"
                     /protein_id="YP_002822661.1"
                     /db_xref="GI:227818690"
                     /db_xref="GeneID:7788185"
                     /translation="MTIGIVSAAYISAAVLFILSLGGLSGQESAKRAVWYGIAGMALA
                     VVATVFGPMIDKSVGTWFIILLMIAGGSVLGTYVARRVQMTEMPQLVAALHSFVGLAA
                     VFIGFNAHIEAGQVAGMDEAARAALSGFAGILAHKTPVELAIMKVEVFLGVFIGAVTF
                     TGSVIAFGKLAGKVEGKAKKLPGGHFLNAGAVGLSLALLVLYFYGADVWALVAMTALA
                     FFIGYHLIMGIGGADMPVVVSMLNSYSGWAAAAIGFTLGNDLLIVTGALVGSSGAILS
                     YIMCKAMNRSFVSVIFGGFGATSGPQMQIAGEQIAIDTDGVAAALNDADSIIIVPGYG
                     MAVAQAQQSVSELTRKLRASGKTVRFAIHPVAGRLPGHMNVLLAEAKVPYDIVLEMDE
                     INEDFPNTDVVIVVGSNDIVNPAAQEDPNSPIAGMPVLEVWKAKQVFVSKRGQGTGYS
                     GIENPLFYKDNARMFYGDAKKSIDLLLPTIV"
     misc_feature    446455..447885
                     /locus_tag="NGR_b04450"
                     /note="NAD(P) transhydrogenase beta subunit; Region: PNTB;
                     cl00566"
                     /db_xref="CDD:260503"
     gene            complement(448029..449129)
                     /locus_tag="NGR_b04460"
                     /db_xref="GeneID:7788186"
     CDS             complement(448029..449129)
                     /locus_tag="NGR_b04460"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator PurR"
                     /protein_id="YP_002822662.1"
                     /db_xref="GI:227818691"
                     /db_xref="GeneID:7788186"
                     /translation="MLFSDSIRIQRIGRELKKSAKALDSGPSRKKYASSIDVARLAGV
                     SQSAVSRTFTEGASVSAKTREKVMKAADELGYGPSIIPKIMLTHKSSLIAIVSGGLYN
                     PFYAGVVEKLSHAVQKSGSNVMLFSVNHGEYIDEIIPDILSYRVDGIVSALSIVSAEA
                     AERCAKMHTPVVLFNNKLSNEWVASICSDNVEGGRQIAALFLKRGARRFAYIGGKKGN
                     LASEDRFAGYLSGLMQNGISDVAMAYGDFRHDEAFIAAKKLLSSRKPPDAIFCANDLM
                     AIGAMEAVKALGLSVPDDVLVAGFDDIPAAAWPSFDLTTVRQDGDAMIGRAMDQLARM
                     VDGEHLAGNSLHLIQAPLVERGSTAREPRKAE"
     misc_feature    complement(448050..449021)
                     /locus_tag="NGR_b04460"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    complement(448893..449021)
                     /locus_tag="NGR_b04460"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    complement(order(448893..448895,448902..448904,
                     448941..448943,448950..448955,448968..448970,
                     448977..448982,448986..449000))
                     /locus_tag="NGR_b04460"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(448059..448856)
                     /locus_tag="NGR_b04460"
                     /note="Ligand-binding domain of uncharacterized
                     DNA-binding regulatory proteins that are members of the
                     LacI-GalR family of bacterial transcription repressors;
                     Region: PBP1_LacI_like_2; cd06278"
                     /db_xref="CDD:107273"
     misc_feature    complement(order(448275..448277,448284..448286,
                     448296..448298,448380..448382,448695..448703,
                     448710..448712,448719..448721,448749..448751,
                     448755..448769,448788..448793,448797..448802,
                     448809..448817,448854..448856))
                     /locus_tag="NGR_b04460"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107273"
     misc_feature    complement(order(448176..448178,448227..448229,
                     448389..448391,448458..448460,448566..448568,
                     448605..448607,448674..448676,448806..448808,
                     448815..448820))
                     /locus_tag="NGR_b04460"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107273"
     gene            449203..450138
                     /locus_tag="NGR_b04470"
                     /db_xref="GeneID:7788187"
     CDS             449203..450138
                     /locus_tag="NGR_b04470"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate isomerase/epimerase IoIE"
                     /protein_id="YP_002822663.1"
                     /db_xref="GI:227818692"
                     /db_xref="GeneID:7788187"
                     /translation="MVARPANGPLENGGFPMHVKLANAPVSWGVDYADDAKNPPWPKI
                     MDEIAEAGYSYTELGPYGFYPTEPKRLASEFQSRGLTVEAGFVFQILHDPAKTDTVLD
                     NAARTVQLLSAVGGRYLVTIDHISEERMATAGRRDLAKKLSESQFEHMIGLIDRIADI
                     ALAAGVKPVVHQHAGCYIEFEDEIEGVLQRLDPERVGICIDTGHMAYAGIDPVAFYER
                     HAKRVQYFHFKDIDPEVHKRVLAEKVPFLAAVEQKIFCPMGVGVVDWEKLAKAFKTYG
                     YDGAANIEQDIDPTISFDPLGDARKSLAYLKSAGF"
     misc_feature    449296..450123
                     /locus_tag="NGR_b04470"
                     /note="Sugar phosphate isomerases/epimerases [Carbohydrate
                     transport and metabolism]; Region: IolE; COG1082"
                     /db_xref="CDD:224007"
     misc_feature    449335..449916
                     /locus_tag="NGR_b04470"
                     /note="Xylose isomerase-like TIM barrel; Region:
                     AP_endonuc_2; pfam01261"
