GenomeNet

Database: RefSeq
Entry: NC_013212
LinkDB: NC_013212
Original site: NC_013212 
LOCUS       NC_013212              49961 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-030, complete
            sequence.
ACCESSION   NC_013212
VERSION     NC_013212.1  GI:258513263
DBLINK      Project: 59279
            BioProject: PRJNA59279
KEYWORDS    RefSeq.
SOURCE      Acetobacter pasteurianus IFO 3283-01
  ORGANISM  Acetobacter pasteurianus IFO 3283-01
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Acetobacteraceae; Acetobacter.
REFERENCE   1  (bases 1 to 49961)
  AUTHORS   Azuma,Y., Hosoyama,A., Matsutani,M., Furuya,N., Horikawa,H.,
            Harada,T., Hirakawa,H., Kuhara,S., Matsushita,K., Fujita,N. and
            Shirai,M.
  TITLE     Whole-genome analyses reveal genetic instability of Acetobacter
            pasteurianus
  JOURNAL   Nucleic Acids Res. 37 (17), 5768-5783 (2009)
   PUBMED   19638423
REFERENCE   2  (bases 1 to 49961)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-SEP-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 49961)
  AUTHORS   Azuma,Y. and Hosoyama,A.
  CONSRTM   Acetobacter pasteurianus genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2009) Contact:Yoshinao Azuma Yamaguchi University
            School of Medicine, Department of Microbiology and Immunology;
            Minami-Kogushi 1-1-1, Ube, Yamaguchi 755-8505, Japan URL
            :http://www.bio.nite.go.jp/dogan/Top
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to AP011124.
            This work was done by Acetobacter pasteurianus genome sequencing
            consortium including Department of Microbiology and Immunology,
            Yamaguchi University School of Medicine, National Institute of
            Technology and Evaluation, Genetic Resources Technology, Faculty of
            Agriculture, Kyushu University, Department of Biological Chemistry,
            Faculty of Agriculture, Yamaguchi University and Mizkan Group
            Corporation Central Research Institute.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..49961
                     /organism="Acetobacter pasteurianus IFO 3283-01"
                     /mol_type="genomic DNA"
                     /strain="IFO 3283"
                     /sub_strain="IFO 3283-01"
                     /db_xref="NBRC:105184"
                     /db_xref="taxon:634452"
                     /plasmid="pAPA01-030"
                     /note="strain coidentity: IFO 3283 = NBRC 3283"
     gene            501..1070
                     /locus_tag="APA01_43530"
                     /db_xref="GeneID:8426909"
     CDS             501..1070
                     /locus_tag="APA01_43530"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="YP_003189519.1"
                     /db_xref="GI:258513264"
                     /db_xref="GeneID:8426909"
                     /translation="MFTMAGQIVAYVRVSSADQNTDRQMFDGMTVDKTFTDKCSGGTR
                     NRPALTEMLGYVREGDTIVCHSIDRLARDLGDLMHLVQTMTRRGVGVRFMKEGLTFTG
                     EDSPMQDLMMHIFGAVAQFERALIHERQKEGQIAARAKGKVPGRKPKLSPEQVTELYN
                     RVATHEPKAQIARDFGISRETLYAYLKAA"
     misc_feature    522..1061
                     /locus_tag="APA01_43530"
                     /note="multiple promoter invertase; Provisional; Region:
                     mpi; PRK13413"
                     /db_xref="CDD:184041"
     misc_feature    522..899
                     /locus_tag="APA01_43530"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(537..539,543..545,702..707,714..716)
                     /locus_tag="APA01_43530"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    543..545
                     /locus_tag="APA01_43530"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(699..701,840..845,849..854,864..866)
                     /locus_tag="APA01_43530"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(717..719,732..737,828..830,837..842,849..854,
                     861..863,870..872)
                     /locus_tag="APA01_43530"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(786..794,828..833,840..845,852..854,864..866,
                     873..875,885..887)
                     /locus_tag="APA01_43530"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(786..788,843..845,852..854,864..866,873..875,
                     885..887)
                     /locus_tag="APA01_43530"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(867..869,885..890)
                     /locus_tag="APA01_43530"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    933..1058
                     /locus_tag="APA01_43530"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cd00569"
                     /db_xref="CDD:259851"
     misc_feature    order(936..944,1038..1043,1047..1055)
                     /locus_tag="APA01_43530"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            1194..1433
                     /locus_tag="APA01_43540"
                     /db_xref="GeneID:8426847"
     CDS             1194..1433
                     /locus_tag="APA01_43540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189520.1"
                     /db_xref="GI:258513265"
                     /db_xref="GeneID:8426847"
                     /translation="MSTTRWNIAVSSEVDQSVRMFLAANGGGRKGDLSRFIEDAVRSY
                     LLEQAVEQAKAASEDMSEAELADLVNEAVQWARGH"
     gene            1415..1855
                     /locus_tag="APA01_43550"
                     /db_xref="GeneID:8426848"
     CDS             1415..1855
                     /locus_tag="APA01_43550"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189521.1"
                     /db_xref="GI:258513266"
                     /db_xref="GeneID:8426848"
                     /translation="MGTWALMRVVLDTNILVSALIYPRGAPDAIYRAWRAHRFDLVTS
                     TTQLEELRRVSRYPKLRSILPPHRVGAMINNMRKASVAEQLPTLPDDVTINDRDDVFL
                     LTMVLAFDADYLVTGDHRAGLLEKGRFQRARIVTPVDFCSIALD"
     misc_feature    1433..1849
                     /locus_tag="APA01_43550"
                     /note="PIN domain; Region: PIN_3; cl17397"
                     /db_xref="CDD:266665"
     gene            complement(1949..2206)
                     /gene="traD"
                     /locus_tag="APA01_43560"
                     /db_xref="GeneID:8426849"
     CDS             complement(1949..2206)
                     /gene="traD"
                     /locus_tag="APA01_43560"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="YP_003189522.1"
                     /db_xref="GI:258513267"
                     /db_xref="GeneID:8426849"
                     /translation="MRDWAKARRERTHHLIELGGLVQKARLVDLTDDDRATLLGAFLD
                     IAGQLQGSNVTTPVDLKTRWRRAGLHAFDAEKEHVERKEQP"
     misc_feature    complement(1982..2194)
                     /gene="traD"
                     /locus_tag="APA01_43560"
                     /note="Conjugal transfer protein TraD; Region: TraD;
                     pfam06412"
                     /db_xref="CDD:253711"
     gene            complement(2253..3143)
                     /locus_tag="APA01_43570"
                     /db_xref="GeneID:8426905"
     CDS             complement(2253..3143)
                     /locus_tag="APA01_43570"
                     /note="Integrase core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189523.1"
                     /db_xref="GI:258513268"
                     /db_xref="GeneID:8426905"
                     /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQK
                     DKELCDDIRRVWNNNFCVYGARKVWHQLKREGVDVARCTVERLMRRMGLKGVIRGKGV
                     RTTRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVG
                     WRVSSTAHTDFVLDALEQALCQRRPEGKVTHHSDRGCQYVSILYTQRLAEAGLVASVG
                     SVGDSYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNI
                     PPAEAEARFYAQQKSHALAA"
     misc_feature    complement(2256..3083)
                     /locus_tag="APA01_43570"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     misc_feature    complement(2844..3017)
                     /locus_tag="APA01_43570"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(2424..2777)
                     /locus_tag="APA01_43570"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(2310..2483)
                     /locus_tag="APA01_43570"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(3140..3463)
                     /locus_tag="APA01_43580"
                     /db_xref="GeneID:8426850"
     CDS             complement(3140..3463)
                     /locus_tag="APA01_43580"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189524.1"
                     /db_xref="GI:258513269"
                     /db_xref="GeneID:8426850"
                     /translation="MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMMIAPKLDIH
                     PDTLSKWTRLHERANAPAVSELPDREKIRQLERENRELRQANDILRKASAYFAQAELD
                     RIFKP"
     misc_feature    complement(3173..3463)
                     /locus_tag="APA01_43580"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(3206..3460)
                     /locus_tag="APA01_43580"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            3462..3941
                     /locus_tag="APA01_43590"
                     /db_xref="GeneID:8426851"