                     /db_xref="CDD:250484"
     gene            450221..451114
                     /locus_tag="NGR_b04480"
                     /db_xref="GeneID:7788188"
     CDS             450221..451114
                     /locus_tag="NGR_b04480"
                     /codon_start=1
                     /transl_table=11
                     /product="RbsB, ABC-type sugar transport system,
                     periplasmic component"
                     /protein_id="YP_002822664.1"
                     /db_xref="GI:227818693"
                     /db_xref="GeneID:7788188"
                     /translation="MSKKLKFYAVTHDILGDVFWEVFRRGLLDAAARFDVDVEHLRPG
                     KFSPEIQAGLIDGARHARPDGIISTVPDVAAVEGALKAAIADGIPVICVNAKDSRPEG
                     ERIPYLFYIGGDDFNAGELAGRYLLEHVKPRAAMCVDHYLYQHICHSDRWHGFKSAFD
                     KAGVPAERLRVPGGQPEECAEAVAKYMESNPNVDAVLTLGPPGAQAVLDAEAIVGAGR
                     TWKHLTFDVAQLQLDGIRSGRIMATIDSQQYLQGFLAVQHMWMHKTQGFTLAADIYTG
                     PAIVDLSNIDEAEQGVKAGTR"
     misc_feature    450236..451060
                     /locus_tag="NGR_b04480"
                     /note="Periplasmic sugar-binding domain of uncharacterized
                     ABC-type transport systems; Region:
                     PBP1_ABC_sugar_binding_like_4; cd06312"
                     /db_xref="CDD:107307"
     misc_feature    450266..451006
                     /locus_tag="NGR_b04480"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    order(450275..450277,450500..450502,450671..450673,
                     450896..450898,450956..450958)
                     /locus_tag="NGR_b04480"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107307"
     gene            complement(451152..452024)
                     /locus_tag="NGR_b04490"
                     /db_xref="GeneID:7788189"
     CDS             complement(451152..452024)
                     /locus_tag="NGR_b04490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822665.1"
                     /db_xref="GI:227818694"
                     /db_xref="GeneID:7788189"
                     /translation="MSLEPKLLLAAQTELGECPVWDPDRNTLFFMDIIGKKLHAYEWS
                     SGNDRVLELPALGGALALAKDGRLIAGLQNGIHMIEPESGAIEFVTDPEPNKPDHRLN
                     EGKCDPEGRFWIGSISTLGRFPSGCLYRLEKDGSVSEVLSEVSVPNTMAWLPDSKGMV
                     FADSVTKQVWRFQYDAGTGAISNREVFIDVSDFTGIPDGVAIDSEGGLWIAEFGGAAV
                     HHFSAEGKRIGRVILPATQVTSCVFAGPDLQHLVIITTKRLLDESGRKAQPHSGDLFV
                     VEPGVRGLQPHLFG"
     misc_feature    complement(451254..451982)
                     /locus_tag="NGR_b04490"
                     /note="SMP-30/Gluconolaconase/LRE-like region; Region:
                     SGL; pfam08450"
                     /db_xref="CDD:254808"
     gene            complement(452035..453912)
                     /locus_tag="NGR_b04500"
                     /db_xref="GeneID:7788190"
     CDS             complement(452035..453912)
                     /locus_tag="NGR_b04500"
                     /codon_start=1
                     /transl_table=11
                     /product="myo-inositol catabolism protein IolD"
                     /protein_id="YP_002822666.1"
                     /db_xref="GI:227818695"
                     /db_xref="GeneID:7788190"
                     /translation="MSSTIRLTAAQATIKYLQKQYSVFDGKRERLIGGIFGIFGHGNV
                     ASISQAIEEYGEELPYYQPKNEQAMVHAAMGYAKMKNRRATLACTASIGPGSTNMITG
                     AATATVNRIPVLLFASDTFAHRRTGNVLQQLEHPVDGDLTVNDCFRPISRFFDRISRP
                     EQILTALPEAMRVLTDPADTGAVTISFPQDVEGEAYDYPVEFFRERNWVIRRRDPSQD
                     DVNEAIAALSQAHAPLIIAGGGVRYSAAERALRDFANQFGIPVAETHAGKGVSLDTPL
                     CLGGMGVTGTGAAGRIAERADVVVAIGTRLQDFQTGSRSAFHAPNVTFVSINTNSYDA
                     HKLRGVPVVGDARLSIERIAAGLREAGYSTASTYRDEIKSRQREWKEAYRNDIAVPPG
                     GELNQGTIVRIVNESTRAGDVVIAAAGTPPGEIHKAWDNSNGSKAFLEFGFSTMGHEI
                     PAAIGARLANRSDEEIFVIIGDGTYLMGPTEIVTAVQENAKITVVVIENYGYQCIRDL
                     QENSTGIDNLGNEFRARDNDVLRPNGSYLEVDYAANARSMGAAVLSASDEEQFKDALA
                     KARDVRGPTVIVVKAEKRGRSIGSGVWWDVGASEVTNTKSVSDATTKFRAGERNQRYL
                     G"
     misc_feature    complement(452083..453912)
                     /locus_tag="NGR_b04500"
                     /note="Acetolactate synthase [Amino acid transport and
                     metabolism]; Region: COG3962"
                     /db_xref="CDD:226471"
     misc_feature    complement(453346..453753)
                     /locus_tag="NGR_b04500"
                     /note="Pyrimidine (PYR) binding domain of POX and related
                     proteins; Region: TPP_PYR_POX_like; cd07035"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(453586..453591,453598..453600,
                     453610..453612,453631..453633,453673..453681,
                     453685..453690,453697..453702,453709..453711,
                     453718..453738))
                     /locus_tag="NGR_b04500"
                     /note="PYR/PP interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(453466..453468,453475..453477,
                     453601..453603,453610..453615,453619..453624,
                     453631..453633,453712..453714,453718..453729,
                     453733..453735))
                     /locus_tag="NGR_b04500"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(order(453619..453621,453631..453633,
                     453715..453717))
                     /locus_tag="NGR_b04500"
                     /note="TPP binding site [chemical binding]; other site"
                     /db_xref="CDD:132918"
     misc_feature    complement(452854..453255)
                     /locus_tag="NGR_b04500"
                     /note="Thiamine pyrophosphate enzyme, central domain;
                     Region: TPP_enzyme_M; pfam00205"
                     /db_xref="CDD:249676"
     misc_feature    complement(452104..452724)
                     /locus_tag="NGR_b04500"
                     /note="Thiamine pyrophosphate (TPP) family, IolD
                     subfamily, TPP-binding module; composed of proteins
                     similar to Rhizobium leguminosarum bv. viciae IolD. IolD
                     plays an important role in myo-inositol catabolism;
                     Region: TPP_IolD; cd02003"
                     /db_xref="CDD:238961"
     misc_feature    complement(order(452410..452412,452416..452418,
                     452491..452502,452575..452577))
                     /locus_tag="NGR_b04500"
                     /note="TPP-binding site; other site"
                     /db_xref="CDD:238961"
     gene            454040..454813
                     /locus_tag="NGR_b04510"
                     /db_xref="GeneID:7788191"
     CDS             454040..454813
                     /locus_tag="NGR_b04510"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="YP_002822667.1"
                     /db_xref="GI:227818696"
                     /db_xref="GeneID:7788191"
                     /translation="MEACFHGGRRKQAMQRFANKVALVTGASTGIGLETIKRIREEGG
                     TVFAAHRRGKIDIEGVASISLDVTDEGNWTRAISKVVSAAGRLDILINNAGVRESGSV
                     EETSLEQWRRLIDTNLTSIFLGCRAAVPAIRQAGGGAIVNVGSITGIRGTENMVAYSA
                     SKSGITSMTSSLALDLASDNIRVNAVCPAAIRTRMVTNWLNSSQDTDAAEAAVLAKHP
                     IGRIGRPDEVASVIAFLASDDSSFMTGMSIPVDGGRSIR"
     misc_feature    454082..454804
                     /locus_tag="NGR_b04510"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    454103..454792
                     /locus_tag="NGR_b04510"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(454115..454117,454121..454132,454187..454195,
                     454232..454240,454316..454324,454385..454387,
                     454466..454474,454511..454513,454523..454525,
                     454601..454612,454616..454621)
                     /locus_tag="NGR_b04510"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(454388..454390,454472..454474,454511..454513,
                     454523..454525)
                     /locus_tag="NGR_b04510"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            454840..455982
                     /locus_tag="NGR_b04520"
                     /db_xref="GeneID:7788192"
     CDS             454840..455982
                     /locus_tag="NGR_b04520"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="YP_002822668.1"
                     /db_xref="GI:227818697"
                     /db_xref="GeneID:7788192"
                     /translation="MEKIRFGIVGSGYMAKLHSLALRNIGAYLWPKLPRIEMVRMADI
                     VPEAAKEGAERWGWQSHTSDWKEVTRADDIDVVIIITPNDSHADIAIDAFSHGKHVFC
                     EKPLSNTVAEAERMTEAARASGKVNLVNFSYRTWPGIELARQLIREGELGEVLHFEGH
                     FFQDYAADPALPFSWRFDKPVSGGGAFGDIGSHIMDIASALMGPVESITAKTRRLYEK
                     RPVNGPDAKQVTVDDLTASLVQFSNGALGSVHASWAAAGHKSDLSFSVTGTKGALSFS
                     WERNNELHFFSAADPQRVGGFRRIMLGGIHPEADPFWYAQGQGLGYGEAFVVTARRAI
                     EAVIDANPNAAPNFAQALHINRVIAGAFQAAEEDRWVKIEKTSAFD"
     misc_feature    454840..455961
                     /locus_tag="NGR_b04520"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    454849..455232
                     /locus_tag="NGR_b04520"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    455266..455610
                     /locus_tag="NGR_b04520"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            456125..457111
                     /locus_tag="NGR_b04530"
                     /db_xref="GeneID:7788193"
     CDS             456125..457111
                     /locus_tag="NGR_b04530"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenases MviM"
                     /protein_id="YP_002822669.1"
                     /db_xref="GI:227818698"
                     /db_xref="GeneID:7788193"
                     /translation="MAQYEVVIIGSGRIADVHAISVTRNPRMHLAGFVDPFDGAYFGE
                     KWSIPGFQTLAAAIDTCKPDALVIASPTETHVSYVLEACRFGLPTLCEKPVAFSREPI
                     LEAISAVASSNIPVILGFHRRFDAYRQEVHARVRAGDVGKVEHILQFSRDPRLAARSA
                     VLHQGNIVADMVVHDLDELNWFMGSLPERAYAQLDRNADPTLAEIGDFDTANIILSWE
                     GGAVAHVSATRRAAHAFEQRLEVFGGEGRIICEDPRISPVIFDSAKDTRISRRFEHFW