     CDS             3462..3941
                     /locus_tag="APA01_43590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189525.1"
                     /db_xref="GI:258513270"
                     /db_xref="GeneID:8426851"
                     /translation="MNPSYLSGRSVSTKPGAIQPASRRLEGVFEKAIGEVRKERQALA
                     SIVGEANNRRDQWFYLIFIGLMAFLFGVGVAPLLFNHITWKNFDERVASFIVGGQDRW
                     ESGAAMMRDARPEQWNSFMWEDRLVQDNMPKIRDCRIAATQVGQPKPCVITIKPDAQ"
     gene            complement(4027..6345)
                     /locus_tag="APA01_43600"
                     /db_xref="GeneID:8426852"
     CDS             complement(4027..6345)
                     /locus_tag="APA01_43600"
                     /note="Adhesin family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_003189526.1"
                     /db_xref="GI:258513271"
                     /db_xref="GeneID:8426852"
                     /translation="MDYWNDTSVSNGETLNDITLTSANDTHDRLFVSSGGVANNVHVG
                     GGAYAYIYGGTISTITVSSGGLVHMVSGGTVKDLHVLSGGIGYIPSGTLSGSVIDNGG
                     LLEVLVSGSATSVTVENNGVVKIRSGGLINASNILSGGSIIVSSGGQSIGTVISSGGS
                     LTFTGGGSGSYTSLLAGGTLNIGSGTTYDNQHTTSLTATSGAQINVLSGGVLTDADAA
                     AFGNIVVSKGGRGQDIIISSGGGLGVAGIASDTTVNNGGVIEINSGGVSNNNHVNNGG
                     KIYADSGSILGLTSISSGGSAIVASGATISDVVTIQDGGTATIWNNTSGTIDLSGDTN
                     HGLTISGLESGGTVSTVISGWSGSKPGNSDSIDLPGVSADGASYAYPSDDQVVVTLAN
                     GNTITLNIPGVKNTGFVLSDDHHGGASAEVCFLSGSMIRTSEGDVAVEDIQIGDEVIA
                     FDWRNDEDVVRQVVWVGKARATVRPDLPDDEAGWPVRILKDAIADGVPYKDMLITAEH
                     CLFFRDRFVPVRMLVNGVSIFYDKSITSYDYYHVETEQHSVITADGMLTESYLDTGNR
                     SSFRQEGKIATLRGAVKNWADHAGAPLGVERSFVEPLFRALQWRENSVVGTKISTTKI
                     ETTTDPDLHLITQTGAVIRPMRKTAHHYSFMLPPNTESVRIVSRSSRPSDVIGPFVDD
                     RRYMGVAVADVQLQCAKQQFDITSHLQDEKPSGWHDTDWTDCAWTNGNAELPLGDHLT
                     HGKMGILSMTIRAAGPYLLNTKPNSDMKKHSA"
     misc_feature    complement(<5518..6018)
                     /locus_tag="APA01_43600"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09945"
                     /db_xref="CDD:137602"
     misc_feature    complement(4660..5082)
                     /locus_tag="APA01_43600"
                     /note="Hint domain; Region: Hint_2; pfam13403"
                     /db_xref="CDD:257728"
     gene            complement(6391..6555)
                     /locus_tag="APA01_43610"
                     /db_xref="GeneID:8426853"
     CDS             complement(6391..6555)
                     /locus_tag="APA01_43610"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189527.1"
                     /db_xref="GI:258513272"
                     /db_xref="GeneID:8426853"
                     /translation="MTVTSNSQEVLSSGATGMQQTIEESQKSASITVTTLGDDSRPER
                     RVRWSERIDH"
     gene            complement(6764..6991)
                     /locus_tag="APA01_43620"
                     /db_xref="GeneID:8426854"
     CDS             complement(6764..6991)
                     /locus_tag="APA01_43620"
                     /note="Probably pseudogene, N-terminal domain of a gene
                     truncated by transposon"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189528.1"
                     /db_xref="GI:258513273"
                     /db_xref="GeneID:8426854"
                     /translation="MRERIWDMGARPAIPAKRRDGPVACPKWAYRCRHLVENLWARLK
                     EWRAVATRYEKTATSFLVVIHIAAAADWIKP"
     misc_feature    complement(6770..6988)
                     /locus_tag="APA01_43620"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_2;
                     pfam13586"
                     /db_xref="CDD:257902"
     gene            complement(7135..7560)
                     /locus_tag="APA01_43630"
                     /db_xref="GeneID:8426855"
     CDS             complement(7135..7560)
                     /locus_tag="APA01_43630"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189529.1"
                     /db_xref="GI:258513274"
                     /db_xref="GeneID:8426855"
                     /translation="MEEGDRTGTFTDETWAIWEPLIEEVRPRGKTPPHDLRRTIAAIF
                     WRHENGAKWRSIPAELGPWWRAAQLFIRWAKLGVWERLLALVQEQQGVAFGMTFLDGT
                     NIRAHHKAAGAQKKGPLSKSETIVKHLAALAVAMAQKSA"
     misc_feature    complement(<7267..7530)
                     /locus_tag="APA01_43630"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3293"
                     /db_xref="CDD:225830"
     misc_feature    complement(7309..7530)
                     /locus_tag="APA01_43630"
                     /note="Putative transposase of IS4/5 family (DUF4096);
                     Region: DUF4096; pfam13340"
                     /db_xref="CDD:257670"
     gene            7752..7907
                     /locus_tag="APA01_43640"
                     /db_xref="GeneID:8426856"
     CDS             7752..7907
                     /locus_tag="APA01_43640"
                     /note="Probably pseudogene, N-terminal domain of a gene
                     truncated by transposon"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="YP_003189530.1"
                     /db_xref="GI:258513275"
                     /db_xref="GeneID:8426856"
                     /translation="MQIQTLNSFECHKVFREKASGADVERVELRRLIKNLCHGDTVVI
                     PPFLVGH"
     misc_feature    7755..>7883
                     /locus_tag="APA01_43640"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cl02788"
                     /db_xref="CDD:261450"
     gene            complement(7916..8743)
                     /locus_tag="APA01_43650"
                     /db_xref="GeneID:8426857"
     CDS             complement(7916..8743)
                     /locus_tag="APA01_43650"
                     /note="Integrase core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189531.1"
                     /db_xref="GI:258513276"
                     /db_xref="GeneID:8426857"
                     /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAA
                     ENDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYRELEFNLRIKPRR
                     RLVREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLP
                     ACRVVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAY
                     IERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
     misc_feature    complement(8435..>8572)
                     /locus_tag="APA01_43650"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(8054..8392)
                     /locus_tag="APA01_43650"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(7943..8140)
                     /locus_tag="APA01_43650"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(8740..9003)
                     /locus_tag="APA01_43660"
                     /db_xref="GeneID:8426858"
     CDS             complement(8740..9003)
                     /locus_tag="APA01_43660"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189532.1"
                     /db_xref="GI:258513277"
                     /db_xref="GeneID:8426858"
                     /translation="MKSGRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAK
                     YGGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
     misc_feature    complement(8788..8991)
                     /locus_tag="APA01_43660"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     gene            9099..9491
                     /locus_tag="APA01_43670"
                     /db_xref="GeneID:8426859"
     CDS             9099..9491
                     /locus_tag="APA01_43670"
                     /note="Probably pseudogene, C-terminal domain of a gene
                     truncated by transposon"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="YP_003189533.1"
                     /db_xref="GI:258513278"
                     /db_xref="GeneID:8426859"
                     /translation="MARSTFDLFAIVKEIIQKGAQFYSLSEPWADTTTSTGRLMLAVL
                     GGLADVERDLIRTRTAEGRARAVQLGVKMGRPTKIADIQRQDIIKRRQNGEFLKDIAE
                     DFGISVGTVSRITTGADSHKSRKNKKGF"
     misc_feature    <9099..9284
                     /locus_tag="APA01_43670"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cl02788"
                     /db_xref="CDD:261450"
     misc_feature    <9102..9440
                     /locus_tag="APA01_43670"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    9318..9440
                     /locus_tag="APA01_43670"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cl17393"
                     /db_xref="CDD:266662"
     misc_feature    order(9321..9329,9423..9428,9432..9440)
                     /locus_tag="APA01_43670"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            complement(9725..10318)
                     /locus_tag="APA01_43680"
                     /db_xref="GeneID:8426860"
     CDS             complement(9725..10318)
                     /locus_tag="APA01_43680"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="YP_003189534.1"
                     /db_xref="GI:258513279"
                     /db_xref="GeneID:8426860"
                     /translation="MTHILIGYARCSTDKQDLAVQKQELLKLGVSADRIYTDKGFTGT
                     NRDRPGLDQALAAVRSGDTLVVPKLDRLARSVPDARAIGDSLAARGVKLQLGTSVHDP