                     DRYRPAYQAEIDHLADILARGEAPLCTLEDGLRAYDLVQIVLSSVQAVTESK"
     misc_feature    456125..457108
                     /locus_tag="NGR_b04530"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    456140..456484
                     /locus_tag="NGR_b04530"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    456527..456844
                     /locus_tag="NGR_b04530"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            457212..458339
                     /locus_tag="NGR_b04540"
                     /db_xref="GeneID:7788194"
     CDS             457212..458339
                     /locus_tag="NGR_b04540"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenases MviM"
                     /protein_id="YP_002822670.1"
                     /db_xref="GI:227818699"
                     /db_xref="GeneID:7788194"
                     /translation="MTGRNTVGVGMIGHAFMGKTHSIGYRDVAVIAPLDVPRPRLKAI
                     YGRDTARLEEARERYGWERAVSDWKEIIDDPDIQLVDNVGPNSIHVEPIIAAALAGKH
                     VYCEKPLAPDATQSFEMWKVAREAGVKHMCAFNYRFFPALQLARQMIQEGELGDIYHF
                     RSNFLVSSSLSENRVKSWRDDKTLAGSGVLGDLGSHHIDISRFLLSSDPVRATAVTGI
                     AVGKAGDQQRIETDDLFAALLTYENGALGVLEASRVAGGNMVTSRIEVDGSRGSIRFS
                     MQNLNELEYAGTDKIWRRINVLRDGDPYQKNWLPPGHPLGWVDTFSHEAMHMLAAIGG
                     LGEIAPIGATFRDGYYCAEVVDAIVRSAAEGATANVTYRNL"
     misc_feature    457227..458321
                     /locus_tag="NGR_b04540"
                     /note="Predicted dehydrogenases and related proteins
                     [General function prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     misc_feature    457230..457613
                     /locus_tag="NGR_b04540"
                     /note="Oxidoreductase family, NAD-binding Rossmann fold;
                     Region: GFO_IDH_MocA; pfam01408"
                     /db_xref="CDD:250596"
     misc_feature    457647..457988
                     /locus_tag="NGR_b04540"
                     /note="Oxidoreductase family, C-terminal alpha/beta
                     domain; Region: GFO_IDH_MocA_C; pfam02894"
                     /db_xref="CDD:251601"
     gene            458349..459332
                     /locus_tag="NGR_b04550"
                     /db_xref="GeneID:7788195"
     CDS             458349..459332
                     /locus_tag="NGR_b04550"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase"
                     /protein_id="YP_002822671.1"
                     /db_xref="GI:227818700"
                     /db_xref="GeneID:7788195"
                     /translation="MARVFISWPGYSPRDEDTGARLIAAGHELVLRPKRGNRTADELA
                     TLLEDCDAAIVSTDPFTREVLAGDRNLKVIARVGVGTDSIDHDAAKEFGVGISVTPGM
                     NAETVADQTLAMILGLMRRVVTQDQAVKAGRWDRVGEATPTELYRKTVGLIGAGIIGK
                     AVIRRLLGFGVRVLYFDAMVEKVHGAERCGSLDQLLGSSDIVSLHAPLLADTRELMNA
                     ARIALMPKGSYLINTSRGGLVQQPAVFAALRSGHLAGAALDVFEVEPPGAEALADVPN
                     LIASAHIGGISTESIARMTRSATTSVLSVLNGEIPDTVINPDALRERLAGA"
     misc_feature    458349..459275
                     /locus_tag="NGR_b04550"
                     /note="Phosphoglycerate dehydrogenase and related
                     dehydrogenases [Amino acid transport and metabolism];
                     Region: SerA; COG0111"
                     /db_xref="CDD:223189"
     misc_feature    458355..459269
                     /locus_tag="NGR_b04550"
                     /note="Putative D-3-Phosphoglycerate Dehydrogenases,
                     NAD-binding and catalytic domains; Region: PGDH_like_2;
                     cd12172"
                     /db_xref="CDD:240649"
     misc_feature    order(458517..458519,458580..458588,458655..458657,
                     459051..459053,459192..459194)
                     /locus_tag="NGR_b04550"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240649"
     misc_feature    order(458583..458585,458655..458657,458667..458669,
                     458808..458822,458874..458882,458961..458969,
                     458982..458984,459045..459053,459123..459128,
                     459192..459194,459198..459203)
                     /locus_tag="NGR_b04550"
                     /note="putative NAD binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240649"
     misc_feature    order(459051..459053,459138..459140,459192..459194)
                     /locus_tag="NGR_b04550"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240649"
     gene            459335..460108
                     /locus_tag="NGR_b04560"
                     /db_xref="GeneID:7788196"
     CDS             459335..460108
                     /locus_tag="NGR_b04560"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxy-2-oxovalerate aldolase"
                     /protein_id="YP_002822672.1"
                     /db_xref="GI:227818701"
                     /db_xref="GeneID:7788196"
                     /translation="MERTLTFKERTRARELTVGTWIKTPSRIVTEVLSGSAMDVLCLD
                     AEHAPFDRMDLDGAILSARAQDMPVLVRVQAPFPTEILNALDLGATGVVIPHVYDAAK
                     TRELVSSCLYAPGGRGYAGSSRAAGYTRVKMADHIMASNKMTTIIAQLEDAEVLSTLD
                     ELMAIEEIDCFFIGRADLAVGLGASSAVAPEVIDASTMICETAAKRGKAVGMFVPDLA
                     EIPRWNQLGVSLYLLESDQAFLINGASRLKHAVYQASGL"
     misc_feature    459350..460075
                     /locus_tag="NGR_b04560"
                     /note="HpcH/HpaI aldolase/citrate lyase family; Region:
                     HpcH_HpaI; cl17231"
                     /db_xref="CDD:266573"
     gene            complement(460349..460621)
                     /locus_tag="NGR_b04570"
                     /db_xref="GeneID:7788197"
     CDS             complement(460349..460621)
                     /locus_tag="NGR_b04570"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822673.1"
                     /db_xref="GI:227818702"
                     /db_xref="GeneID:7788197"
                     /translation="MYDLTGPPHPNFCPVHDPLPPTLKLAVASGSILEFTRPMGLIRP
                     WMAISMGRILAKQQGILDLAAQYKETAVKLGETQPHSVASFGSAFD"
     gene            complement(460879..461811)
                     /locus_tag="NGR_b04580"
                     /db_xref="GeneID:7788198"
     CDS             complement(460879..461811)
                     /locus_tag="NGR_b04580"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_002822674.1"
                     /db_xref="GI:227818703"
                     /db_xref="GeneID:7788198"
                     /translation="MINKVRHRVLKLSLGDAELRLLRVFASVVQQGGFSAAQSALGMT
                     QATISTHMRHLEERLGLRLCSRGRSGFQLTDEGRLVYDAALELFGSLEKFQSRIGEAQ
                     GELTGNLSFGTVDAMITNRDLDLQGALAAFRATAPRVHLEIDVAAPQVLHQGLLNGSY
                     QIVLMPSVGSVAPHFRSHPVFSEVQKLYCAQGHPLYSRPDAELTDKLFEEQSFAGRTY
                     MLNETICGVNFSWAAATPHMEGTLLLLLSGAYIGFLPDHYADEWVRTGRLRMLAPERM
                     AFEDMFHIAYPRNKPSRAAETLALAITKSARKPH"
     misc_feature    complement(460888..461760)
                     /locus_tag="NGR_b04580"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(461578..461757)
                     /locus_tag="NGR_b04580"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(460918..461487)
                     /locus_tag="NGR_b04580"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(461071..461076,461080..461085,
                     461101..461118,461377..461397,461401..461403,
                     461413..461415,461422..461427,461431..461436))
                     /locus_tag="NGR_b04580"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            461903..462880
                     /locus_tag="NGR_b04590"
                     /db_xref="GeneID:7788199"
     CDS             461903..462880
                     /locus_tag="NGR_b04590"
                     /codon_start=1
                     /transl_table=11
                     /product="SpeB Arginase/agmatinase/formimionoglutamate
                     hydrolase SpeB"
                     /protein_id="YP_002822675.1"
                     /db_xref="GI:227818704"
                     /db_xref="GeneID:7788199"
                     /translation="MASNSYETGRLNLPFVGICTFGKNPYQPDWDAIDADVAILGAPF
                     DCGTQWRAGTRFGPRAIREASTLFSFGHRGAYDHEDDITYLPSGEVSIVDIGDADIVH
                     TDTMKSHANIEFGVRKILAAGALPVVLGGDHSVNIPCVNAFDEDCARKGPIHIVQIDA
                     HLDFVDERHGVRYGHGNPMRRAAEKPYVSGLSQLGIRNVSSTAKEGYEDARKMGSDIL
                     SVRQIRVLGTDAVVERVPAGARYYVTIDIDGFDPSIAPGTGTPSHGGFIYYEVLEILA
                     ALAKRGTVVGIDLVEVAPDYDHTGGTSILAAQVLMNLIGRVMHAKAKQR"
     misc_feature    462011..462847
                     /locus_tag="NGR_b04590"
                     /note="Agmatinase and related proteins; Region:
                     Agmatinase_like_1; cd11589"
                     /db_xref="CDD:212537"
     misc_feature    order(462029..462031,462038..462040,462065..462070,
                     462077..462079,462086..462088,462182..462184,
                     462191..462196,462668..462670,462680..462682,
                     462692..462694,462704..462709,462803..462805,
                     462812..462817,462824..462826,462836..462838)
                     /locus_tag="NGR_b04590"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212537"
     misc_feature    order(462299..462301,462377..462379,462383..462391,
                     462425..462430,462638..462640,462644..462646,
                     462773..462775)
                     /locus_tag="NGR_b04590"
                     /note="active site"
                     /db_xref="CDD:212537"
     misc_feature    order(462299..462301,462377..462379,462383..462385,
                     462389..462391,462638..462640,462644..462646)
                     /locus_tag="NGR_b04590"
                     /note="Mn binding site [ion binding]; other site"
                     /db_xref="CDD:212537"
     gene            462970..464478
                     /locus_tag="NGR_b04600"
                     /db_xref="GeneID:7788200"
     CDS             462970..464478
                     /locus_tag="NGR_b04600"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="YP_002822676.1"
                     /db_xref="GI:227818705"