                     SDPMGKLFFNILATFAEFEADLIKLRTREGMAVARAKGKLRGKKPKLSDRQQKELRRM
                     YDTGDYSISDLADLFSISRPTVYRTLGRQPVTSVLAA"
     misc_feature    complement(9746..10309)
                     /locus_tag="APA01_43680"
                     /note="multiple promoter invertase; Provisional; Region:
                     mpi; PRK13413"
                     /db_xref="CDD:184041"
     misc_feature    complement(9923..10306)
                     /locus_tag="APA01_43680"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(10097..10099,10106..10111,10283..10285,
                     10289..10291))
                     /locus_tag="APA01_43680"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(10283..10285)
                     /locus_tag="APA01_43680"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(9956..9958,9968..9973,9977..9982,
                     10112..10114))
                     /locus_tag="APA01_43680"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(9950..9952,9959..9961,9968..9973,
                     9980..9985,9992..9994,10076..10081,10094..10096))
                     /locus_tag="APA01_43680"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(9935..9937,9947..9949,9956..9958,
                     9968..9970,9977..9982,9989..9994,10019..10027))
                     /locus_tag="APA01_43680"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(9935..9937,9947..9949,9956..9958,
                     9968..9970,9977..9979,10025..10027))
                     /locus_tag="APA01_43680"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(9932..9937,9953..9955))
                     /locus_tag="APA01_43680"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    complement(9761..9889)
                     /locus_tag="APA01_43680"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cd00569"
                     /db_xref="CDD:259851"
     misc_feature    complement(order(9764..9772,9776..9781,9878..9886))
                     /locus_tag="APA01_43680"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            10437..11936
                     /locus_tag="APA01_43690"
                     /db_xref="GeneID:8426861"
     CDS             10437..11936
                     /locus_tag="APA01_43690"
                     /note="Integrase core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189535.1"
                     /db_xref="GI:258513280"
                     /db_xref="GeneID:8426861"
                     /translation="MILYRTGAITMADDRVLGTDSTEVAMRMAVLRPYLIDNVPLTKI
                     AVDAAIPIRTVRRWIARYRLSGPAGLMRPTRPDAGTRTFPKEMVELIEGMALLKPQSS
                     IATIHRRIVMLAAEQGWRKPSYGSVRSIVREINPAILTLAHEGSAAFRDKYELVHRHR
                     ASRPNATWQADHTQLDILILDAGGKAARPWLTTVMDDYSRVVAGYMVMLGAPSALNTS
                     LALRQAIWRKADPMWPVCGIPDVLHVDHGSDFTSLHLEQASADLHFRLIYSGVARPQG
                     RGKIERLFRTINTELLPELPGNLRNGKPSSPPRLSLAELDATIGDYIVSTYNTRPHST
                     IGVPPAKAWCGDGWLPRMPETVDELDTLLVMVARPRTVHRDGIRFEGLRYFDPTLAAY
                     VGEPVMIRYDPRDMGEIRIFHRNTFLCRAVSADHAGDSITLKDIQTARIAHRRHLRNQ
                     IAERKARVADFFPSPVFRPTQPAVPVTLSGTEAKGRQKGRRLRIYSEGD"
     misc_feature    10515..10841
                     /locus_tag="APA01_43690"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     misc_feature    10515..10664
                     /locus_tag="APA01_43690"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    10596..10826
                     /locus_tag="APA01_43690"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    10914..11309
                     /locus_tag="APA01_43690"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    11220..11453
                     /locus_tag="APA01_43690"
                     /note="Integrase core domain; Region: rve_3; cl15866"
                     /db_xref="CDD:265813"
     misc_feature    11511..11699
                     /locus_tag="APA01_43690"
                     /note="Mu transposase, C-terminal; Region: Mu-transpos_C;
                     pfam09299"
                     /db_xref="CDD:255273"
     gene            11936..12760
                     /locus_tag="APA01_43700"
                     /db_xref="GeneID:8426862"
     CDS             11936..12760
                     /locus_tag="APA01_43700"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="YP_003189536.1"
                     /db_xref="GI:258513281"
                     /db_xref="GeneID:8426862"
                     /translation="MRTARTTSFIATQEHRRFSEFADAVRKHRYIGLCHGPAGVGKTL
                     SARRYTHWHVVGKTLEEWGPRGSDQAKVNAHLAKSRAIFFTPTVSCSVQELRHDVPAL
                     IACAEICIDDHVRPHIQGQARIIDHTTRYIELLIVDEAERLSMTALEWLRDLFDRQGI
                     SLIFIGMPGIDKRMARYPQLFSRVGFSHHYRPLQEQELTFVLTRRWRDLGLSLDGADF
                     TDAQAVAAIVRLTGGNFRLLHRLFVQIERIMRLNELTVITEDVVEAARSTLVIGVT"
     misc_feature    11948..12757
                     /locus_tag="APA01_43700"
                     /note="Uncharacterized ATPase, putative transposase
                     [General function prediction only]; Region: COG2842"
                     /db_xref="CDD:225398"
     misc_feature    12011..12457
                     /locus_tag="APA01_43700"
                     /note="AAA domain; Region: AAA_22; pfam13401"
                     /db_xref="CDD:257726"
     gene            12808..13455
                     /locus_tag="APA01_43710"
                     /db_xref="GeneID:8426863"
     CDS             12808..13455
                     /locus_tag="APA01_43710"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="YP_003189537.1"
                     /db_xref="GI:258513282"
                     /db_xref="GeneID:8426863"
                     /translation="MHGGFSGRVQMGQRAVIYCRVSTADQSCARQKDELKRFAERAGY
                     EVLDVFMETGSGVRVDRAERRNVMALAQAREIDAILVTELSRWGRSTIDLISTLQELE
                     SYRVSLIAITGMAFDLATPHGRMLATVLAGIAEFERDLISERVKSGLAAAKARGKVLG
                     RQKGERPKSDRLAPKVLALVAEKRSYRWIARDLGISKNTVAAIVQRDQVRPSLPS"
     misc_feature    12850..13251
                     /locus_tag="APA01_43710"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    12859..13440
                     /locus_tag="APA01_43710"
                     /note="multiple promoter invertase; Provisional; Region:
                     mpi; PRK13413"
                     /db_xref="CDD:184041"
     misc_feature    order(12865..12867,12871..12873,13060..13065,13072..13074)
                     /locus_tag="APA01_43710"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    12871..12873
                     /locus_tag="APA01_43710"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(13057..13059,13192..13197,13201..13206,13216..13218)
                     /locus_tag="APA01_43710"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(13075..13077,13090..13095,13180..13182,13189..13194,
                     13201..13206,13213..13215,13222..13224)
                     /locus_tag="APA01_43710"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(13144..13149,13153..13155,13180..13185,13192..13197,
                     13204..13206,13216..13218,13225..13227,13237..13239)
                     /locus_tag="APA01_43710"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(13144..13146,13195..13197,13204..13206,13216..13218,
                     13225..13227,13237..13239)
                     /locus_tag="APA01_43710"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(13219..13221,13237..13242)
                     /locus_tag="APA01_43710"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     gene            13498..14133
                     /gene="parA"
                     /locus_tag="APA01_43720"
                     /db_xref="GeneID:8426864"
     CDS             13498..14133
                     /gene="parA"
                     /locus_tag="APA01_43720"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning family protein ParA/MinD"
                     /protein_id="YP_003189538.1"
                     /db_xref="GI:258513283"
                     /db_xref="GeneID:8426864"
                     /translation="MKVLAVLSQKGGVGKTTLATCLAVAAEQAGKVAAIIDLDPQATA
                     SFWKDVRQLDTPAVASIQPIRLPAMLKACADAGTDLVIIDGAAVARDVAYEAARHADF
                     VLIPTKTAVFDTMSMTHTLDVVRQLDKAFAVVLTFVPPQGQETGDAIKAVTELGATVC
                     PVTVGNRKAFFRAQAAGQAVQEFETHGPAANEIKRLYEYTDIQLYKNREVV"
     misc_feature    13501..14097
                     /gene="parA"
                     /locus_tag="APA01_43720"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     misc_feature    13504..13905
                     /gene="parA"
                     /locus_tag="APA01_43720"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    13525..13545
                     /gene="parA"
                     /locus_tag="APA01_43720"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(13543..13545,13747..13749)
                     /gene="parA"
                     /locus_tag="APA01_43720"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            14160..14411
                     /locus_tag="APA01_43730"
                     /db_xref="GeneID:8426897"
     CDS             14160..14411
                     /locus_tag="APA01_43730"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189539.1"
                     /db_xref="GI:258513284"
                     /db_xref="GeneID:8426897"
                     /translation="MLDRAKGSGEAMPTPSPKPDISSRKPTLNGRKGTKLIGGHFSPE
                     VSTQLRIIAAEEGTTVQSLLGEALDDLFVKKGRIRIVSG"
     gene            complement(14447..15547)
                     /gene="repA"
                     /locus_tag="APA01_43740"
                     /db_xref="GeneID:8426865"
     CDS             complement(14447..15547)
                     /gene="repA"
                     /locus_tag="APA01_43740"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid replication initiator RepA"
                     /protein_id="YP_003189540.1"
                     /db_xref="GI:258513285"
                     /db_xref="GeneID:8426865"
                     /translation="MKPRIKPDRQRNPELALIVSETPNVDGRSVLLPERYPTPDLFIC
                     DVLDAIPKDDMASMEHPIFSLATKPDRRIFRYEHNGNTVEIVPSIKGLATIHDKDILI
                     YCISQLIAKMNQGELPNRTLHLTARDLLVWTNRQTDGDGYKRLRSAFERLAGTRITTN
                     IKADGEEVTEGFGLINEWRIVRKTNSGQMSEIKVTLSEWLFRMIEGRSVLTLHRDYFR
                     LRKPLERRIYELARKHCGAQEKWVVSIEILQKKTGASSHIRVFRSMLRDLAINNHLPD
                     YAVEINSNTVTFRNRETMDTVKVIEPKLQKPFVDPEGFHDARGVAPGYDVYALYDEWV
                     SWWNDSGQPELQNPSAAFVGFCRNRHKRNPIR"
     misc_feature    complement(14711..15394)
                     /gene="repA"
                     /locus_tag="APA01_43740"
                     /note="Replication initiator protein A; Region: RPA;
                     pfam10134"
                     /db_xref="CDD:255779"
     gene            16600..17007
                     /locus_tag="APA01_43750"
                     /db_xref="GeneID:8426903"
     CDS             16600..17007
                     /locus_tag="APA01_43750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189541.1"
                     /db_xref="GI:258513286"
                     /db_xref="GeneID:8426903"
                     /translation="MANDMNYQTAREADTLHRATVPHAVSARLIRARRALHVTLSNGV
                     EMSVPVDLLQDLHGASLNDLAEIEITPLGNDLHWPRLDADVLVEGLIHGIYGSRSWMA
                     AQMGRVGGSSASPAKAAAARRNGAKGGRPRNVA"
     misc_feature    16669..16881
                     /locus_tag="APA01_43750"
                     /note="Protein of unknown function (DUF2442); Region:
                     DUF2442; pfam10387"
                     /db_xref="CDD:255955"
     gene            17110..17337
                     /gene="mazE"
                     /locus_tag="APA01_43760"
                     /db_xref="GeneID:8426866"
     CDS             17110..17337
                     /gene="mazE"
                     /locus_tag="APA01_43760"
                     /note="Antitoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator MazE"
                     /protein_id="YP_003189542.1"
                     /db_xref="GI:258513287"
                     /db_xref="GeneID:8426866"
                     /translation="MVELKVRKFGNSLGVVLPKEVISRLNTQDGAPLYLTEAPDGGYR
                     LVPYDPDFESKMTKAEDIMRRYRDTLHVLAQ"
     misc_feature    17119..17334
                     /gene="mazE"
                     /locus_tag="APA01_43760"
                     /note="Antidote-toxin recognition MazE; Region:
                     Antitoxin-MazE; cl00877"
                     /db_xref="CDD:260674"
     gene            17334..17729
                     /locus_tag="APA01_43770"
                     /db_xref="GeneID:8426896"
     CDS             17334..17729
                     /locus_tag="APA01_43770"
                     /note="Prophage maintenance system killer protein"
                     /codon_start=1
                     /transl_table=11
                     /product="death-on-curing protein"
                     /protein_id="YP_003189543.1"
                     /db_xref="GI:258513288"
                     /db_xref="GeneID:8426896"
                     /translation="MTVFVWIDEREALILHDRLLGLHGGASGLRDAGLLKSALARPQQ
                     HAAYADPLDPVHLAAVYTAGIVKNHPFIDGNKRTGFVLGVLFLELNGYRFTAAQEDAA
                     NAVLALAAGQMDELGYAAFLTANVASERV"
     misc_feature    17376..>17633
                     /locus_tag="APA01_43770"
                     /note="Prophage maintenance system killer protein [General
                     function prediction only]; Region: Doc; COG3654"
                     /db_xref="CDD:226180"
     gene            17857..18102
                     /gene="phd/yefM"
                     /locus_tag="APA01_43780"
                     /db_xref="GeneID:8426867"
     CDS             17857..18102
                     /gene="phd/yefM"
                     /locus_tag="APA01_43780"
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein Phd/YefM"
                     /protein_id="YP_003189544.1"
                     /db_xref="GI:258513289"
                     /db_xref="GeneID:8426867"
                     /translation="MRTVNIHEAKTHLSRLIDAAMKGESFIIAKAGRPMVRVSPITAP
                     EELQQRRLGFLAGKIRVPEDFDRMGQDDIVSLFDGPA"
     misc_feature    17860..17979
                     /gene="phd/yefM"
                     /locus_tag="APA01_43780"
                     /note="Antitoxin of toxin-antitoxin stability system
                     N-terminal; Region: RelB_N; pfam12910"
                     /db_xref="CDD:257394"
     gene            18099..18485
                     /gene="pilT"
                     /locus_tag="APA01_43790"
                     /db_xref="GeneID:8426899"
     CDS             18099..18485
                     /gene="pilT"
                     /locus_tag="APA01_43790"
                     /codon_start=1
                     /transl_table=11
                     /product="pilus retraction motor protein PilT"
                     /protein_id="YP_003189545.1"
                     /db_xref="GI:258513290"
                     /db_xref="GeneID:8426899"
                     /translation="MRLLLDTHLLLWAAGEPDKLSARARTLMEDPGNDLVFSAASLWE
                     ITIKTGLGRADFQVDPHLLRRGLIENGYEELPITSQHALAVGQLPDVHRDPFDRILVA
                     QATVEGLLLLTHDPLVKAYPGPIEAV"
     misc_feature    18132..18467
                     /gene="pilT"
                     /locus_tag="APA01_43790"
                     /note="PIN domain of the VapC-like Sll0205 protein and
                     homologs; Region: PIN_Sll0205; cd09872"
                     /db_xref="CDD:189042"
     misc_feature    order(18228..18230,18387..18389,18441..18443)
                     /gene="pilT"
                     /locus_tag="APA01_43790"
                     /note="putative active site [active]"
                     /db_xref="CDD:189042"
     gene            18511..18687
                     /locus_tag="APA01_43800"
                     /db_xref="GeneID:8426900"
     CDS             18511..18687
                     /locus_tag="APA01_43800"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189546.1"
                     /db_xref="GI:258513291"
                     /db_xref="GeneID:8426900"
                     /translation="MPSLHSDEAAEDFVATVDLTRYDLSGFKPMRCEIEPKAAALNMR
                     LPASLLETDVAQTR"
     misc_feature    18511..18621
                     /locus_tag="APA01_43800"
                     /note="Protein of unknown function (DUF3680); Region:
                     DUF3680; pfam12441"
                     /db_xref="CDD:204919"
     gene            18772..19026
                     /locus_tag="APA01_43810"
                     /db_xref="GeneID:8426868"
     CDS             18772..19026
                     /locus_tag="APA01_43810"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189547.1"
                     /db_xref="GI:258513292"
                     /db_xref="GeneID:8426868"
                     /translation="MSRTYHHSRKYGRNHRWANQPDRCGYGGSREASESPNWYSHLHD
                     IRPGRHHDRHVARLIIKGDLDPVEAVFPYTGTRRPHEYYW"
     gene            complement(19122..19298)
                     /locus_tag="APA01_43820"
                     /db_xref="GeneID:8426869"
     CDS             complement(19122..19298)
                     /locus_tag="APA01_43820"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189548.1"
                     /db_xref="GI:258513293"
                     /db_xref="GeneID:8426869"
                     /translation="MTMTDLSDERAAKRDAIRKASNSTKPTVPADQVLALLDAELARI
                     QAAIDTLPTPRPTD"
     gene            complement(19295..19627)
                     /locus_tag="APA01_43830"
                     /db_xref="GeneID:8426870"
     CDS             complement(19295..19627)
                     /locus_tag="APA01_43830"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189549.1"
                     /db_xref="GI:258513294"
                     /db_xref="GeneID:8426870"
                     /translation="MAPEYPSPEWFSDTINRHQWMWNLNARFVARAAKRMTDTDAFIL
                     LNEAVNLEIAETAANLLREGVPEKIVADFVIAYSQTQRAELLDNVCDYAWRISAPVAA
                     TKHEAMKT"
     gene            complement(19731..19970)
                     /gene="traD"
                     /locus_tag="APA01_43840"
                     /db_xref="GeneID:8426871"
     CDS             complement(19731..19970)
                     /gene="traD"
                     /locus_tag="APA01_43840"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="YP_003189550.1"
                     /db_xref="GI:258513295"
                     /db_xref="GeneID:8426871"
                     /translation="MRDWAKARRERTHHLIELGGLVQKAGLVDLTDDDRATLLGAFLD