                     /db_xref="GeneID:7788200"
                     /translation="MDESVRNYLDQYGVSDATRRFLAKPQKMFIDGAWSDSSNGATFD
                     IFEPSTGGLITRAPSGTPEDLDRAVRAARRQFDGGAWRRLKPLERERLLHSLADLIEA
                     HSDELAEIEAIDMGKSVTFAREIDIRGTVDTFRYFAGWASKLHGRTVEPSLPGNYLAY
                     TRKEPLGVVAAIVPWNFPLQTLAWKLAAALAVGCTAIVKPAELTSLSTLRFAELVQEA
                     GIPDGVVNIVTGKGSIIGAAMSTHPGINKVTFTGSTPVGQEVGRTAVGNLKHVTLELG
                     GKSPVLVLDDADLQSAAVAVANGVFFNSGQVCDAGTRVYVQGSVHDAFLDELVSVTSA
                     LKIAPGLDRDCYIGPLVSAQQKKVVSGYIEAGRREGAELIHGGASLHRQGHFIEPAIF
                     SHCKPQMSIVREEIFGPVLVTSPFDDLDDAVSLANDTPFGLAAAIYSNDLSRVHTLIP
                     RLHAGSIYVNAHSTIDPAMPFGGFKASGFGKDLGPEQLDYLMETKAVWITLP"
     misc_feature    463042..464460
                     /locus_tag="NGR_b04600"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     misc_feature    order(463483..463497,463519..463521,463564..463566,
                     463570..463575,463717..463728,463735..463737,
                     463744..463749,463789..463797,463891..463893,
                     464182..464184,464188..464190,464266..464268,
                     464380..464382)
                     /locus_tag="NGR_b04600"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143395"
     misc_feature    order(463495..463497,463789..463791,463882..463884,
                     463891..463893)
                     /locus_tag="NGR_b04600"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143395"
     gene            464587..464754
                     /locus_tag="NGR_b04610"
                     /db_xref="GeneID:7788201"
     CDS             464587..464754
                     /locus_tag="NGR_b04610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822677.1"
                     /db_xref="GI:227818706"
                     /db_xref="GeneID:7788201"
                     /translation="MENDTAWQNELARRARIYEDIEAGHRFEGTMTVLDYAGMGALTL
                     VLVVAFWIWGA"
     gene            464756..466219
                     /locus_tag="NGR_b04620"
                     /db_xref="GeneID:7788202"
     CDS             464756..466219
                     /locus_tag="NGR_b04620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822678.1"
                     /db_xref="GI:227818707"
                     /db_xref="GeneID:7788202"
                     /translation="MTDHVTHGGFAAIETERQEASRNRAAAERGDAPLLPYERLWGFW
                     EFTYANSALAIATWAFLIGGSVGLFVGPKEGIAAIVIGNIVGVMLTALATTPLSGRYG
                     IEQFVALRSQFGYNGSRVVYVLAVVVLTMGWLAVLAMMFGRSIDGLAALSAGEAANPT
                     GIKMIVAAVGAILVTWFVVARGPTSIKFFNMVVSPALVILMIVMLYLILQHRSFAELL
                     AMPALAPPFEDNTLNFIIAVEVNLAAGFSWWPYIGNLARLTKNERTAFWPNILGIFGA
                     AALGEIVGLLAAVALGDSDPTIWMTKIAGPVIGIIALLFVAFANMTSMANILYTSIVG
                     LRQVGTASVRAISWGTILFLFCVIPLGLVVFYPQMYDGFFIFLVWTSALNSALAGIGI
                     ADYFFLRGQKLDMRSLHGPQENGPYRFWGGFNPISLLALAAGFLVYVLVFNPQTLASL
                     PAFKYFTASVPSCLAAGTVHYVLTRLFARRRGWGLYP"
     misc_feature    order(464903..464905,464912..464914,465710..465712,
                     465719..465724)
                     /locus_tag="NGR_b04620"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:212031"
     misc_feature    464930..466198
                     /locus_tag="NGR_b04620"
                     /note="Solute carrier families 5 and 6-like; solute
                     binding domain; Region: SLC5-6-like_sbd; cl00456"
                     /db_xref="CDD:260433"
     gene            466236..467921
                     /locus_tag="NGR_b04630"
                     /db_xref="GeneID:7788203"
     CDS             466236..467921
                     /locus_tag="NGR_b04630"
                     /note="catalyzes the oxidation of choline to betaine
                     aldehyde and betain aldehyde to glycine betaine"
                     /codon_start=1
                     /transl_table=11
                     /product="choline dehydrogenase"
                     /protein_id="YP_002822679.1"
                     /db_xref="GI:227818708"
                     /db_xref="GeneID:7788203"
                     /translation="MTETYDYIIIGAGSAGCVLANRLSEDPAAKVLVLEYGGSDMSIF
                     IQMPTALSIPMNGTKYNWKYMTLPEPGLGGRRVHCPRGKVIGGSSSINGLVYMRGHAR
                     DFDEWEELGARGWRYANCLPYFQRAESWQDGGDAYRGASGPLATNAGNKMKNPLYRAF
                     VDAGREAGYITTEDPNGHMQEGFGAMHMTVKDGVRWSTANAYLKPAMSRPNLTVITHA
                     MTRRVVLEGKRAVGVEYELEGERVVAKASREVLISSGPIGSPHLLQRSGIGPAAVLRQ
                     AGVEVLHDLPGVGENLQDHSEVYIQYVCKEPITLNGKMGLLSRALIGAEWLLFQKGLS
                     VSNHFESGGFIRSDASLQWPDIQFHFLPAAMRYDGKKPLDGHGFMVLTGPNKPKSRGY
                     VRLRSAEAHEQPDILFNYLDREEDREGFRRCLRLTREIIAQPAFDRFRGEEIAPGANV
                     RSNDEIDAWVCETMESTYHPCGSCRMGEDAMAVVDSDLGVRGIAGLRVIDSSVFPSEP
                     NANLNAPTIMLAERASDIVRGKPLLAASNAEAGVAPGVGVTQRSGTPMRTVRH"
     misc_feature    466236..467903
                     /locus_tag="NGR_b04630"
                     /note="choline dehydrogenase; Validated; Region: PRK02106"