                     IAGQLQEGNETTPDDLKSRWRRAGLHAFDRHREHD"
     misc_feature    complement(19749..19958)
                     /gene="traD"
                     /locus_tag="APA01_43840"
                     /note="Conjugal transfer protein TraD; Region: TraD;
                     pfam06412"
                     /db_xref="CDD:253711"
     gene            complement(20035..20394)
                     /locus_tag="APA01_43850"
                     /db_xref="GeneID:8426906"
     CDS             complement(20035..20394)
                     /locus_tag="APA01_43850"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189551.1"
                     /db_xref="GI:258513296"
                     /db_xref="GeneID:8426906"
                     /translation="MSDAVLACVIKYATDQKNKGSIMRKPRDIDAELEELQKRARALK
                     AKRIVQFGELVEATGADTLSIEALAGVLLAAVEQADSKPEAVARWTERGAAFFQAGGK
                     KGSRKGTGNDQNGSAGA"
     misc_feature    complement(20098..20289)
                     /locus_tag="APA01_43850"
                     /note="Conjugal transfer protein TraD; Region: TraD;
                     pfam06412"
                     /db_xref="CDD:253711"
     gene            20491..23577
                     /gene="traA"
                     /locus_tag="APA01_43860"
                     /db_xref="GeneID:8426872"
     CDS             20491..23577
                     /gene="traA"
                     /locus_tag="APA01_43860"
                     /note="MobA/MobL family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer relaxase TraA"
                     /protein_id="YP_003189552.1"
                     /db_xref="GI:258513297"
                     /db_xref="GeneID:8426872"
                     /translation="MAIYHLHAKVISRATGRSAVAAAAYRAASRLHDVRLDRDHDFSN
                     KSGVVHSEILLPDGAPERFLDRATLWNEVEAIEKRKDAQLAREVEFSIPREMTQAQGI
                     ALARDFVREQFVERGMVADLNVHWDIGEDGQAKPHAHVMLSTRSVDENGFGAKERSWN
                     DKELLLTWRERWASLANERLAELDLDVRIDHRSFAAQGIDLEPQNKIGPAGMRREERG
                     EDAERVADHLEIARRNGERLLAEPHVALEALTRQQSTFTRQDMARFVDRQTVDAEQFT
                     AVMVRVEACPELVALGKDGHGRERFSTRAMIGVEQRLEEASLAMGQSQGHAVPLAVRR
                     AAMQHSGLGEEQALAVGEVTKSRDLSVVVGYAGTGKSTMLGVARAAWEEAGYRVRGAA
                     LSGIAAEGLEAGSGIESRTLASLERAWERGFDLLERGDVLVVDEAGMVGSRQMERVLS
                     VAREAGAKVVLVGDPEQLQAIEAGGAFRAVAERVGSVEITTVRRQREGWQQAATKELA
                     TGRTEQALGRYEAAGLVRGHDTLEEARAGVVAGWEEARQAAPEESQIMLAHRRVDVRA
                     LNEAAREIRRDAGELGDDVLVPTAQGERVFANGERVYFLRNDRELGVKNGTLGTVRSI
                     VGSAEAGDLAMSVQLDGPGGAGTGRVVSVSVAEYDALDHGYAATIHKSQGVTVDRAHV
                     LATGSMDRHGAYVALSRHRESVSVHWGRDDVGDRDGLVRRLSCERLKDTTLDYPHVRD
                     RDTGFARRRGLHVPESEIVVEREKAASGPRQDRQAEGVPMPDPASAQQKRGMFDGLDL
                     SVRPGRCTTEKDVSAGLDAGAGKGESGIEREAPVSPFAGLRLPRVQREQVPAGLDGFV
                     PGSDPLHQAVERYARAWVDAERMVRQELPVLEHQKKALLEAGRDLERIRRGGEADLRA
                     ALKHQPEIRQALYGLEGPARARKLVEGLEHEDRVRKRPDLRAARFVKTWDGLSREQQG
                     VAFKELKRDAQLESILREKSRELGIRKGSTLDHGLHPHQREQALSRSRSRGMDMGM"
     misc_feature    20491..23574
                     /gene="traA"
                     /locus_tag="APA01_43860"
                     /note="conjugal transfer relaxase TraA; Provisional;
                     Region: PRK13889"
                     /db_xref="CDD:237546"
     misc_feature    20581..21141
                     /gene="traA"
                     /locus_tag="APA01_43860"
                     /note="MobA/MobL family; Region: MobA_MobL; pfam03389"
                     /db_xref="CDD:251918"
     misc_feature    21511..22080
                     /gene="traA"
                     /locus_tag="APA01_43860"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:257919"
     misc_feature    22276..22608
                     /gene="traA"
                     /locus_tag="APA01_43860"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; cl19402"
                     /db_xref="CDD:267755"
     gene            23628..23894
                     /locus_tag="APA01_43870"
                     /db_xref="GeneID:8426904"
     CDS             23628..23894
                     /locus_tag="APA01_43870"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="YP_003189553.1"
                     /db_xref="GI:258513298"
                     /db_xref="GeneID:8426904"
                     /translation="MRSSVMSSVVIRNLPEETHRALKAQAMLHGRSTEAEIRTILEAA
                     VRPPQRVRLGSLLASIGREAGVREQDVTALQVRDQTPAEPLSFE"
     misc_feature    23643..23864
                     /locus_tag="APA01_43870"
                     /note="Plasmid stability protein [General function
                     prediction only]; Region: StbC; COG4691"
                     /db_xref="CDD:227035"
     gene            23891..24313
                     /locus_tag="APA01_43880"
                     /db_xref="GeneID:8426873"
     CDS             23891..24313
                     /locus_tag="APA01_43880"
                     /note="PIN domain"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="YP_003189554.1"
                     /db_xref="GI:258513299"
                     /db_xref="GeneID:8426873"
                     /translation="MILLDTNVISEPWKPVPEPRVLAWIDRQAIETLFLSAVTVAELR
                     FGIGAMPAGRRRSVLHERLEQEVLPLFAGRVLSFDLAASQAYAELMVRARSEGRAIGK
                     ADGYIAATAASRGYVVASRDVSPFEAAGVRVLNPWEDT"
     misc_feature    23897..24295
                     /locus_tag="APA01_43880"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    order(23900..23908,23915..23920,23924..23932,23954..23956,
                     23963..23965,23987..23989,23999..24004,24008..24016,
                     24020..24028,24077..24079,24086..24088,24113..24115,
                     24119..24127,24140..24142,24146..24151,24158..24163,
                     24170..24172,24191..24193,24197..24202,24206..24211,
                     24266..24268)
                     /locus_tag="APA01_43880"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    order(23903..23905,24014..24016,24200..24202,24254..24256)
                     /locus_tag="APA01_43880"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    order(23999..24004,24011..24016,24020..24025,24080..24085,
                     24092..24094,24122..24124,24137..24142,24146..24154,
                     24158..24163,24194..24199,24203..24205)
                     /locus_tag="APA01_43880"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     gene            24313..24540
                     /locus_tag="APA01_43890"
                     /db_xref="GeneID:8426874"
     CDS             24313..24540
                     /locus_tag="APA01_43890"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189555.1"
                     /db_xref="GI:258513300"
                     /db_xref="GeneID:8426874"
                     /translation="MSETDPAARAFEDLCAEMTVLRRSVEALPQAWRDNRPPDYTEDL
                     ARVVKAMNAVGMHMKAIDADFSHLRQFRVIL"
     misc_feature    <24337..24528
                     /locus_tag="APA01_43890"
                     /note="This domain superfamily is found in a variety of
                     structurally related metalloproteins, including the type I
                     extradiol dioxygenases, glyoxalase I and a group of
                     antibiotic resistance proteins; Region: Glo_EDI_BRP_like;
                     cl14632"
                     /db_xref="CDD:265436"
     gene            complement(24683..26068)
                     /locus_tag="APA01_43900"
                     /db_xref="GeneID:8426875"
     CDS             complement(24683..26068)
                     /locus_tag="APA01_43900"
                     /note="DDE (Asp,Asp,Glu) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189556.1"
                     /db_xref="GI:258513301"
                     /db_xref="GeneID:8426875"
                     /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDI
                     LGLSRRFAACFRDKRHPAFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLAS
                     GRLSGGRANCAALAGKSTLNRLERSGHKADRYCRIIADHEALATLFVTLFLDQHERAP
                     ARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYIFCGDHLLSATLRTADRDPGNE
                     ALADISRIVEQIRNRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDR
                     IASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTT
                     LPQGMSDPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYV
                     LLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALA
                     HARLRRLRQAI"
     misc_feature    complement(24686..26035)
                     /locus_tag="APA01_43900"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:257999"
     misc_feature    complement(24890..25585)
                     /locus_tag="APA01_43900"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            complement(26126..26365)
                     /locus_tag="APA01_43910"
                     /db_xref="GeneID:8426876"
     CDS             complement(26126..26365)
                     /locus_tag="APA01_43910"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="YP_003189557.1"
                     /db_xref="GI:258513302"
                     /db_xref="GeneID:8426876"
                     /translation="MLVGYMRVSSADERQSVDLQRDALIAAGVDARHIHSDKASGARD
                     DRPGLKTCLAWLKEGDTLVVWKLDAEISQKGCTSG"
     misc_feature    complement(<26162..26365)
                     /locus_tag="APA01_43910"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(<26162..26362)
                     /locus_tag="APA01_43910"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(26162..26164,26339..26341,26345..26347))
                     /locus_tag="APA01_43910"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(26339..26341)
                     /locus_tag="APA01_43910"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     gene            complement(26520..26993)
                     /gene="parA"
                     /locus_tag="APA01_43920"
                     /db_xref="GeneID:8426877"
     CDS             complement(26520..26993)
                     /gene="parA"
                     /locus_tag="APA01_43920"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning family protein ParA/MinD"
                     /protein_id="YP_003189558.1"
                     /db_xref="GI:258513303"
                     /db_xref="GeneID:8426877"
                     /translation="MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQ
                     GSLTNWWNRRTAATPDAGPKLIQLSPENLPDMTEKLRGKFDLVLIDTPPSTHDALRKI
                     ASKADMAVIPTKPTPDDLDAVGPVIRQLRGVVPMAFVISQITNKGSVHRTGTDIR"
     misc_feature    complement(<26559..26981)
                     /gene="parA"
                     /locus_tag="APA01_43920"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    complement(26571..26978)
                     /gene="parA"
                     /locus_tag="APA01_43920"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(26937..26957)
                     /gene="parA"
                     /locus_tag="APA01_43920"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(26724..26726,26937..26939))
                     /gene="parA"
                     /locus_tag="APA01_43920"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(28082..28381)
                     /gene="xre"
                     /locus_tag="APA01_43930"
                     /db_xref="GeneID:8426898"
     CDS             complement(28082..28381)
                     /gene="xre"
                     /locus_tag="APA01_43930"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_003189559.1"
                     /db_xref="GI:258513304"
                     /db_xref="GeneID:8426898"
                     /translation="MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRK
                     RTGLSQVRFAARYGFSAAAVRDWEQKRRTPEKAARTLLMLIDKEPQAVERVLVGV"
     misc_feature    complement(28139..28270)
                     /gene="xre"
                     /locus_tag="APA01_43930"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(28175..28177,28250..28252,28262..28264))
                     /gene="xre"
                     /locus_tag="APA01_43930"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(28178..28180,28253..28255))
                     /gene="xre"
                     /locus_tag="APA01_43930"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(28172..28177,28187..28189,28196..28198,
                     28229..28234))
                     /gene="xre"
                     /locus_tag="APA01_43930"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(28383..28721)
                     /gene="relEB"
                     /locus_tag="APA01_43940"
                     /db_xref="GeneID:8426907"
     CDS             complement(28383..28721)
                     /gene="relEB"
                     /locus_tag="APA01_43940"
                     /note="Toxin-antitoxin stability DNA-damage-inducible
                     system"
                     /codon_start=1
                     /transl_table=11
                     /product="translation repressor RelE/RelB/StbE"
                     /protein_id="YP_003189560.1"
                     /db_xref="GI:258513305"
                     /db_xref="GeneID:8426907"
                     /translation="MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTG
                     GVRKLRFAGSGRGKRGGVRVIWYVASDRIPVYALLIYGKNEQDDLTPDQKKAMASMAE
                     RIKKSDQGGT"
     misc_feature    complement(28419..>28592)
                     /gene="relEB"
                     /locus_tag="APA01_43940"
                     /note="Protein of unknown function (DUF1044); Region:
                     DUF1044; cl01955"
                     /db_xref="CDD:242799"
     gene            28802..29188
                     /locus_tag="APA01_43950"
                     /db_xref="GeneID:8426901"
     CDS             28802..29188
                     /locus_tag="APA01_43950"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189561.1"
                     /db_xref="GI:258513306"
                     /db_xref="GeneID:8426901"
                     /translation="MLSHLKSPGKTTMQPLIHRGSGLSQSDYDLKGHIMSKSSSPYVR
                     RLLWIVACFVGGFALLCVSGWALVVNGSTQDSAMVTVLRWLPVATGAITVAAGFFLLF
                     LPVPEDPEDFFLPDDTDGELERTDGK"
     misc_feature    28925..>29098
                     /locus_tag="APA01_43950"
                     /note="Tetraspanin family; Region: Tetraspannin;
                     pfam00335"
                     /db_xref="CDD:249779"
     gene            complement(29249..30058)
                     /locus_tag="APA01_43960"
                     /db_xref="GeneID:8426878"
     CDS             complement(29249..30058)
                     /locus_tag="APA01_43960"
                     /note="Oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="esterase/lipase"
                     /protein_id="YP_003189562.1"
                     /db_xref="GI:258513307"
                     /db_xref="GeneID:8426878"
                     /translation="MTEHLTKRWQTLPATPAPLASFKGQHAPINGCSLYYTEGGTGDD
                     VIIMLHGGMANSDYWGIQAAYLAKTHRVILVDSRGHGRSTLGDKPLSYAQMADDIIHL
                     MNHLEIPNASLVGWSDGGVQSIILASEHPDRIKRIFAYGPHMSASGLNLACSGNKVVN
                     AFVKRATEDYRELSPTPDKFDVFSKTLRGLWKWEHDAEFTEDRLNAIRCPAWVVGGDR
                     DEMIHRAHLEYLVAHIPDSSYMILPETSHFAFLQAPLLFNEALADFLSVKA"
     misc_feature    complement(29279..29923)
                     /locus_tag="APA01_43960"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    complement(<29642..29923)
                     /locus_tag="APA01_43960"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            complement(30133..30960)
                     /locus_tag="APA01_43970"
                     /db_xref="GeneID:8426879"
     CDS             complement(30133..30960)
                     /locus_tag="APA01_43970"
                     /note="Integrase core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189563.1"
                     /db_xref="GI:258513308"
                     /db_xref="GeneID:8426879"
                     /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAA
                     ENDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGHVWNHKRVYRIYRELELNLRIKPRR
                     RLVREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLP
                     ACRVVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAY
                     IERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
     misc_feature    complement(30655..30831)
                     /locus_tag="APA01_43970"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(30154..30825)
                     /locus_tag="APA01_43970"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: Tra5;
                     COG2801"
                     /db_xref="CDD:225361"
     misc_feature    complement(30271..30609)
                     /locus_tag="APA01_43970"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(30160..30357)
                     /locus_tag="APA01_43970"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(30957..31220)
                     /locus_tag="APA01_43980"
                     /db_xref="GeneID:8426880"
     CDS             complement(30957..31220)
                     /locus_tag="APA01_43980"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189564.1"
                     /db_xref="GI:258513309"
                     /db_xref="GeneID:8426880"
                     /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAK
                     YGGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
     misc_feature    complement(31005..31208)
                     /locus_tag="APA01_43980"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     gene            complement(31330..32517)
                     /locus_tag="APA01_43990"
                     /db_xref="GeneID:8426881"
     CDS             complement(31330..32517)
                     /locus_tag="APA01_43990"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189565.1"
                     /db_xref="GI:258513310"
                     /db_xref="GeneID:8426881"
                     /translation="MAELSDEELLAELGVSLETKKKAALTAEEERIIAGFEDICRFYE
                     EHGHAPAHGEDRDIFERLYAVRLDRIRALEKCRSLLAQRDPHGLLSVSGKEAESPDPD
                     TLDDDALLAELGIEAEPAAESITVLKHVKSRAEVRAAEEIASREPCKDFETFRPFFAQ
                     VQEDLKSGVRETRPFGQEAGIRQGEFFILKGQMVYVAHVGEEFETEYGRRDSRLRVIY