                     /db_xref="CDD:235000"
     misc_feature    <466299..>466433
                     /locus_tag="NGR_b04630"
                     /note="SERine Proteinase INhibitors (serpins) exhibit
                     conformational polymorphism shifting from native to
                     cleaved, latent, delta, or polymorphic forms. Many
                     serpins, such as antitrypsin and antichymotrypsin,
                     function as serine protease inhibitors which regulate...;
                     Region: SERPIN; cl00137"
                     /db_xref="CDD:260211"
     misc_feature    466452..467120
                     /locus_tag="NGR_b04630"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    467394..467798
                     /locus_tag="NGR_b04630"
                     /note="GMC oxidoreductase; Region: GMC_oxred_C; pfam05199"
                     /db_xref="CDD:253079"
     gene            complement(468056..468376)
                     /locus_tag="NGR_b04640"
                     /db_xref="GeneID:7788204"
     CDS             complement(468056..468376)
                     /locus_tag="NGR_b04640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822680.1"
                     /db_xref="GI:227818709"
                     /db_xref="GeneID:7788204"
                     /translation="MRSHSVKCAALFGSDLCVRAMPRMATLAGLARIDCSDSGLNAWL
                     EDDRGDRAVHRAVLDAGLQCYPLSDYTIATPRPDAIILGYAGVPADRMKPYVLRLAEA
                     IART"
     misc_feature    complement(468062..>468292)
                     /locus_tag="NGR_b04640"
                     /note="Transcriptional regulators containing a DNA-binding
                     HTH domain and an aminotransferase domain (MocR family)
                     and their eukaryotic orthologs [Transcription / Amino acid
                     transport and metabolism]; Region: ARO8; COG1167"
                     /db_xref="CDD:224089"
     gene            468279..468590
                     /locus_tag="NGR_b04650"
                     /note="PilT protein domain protein may be truncated"
                     /pseudo
                     /db_xref="GeneID:7788205"
     gene            complement(468770..469153)
                     /locus_tag="NGR_b04660"
                     /db_xref="GeneID:7788206"
     CDS             complement(468770..469153)
                     /locus_tag="NGR_b04660"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein-like protein"
                     /protein_id="YP_002822681.1"
                     /db_xref="GI:227818710"
                     /db_xref="GeneID:7788206"
                     /translation="MILADTSIWIDHFRHADSELRRIIEDDRLFCHPAVIGELALGSL
                     RDRSNVIAFLAAQREAFVATHDEVMMMIDRHAIFSMGIGYTDAHLMASVLLDQRAALW
                     TRDKRLRAAAERVGAPLHTPANARN"
     misc_feature    complement(468833..469153)
                     /locus_tag="NGR_b04660"
                     /note="Predicted nucleic acid-binding protein, contains
                     PIN domain [General function prediction only]; Region:
                     VapC; COG1487"
                     /db_xref="CDD:224404"
     misc_feature    complement(order(468839..468841,468896..468898,
                     469139..469141))
                     /locus_tag="NGR_b04660"
                     /note="putative active site [active]"
                     /db_xref="CDD:189022"
     gene            complement(469150..469350)
                     /locus_tag="NGR_b04670"
                     /db_xref="GeneID:7788207"
     CDS             complement(469150..469350)
                     /locus_tag="NGR_b04670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822682.1"
                     /db_xref="GI:227818711"
                     /db_xref="GeneID:7788207"
                     /translation="MRSTINLDDTLLERARSLTGTKETAALVRQALETLVRVESGKRL
                     IALGGTMPDAEAAPRRRSAAAK"
     misc_feature    complement(469210..469350)
                     /locus_tag="NGR_b04670"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2191); Region: DUF2191; pfam09957"
                     /db_xref="CDD:255659"
     gene            469636..470271
                     /locus_tag="NGR_b04680"
                     /db_xref="GeneID:7788208"
     CDS             469636..470271
                     /locus_tag="NGR_b04680"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822683.1"
                     /db_xref="GI:227818712"
                     /db_xref="GeneID:7788208"
                     /translation="MAYVDWAIKGPKIAACSCDYGCPCEFNGKPTEGLCEGLECMLIE
                     EGWFGDLRLDGLKVAAVYRWPGPVHEGGGVVRGFFDANADQAQIDALFTILGGKEQEP
                     TTVFNIYGSTIAQELEPIFAPIEFHSDIEKRTGGFRIDGHLELELEPIRNPVTGALHR
                     ARIVLPEGFEFREAEVASGTFTANGAIAMGRQKRYGALWRAAYGPYGIIEE"
     misc_feature    469636..470256
                     /locus_tag="NGR_b04680"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5588"
                     /db_xref="CDD:227875"
     gene            complement(470533..470889)
                     /locus_tag="NGR_b04690"