                     DNGTESDVLLRSLQRALYKDEAGRRITDPTVGPLFGTTVEPDDLESGTIYVLRSLSDN
                     PYIAQHRNLIHKIGVTGGDVKKRIANAKHDATYLLADVEVVATYKLFNINRTKLEKIF
                     HRVLAPAQIDLTIQDRFGHPVHPKEWFLVPINIVSQIVDKISDGSIDGFIYDPKTVGL
                     VKA"
     misc_feature    complement(31390..31725)
                     /locus_tag="APA01_43990"
                     /note="T5orf172 domain; Region: T5orf172; pfam10544"
                     /db_xref="CDD:256050"
     gene            complement(32510..34594)
                     /locus_tag="APA01_44000"
                     /db_xref="GeneID:8426882"
     CDS             complement(32510..34594)
                     /locus_tag="APA01_44000"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189566.1"
                     /db_xref="GI:258513311"
                     /db_xref="GeneID:8426882"
                     /translation="MTINPVIPAVSLRTGQTGLSARTNELGMRPMQEAVYEKRGEQYL
                     LIKSPPASGKSRALMFVALDKLAHQGVKKALIVVPERSIGGSFMNEPLSKFGFWADWI
                     VQPKWNLCNAPGSDEGQVARSKVKAVGEFLKSKDQTLVCTHATFRFAAEELGIAAFDG
                     CLVAVDEFHHVSADPKNRLGYYLNQLIARGETHIIAMTGSYFRGDAVAVLSPEDEGKF
                     ETVTYTYYQQLNGYQYLKELDLGYYFYTGSYLDAIDRVLDGTRKTIVHIPNVNSREST
                     TQKHKEVEHILSVLGDWEGEDEETGFHLVRRTDGRVLRIADLVEDEPVRRNKVVSALK
                     DPAQKNNRDHVDIIIALGMAKEGFDWIWCEQALTVGYRSSLTEIIQIIGRATRDAPGK
                     TRAEFINLIAEPDASQEKVTDAVNDMLKAIAASLLMEQVLTPRFEFTPKTEESAPLDG
                     YDYGEEGYKPNGTNVGFNAQTGQFHMEIKGLVSPKSPEAQRICREDLNEVVASFVQDK
                     PSLEHGLFDEETAPQELTQVRLGKIIRDRYPELSDEDQEAVRQHAVAAFNLTQKGQKA
                     AEEVTQAAGGEEKIGGNTALIEGMRKIAMNVRDLDIDLIDAINPFEEAYKILAKSMNA
                     ETLKQVQEVIAGRHIALTIEEARDLAKRALLFKKERGRLPELTSPDAWERKMAEGVAV
                     LARKTAEERANG"
     misc_feature    complement(33419..34510)
                     /locus_tag="APA01_44000"
                     /note="DNA or RNA helicases of superfamily II
                     [Transcription / DNA replication, recombination, and
                     repair]; Region: SSL2; COG1061"
                     /db_xref="CDD:223989"
     misc_feature    complement(33998..34471)
                     /locus_tag="APA01_44000"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(34430..34444)
                     /locus_tag="APA01_44000"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(34088..34099)
                     /locus_tag="APA01_44000"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(32690..>32989)
                     /locus_tag="APA01_44000"
                     /note="ABC transporter, phosphonate, periplasmic
                     substrate-binding protein; Region: Phosphonate-bd;
                     cl19131"
                     /db_xref="CDD:267484"
     misc_feature    complement(32600..32674)
                     /locus_tag="APA01_44000"
                     /note="Pseudomurein-binding repeat; Region: PMBR;
                     pfam09373"
                     /db_xref="CDD:117915"
     gene            complement(34598..37306)
                     /locus_tag="APA01_44010"
                     /db_xref="GeneID:8426883"
     CDS             complement(34598..37306)
                     /locus_tag="APA01_44010"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA methylase"
                     /protein_id="YP_003189567.1"
                     /db_xref="GI:258513312"
                     /db_xref="GeneID:8426883"
                     /translation="MNPVEIEEAVSRIAEAPFNPGEFPFEFLQAFGNRDVTIKRLRKD
                     NRSDVPGAVLQRNNIHLAVCPEGHVAQTLNLLRESPKTQSAKARFLLATDGVTFEAED
                     RTEDEHITDVFTHLADRFGFFLPLAGITTVQKIKNNPIDVKATSRLNRLYVELLKENP
                     DWATEERRHDMNHFMARLIFCFFAEDTGIFLNNLFTRTIQTMTEGATDQTHEVMAELF
                     RTMDLDTRNDDREKGGVKSWARDFPYVNGNLFSGTTDCPKFNKLARTYLLRAGELNWA
                     QINPDIFGSMIQAVADEGERGALGMHYTSVPNIRKVLNPLFLDGLREELEKAGQNTQK
                     LHALKERLSGIRVFDPACGSGNFLVIAYKDMRDIQSEIDDRLKIERAERKSVIPLANF
                     YGIEIRDFAVEIARLSLLIAEFQSDEIHIDQKQARLNVLPLKDTGHIICGNALERDWF
                     DVCAPQKSSEIYICGNPPYKGSQWQSAEQKADLEQIFGQRTKSWKSLDYVAGWFMKAA
                     DYGQKTGSSSAFVSTNSICQGRQVAILWPLIFGLNYEISFAHTSFKWANLAAHNAGVT
                     VAIIGIAPVSDCQKILFSNGNDGKTIRQETGHINAYLVPGSDVVVEKHSRPLSSVSDM
                     DFGSMPNDGGHLLLSWDDVERLRLTEHQKEKFIKPVYGSSEYIRGNMRFCIWVTDDLR
                     NEAFQIPSLKERFDNVCDQRIKSERLTTKELSKYPYKFGEVRQVGNEEIIAIPAISSE
                     NRPFLPVGVLPKGNIVTNKIYALYDAPLWNMALIASRLHWVWIGTVCVRMRTDFSYSN
                     TLGWNTFPVPTLTEKNRADLTRCAEDILLAREAHFPATIADLYDPDKMPDNLRAAHDR
                     NDEVLERIYIGRRFRNDTERLEKLFDLYSKMIAKKGGKMKKKKDAA"
     misc_feature    complement(34649..36784)
                     /locus_tag="APA01_44010"
                     /note="Type II restriction enzyme, methylase subunits
                     [Defense mechanisms]; Region: COG1002"
                     /db_xref="CDD:223934"
     misc_feature    complement(<35858..36277)
                     /locus_tag="APA01_44010"
                     /note="Methyltransferase domain; Region: Methyltransf_26;
                     pfam13659"
                     /db_xref="CDD:257966"
     gene            complement(37346..38440)
                     /gene="ftsA"
                     /locus_tag="APA01_44020"
                     /db_xref="GeneID:8426884"
     CDS             complement(37346..38440)
                     /gene="ftsA"
                     /locus_tag="APA01_44020"
                     /note="Yeast CDC2/30 and FtsA"
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation cAMP-inducing protein Fic"
                     /protein_id="YP_003189568.1"
                     /db_xref="GI:258513313"
                     /db_xref="GeneID:8426884"
                     /translation="MLTPTYHIRPLPPQAEIETVPVLKALVEANKALAELKGRAATIP
                     NQGILIDTLALQEAKASSEIENIVTTQDELFQADLFPEGPDSMAAKEVALYRDALHLG
                     FRLLKETDGLILNKGLIAIFQRLKKRGDGFRNTPGTALKNERTGEVVFVPPQDGREII
                     GHMSDLERFVNDDGLCDLDPLIKMALIHHQFESIHPFPDGNGRVGRILNVLYLTRTGL
                     LDIPILYLSRYITRHKDEYYHLLQKVRDEGAWEVWILYMLRAVAETSRITLELIEGMR
                     AQMATMKQRMRTELPKIYSQELLNNLFRHPYTKIEYVQSDLSIARQTAGKYLDQLSEK
                     GLLSKHRSGRSNYYINAPLVRLFLEVSGGA"
     misc_feature    complement(37388..38413)
                     /gene="ftsA"
                     /locus_tag="APA01_44020"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    complement(38129..38377)
                     /gene="ftsA"
                     /locus_tag="APA01_44020"
                     /note="Fic/DOC family N-terminal; Region: Fic_N;
                     pfam13784"
                     /db_xref="CDD:258068"
     misc_feature    complement(37802..38089)
                     /gene="ftsA"
                     /locus_tag="APA01_44020"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            complement(38767..39237)
                     /locus_tag="APA01_44030"
                     /db_xref="GeneID:8426895"
     CDS             complement(38767..39237)
                     /locus_tag="APA01_44030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189569.1"
                     /db_xref="GI:258513314"
                     /db_xref="GeneID:8426895"
                     /translation="MKESRKRTGSTISGLVRKHLSEIEKRMIEGESRDQILDWLKEET
                     GREIERTTFFTVFYRARKWAEKNKIKAAYLAALSAQPVQSVAPEPAILTSSKKKPKKH
                     VERAADKPEVRRENVLPENPTGQQRLRAALAIGKPPPVLDWEEDDRFAKYRNGK"
     gene            39775..40191
                     /locus_tag="APA01_44040"
                     /db_xref="GeneID:8426885"
     CDS             39775..40191
                     /locus_tag="APA01_44040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189570.1"
                     /db_xref="GI:258513315"
                     /db_xref="GeneID:8426885"
                     /translation="MRERKYTVRFTEDEAEWLQEVALDGNVSGYIRDTVLRQSKSDRK
                     LVSMNERLVDLGQDMRLVTDLLHDLDQKVAGTPTAPDATGSQEPEGIPDELMAMVLEI
                     LLLVRSFSAPHERQMAQADVAQIGLPIWRKANLRDR"
     gene            complement(40261..40644)
                     /locus_tag="APA01_44050"
                     /db_xref="GeneID:8426886"
     CDS             complement(40261..40644)
                     /locus_tag="APA01_44050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189571.1"
                     /db_xref="GI:258513316"
                     /db_xref="GeneID:8426886"
                     /translation="MRDRSVVASGRVFAPGEIVLADWRGDALPKEPNKLRPAVVVEDE
                     LFPPEWPNVMLVPLTDDENLVIPDLAVRIDPSADNGCSKSCWAISALLTTTSKHRLRI
                     TGSKVRPDQLFTIRRQIALLVGADG"
     misc_feature    complement(40276..40602)
                     /locus_tag="APA01_44050"
                     /note="PemK-like protein; Region: PemK; pfam02452"
                     /db_xref="CDD:251304"
     gene            complement(40637..40972)
                     /locus_tag="APA01_44060"
                     /db_xref="GeneID:8426887"
     CDS             complement(40637..40972)
                     /locus_tag="APA01_44060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189572.1"
                     /db_xref="GI:258513317"