                     /db_xref="GeneID:7788209"
     CDS             complement(470533..470889)
                     /locus_tag="NGR_b04690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002822684.1"
                     /db_xref="GI:227818713"
                     /db_xref="GeneID:7788209"
                     /translation="MNQLLFRMADFLSRPPGFYFVIVAMIASTALVPFGLTNVVTYAL
                     SVAAILITSVVLIQGYRDTAAIHAKLDEIIVSMRETRNEVVGLEHEQPEHIAAAVQRL
                     EAEAEEQGRANTETAR"
     misc_feature    complement(470539..470889)
                     /locus_tag="NGR_b04690"
                     /note="Predicted small integral membrane protein [Function
                     unknown]; Region: COG5478"
                     /db_xref="CDD:227765"
     gene            471127..471936
                     /locus_tag="NGR_b04700"
                     /db_xref="GeneID:7788210"
     CDS             471127..471936
                     /locus_tag="NGR_b04700"
                     /codon_start=1
                     /transl_table=11
                     /product="Ku78, Ku70 and Ku80 are 70kDa and 80kDa subunits
                     of the Lupus Ku autoantigen"
                     /protein_id="YP_002822685.1"
                     /db_xref="GI:227818714"
                     /db_xref="GeneID:7788210"
                     /translation="MAPRSFWKGYLKLSLVTCPVAMSPATTENEKVRFHTLNRKTSNR
                     VVSQYVDAVSGKPVSEDDEVKGYQRGEDDYVLLEDDELEAVGLESTRTIDIDMFVEAD
                     SIRWIWYDKPHYLVPDDPVGEEAFSVIRDAMASTGTVGISRLVMYRRERAVMLEPRGK
                     GIVLWTLRYGDEVRQPEEFFRNIGDDDNDPELMRLVTTLIEERSKPWNPDMVGDPVQD
                     RLLDIISAKKKGRKRVAKAKADEGERPSNVVNIMDALRKSISSEKTKKTKS"
     misc_feature    471127..471933
                     /locus_tag="NGR_b04700"
                     /note="Ku-homolog [Replication, recombination, and
                     repair]; Region: COG1273"
                     /db_xref="CDD:224192"
     misc_feature    471136..471915
                     /locus_tag="NGR_b04700"
                     /note="Ku-core domain, Ku-like subfamily; composed of
                     prokaryotic homologs of the eukaryotic DNA binding protein
                     Ku. The alignment includes the core domain shared by the
                     prokaryotic YkoV-like proteins and the eukaryotic Ku70 and
                     Ku80. The prokaryotic Ku...; Region: KU_like; cd00789"
                     /db_xref="CDD:238408"
     misc_feature    order(471139..471141,471196..471198,471226..471228,
                     471271..471273,471565..471567)
                     /locus_tag="NGR_b04700"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238408"
     misc_feature    order(471175..471177,471196..471204,471208..471213,
                     471226..471237,471250..471252,471259..471270,
                     471274..471282,471298..471300,471310..471318,
                     471322..471324,471328..471333,471343..471348,
                     471355..471357,471412..471414,471418..471423,
                     471451..471453,471496..471498,471553..471555,
                     471634..471642,471646..471648,471733..471735,
                     471745..471747,471760..471768,471805..471807,
                     471892..471894,471901..471903)
                     /locus_tag="NGR_b04700"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238408"
     gene            complement(472205..474757)
                     /locus_tag="NGR_b04710"
                     /db_xref="GeneID:7788211"
     CDS             complement(472205..474757)
                     /locus_tag="NGR_b04710"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA ligase"
                     /protein_id="YP_002822686.1"
                     /db_xref="GI:227818715"
                     /db_xref="GeneID:7788211"
                     /translation="MALEIYRKKRNFGSTPEPKGRKARRSGNSFVVQKHDATRLHYDF
                     RLEMDGVLKSWAVTKGPSLIPGEKRLAVHVEDHPLEYGDFEGTIPKGEYGGGTVILWD
                     RGTWSPIGDADRGYAKGHLDFELSGEKLGGRWHLVRMAGKPREKRENWLLIKGDDEAA
                     RSEDDPDILEERPESVLTGREIKDVAGEEPGWSSKIGRIRKKGRGTTKAASQQAERQA
                     VANVPDPAKIKGAKAAPLPDFVEPALATLVSSAPAGERWLHEIKFDGYRLQARIEAGR
                     VKLLTRGGLDWTKKFGKTLVSASQALPIGTALIDGEIVVETGSGASDFSALQADLSEG
                     RSDRFRFYVFDLLHLDGYDLRPLPLTKRKELLGQLIGEADGIIRFSNHFEEEGKLVLR
                     HACRLSLEGVVSKLRDAPYRTGRNKSWVKSKCSARQEFVVAGYVPSTTSRKAIGSLVL
                     GVYDAGKLHHVGRVGTGFTAALAEDLFKRLDRLRTTHSPFSARLSAEDARQVRYVKPE
                     LVAEIEFRAWTADGHLRHASFRGLREDKLASDIVREAPRSATAQPKPPQRTVKLTHPD
                     RLYWPDEGVTKEGLADYYAEVWRFIAPHIVGRPLALVRCPNGIAGEQFFQKHAWKGLN
                     PNIVLVNDPKEPPDEQLLSIRNLDGLTALVQSAVLEIHPWGSTVADWERPDTIIMDLD
                     PGDDVPFEAVIEAAFETADRLKAAGLVPFVKTSGGKGLHVVAPLKPKAEWPVAKAFTK
                     SIADAMASDSPDRFVSTITKSKRRGKILVDYLRNQRGATAVAAYSTRARPGAAVSMPL
                     SWDELAPGIGPAYFTVENTPTRLASLSTDPWGEFRAAAVPLAEPKVRRKKAA"
     misc_feature    complement(472241..474754)
                     /locus