                     /db_xref="GeneID:8426887"
                     /translation="MFGGDRLDLRVFLVVVEYIIVLQNQHTICMEEAMASPLSIRLDE
                     RLRLNLEQEAAASGIPLSQLVRDLLETGAKRARRDRIRRDSARVARYVAATPSAQELF
                     EETGGTHGA"
     gene            complement(41074..41559)
                     /locus_tag="APA01_44070"
                     /db_xref="GeneID:8426888"
     CDS             complement(41074..41559)
                     /locus_tag="APA01_44070"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="YP_003189573.1"
                     /db_xref="GI:258513318"
                     /db_xref="GeneID:8426888"
                     /translation="MKVDKIFTDKCSGGTRNRPALTEMLRYVREGDTIICHSIDRLAR
                     DLQDLLHLVETLTDRGVGVRFIKEAMTFEGNASPMQTMILQVMGSFAQFERSLIKERQ
                     REGQQAARARGKLPGRRKSLSPEQITELKARVSAHEPKARIARDLGISRETLYAYLKA
                     A"
     misc_feature    complement(41083..41559)
                     /locus_tag="APA01_44070"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    complement(41245..41556)
                     /locus_tag="APA01_44070"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(41278..41280,41290..41295,41299..41304,
                     41443..41445))
                     /locus_tag="APA01_44070"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(41428..41430,41437..41442))
                     /locus_tag="APA01_44070"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(41272..41274,41281..41283,41290..41295,
                     41302..41307,41314..41316,41407..41412,41425..41427))
                     /locus_tag="APA01_44070"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(41257..41259,41269..41271,41278..41280,
                     41290..41292,41299..41304,41311..41316,41350..41358))
                     /locus_tag="APA01_44070"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(41257..41259,41269..41271,41278..41280,
                     41290..41292,41299..41301,41356..41358))
                     /locus_tag="APA01_44070"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    complement(order(41254..41259,41275..41277))
                     /locus_tag="APA01_44070"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    complement(41086..41211)
                     /locus_tag="APA01_44070"
                     /note="Helix-turn-helix domain of Hin and related
                     proteins; Region: HTH_Hin_like; cd00569"
                     /db_xref="CDD:259851"
     misc_feature    complement(order(41089..41097,41101..41106,41200..41208))
                     /locus_tag="APA01_44070"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            complement(41753..43138)
                     /locus_tag="APA01_44080"
                     /db_xref="GeneID:8426889"
     CDS             complement(41753..43138)
                     /locus_tag="APA01_44080"
                     /note="DDE (Asp,Asp,Glu) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189574.1"
                     /db_xref="GI:258513319"
                     /db_xref="GeneID:8426889"
                     /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDI
                     LGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLAS
                     GRLSGGRANCAALAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAP
                     ARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKE
                     ALADIRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDR
                     IASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTT
                     LPQGMSDPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYV
                     LLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALA
                     HARLRRLRQAI"
     misc_feature    complement(41756..43105)
                     /locus_tag="APA01_44080"
                     /note="Transposase DDE domain group 1; Region:
                     DDE_Tnp_1_4; pfam13701"
                     /db_xref="CDD:257999"
     misc_feature    complement(41960..42655)
                     /locus_tag="APA01_44080"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     gene            43256..43723
                     /locus_tag="APA01_44090"
                     /db_xref="GeneID:8426890"
     CDS             43256..43723
                     /locus_tag="APA01_44090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003189575.1"
                     /db_xref="GI:258513320"
                     /db_xref="GeneID:8426890"
                     /translation="MTPQAYGQGIREEGLAASRRLEGVFEKAIGEVRKERQALASIVG
                     EANNRRDQWFYLIFIGLMAFLFGVGVAPLLFNHITWKNFDERVASFIVGGQDRWESGA
                     AMMRDARPEQWNSFMWEDRLVQDNMPKIRDCRIAATQVGQPKPCVITIKPDAQ"
     gene            complement(43809..45986)
                     /locus_tag="APA01_44100"
                     /db_xref="GeneID:8426891"
     CDS             complement(43809..45986)
                     /locus_tag="APA01_44100"
                     /note="Adhesin family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein"
                     /protein_id="YP_003189576.1"
                     /db_xref="GI:258513321"
                     /db_xref="GeneID:8426891"
                     /translation="MSIVNPSNGTPYLTPGTTTFTSGQVVSGVTVPSNSKEVLSSGAT
                     GMQQTIKEASGNTGGGEILVLSGAQLLQNTDAGVWLNEGKIIVHDGGFISGGAATAGG
                     ITTILSGGIAEEITAGNAGSIGTVIFSSGAILKGTTVARSGGTISGGTATSGAQIKVL
                     SGGVLTDADAAAFGNIVVSKGGRGQDIIISSGGGLGVAGIASDTTVNNGGVIEINSGG
                     VSNNNHVNNGGKIYADSGSILGLTSISSGGSAIVASGATISDVVTIQDGGTATIWNNT
                     SGTIDLSGDTNHGLTISGLESGGTVSTVISGWSGSKPGNSDSIDLPGVSADGASYAYP
                     SDDQVVVTLANGNTITLNIPGVKNTGFVLSDDHHGGASAEVCFLSGSMIRTSEGDVAV
                     EDIQIGDEVIAFDWRNDEDVVRQVVWVGKARATVRPDLPDDEAGWPVRILKDAIADGV
                     PYKDMLITAEHCLFFRDRFVPVRMLVNGVSIFYDKSITSYDYYHVETEQHSVITADGM
                     LTESYLDTGNRSSFRQEGKIATLRGAVKNWADHAGAPLGVERSFVEPLFRALQWRENS
                     VVGTKISTTKIETTTDPDLHLITQTGAVIRPMRKTAHHYSFMLPPNTESVRIVSRSSR
                     PSDVIGPFVDDRRYMGVAVADVQLQCAKQQFDITSHLQDEKPSGWHDTDWTDCAWTNG
                     NAELPLGDHLTHGKMGILSMTIRAAGPYLLNTKPNSDMKKHSA"
     misc_feature    complement(<45300..45749)
                     /locus_tag="APA01_44100"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09945"
                     /db_xref="CDD:137602"
     misc_feature    complement(44442..44864)
                     /locus_tag="APA01_44100"
                     /note="Hint domain; Region: Hint_2; pfam13403"
                     /db_xref="CDD:257728"
     gene            46313..46576
                     /locus_tag="APA01_44110"
                     /db_xref="GeneID:8426892"
     CDS             46313..46576
                     /locus_tag="APA01_44110"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189577.1"
                     /db_xref="GI:258513322"
                     /db_xref="GeneID:8426892"
                     /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAK
                     YGGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
     misc_feature    46325..46528
                     /locus_tag="APA01_44110"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     gene            46573..47400
                     /locus_tag="APA01_44120"
                     /db_xref="GeneID:8426893"
     CDS             46573..47400
                     /locus_tag="APA01_44120"
                     /note="Integrase core domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_003189578.1"
                     /db_xref="GI:258513323"
                     /db_xref="GeneID:8426893"
                     /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAA
                     ENDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYRELEFNLRIKPRR
                     RLVREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLP
                     ACRVVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAY
                     IERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
     misc_feature    <46744..46881
                     /locus_tag="APA01_44120"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    46924..47262
                     /locus_tag="APA01_44120"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    47176..47373
                     /locus_tag="APA01_44120"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            47575..47913
                     /gene="relEB"
                     /locus_tag="APA01_44130"
                     /db_xref="GeneID:8426894"
     CDS             47575..47913
                     /gene="relEB"
                     /locus_tag="APA01_44130"
                     /note="Toxin-antitoxin stability DNA-damage-inducible
                     system"
                     /codon_start=1
                     /transl_table=11
                     /product="translation repressor RelE/RelB/StbE"
                     /protein_id="YP_003189579.1"
                     /db_xref="GI:258513324"
                     /db_xref="GeneID:8426894"
                     /translation="MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTG
                     GVRKLRFAGSGRGKRGGVRVIWYVASDRIPVYALLIYGKNEQDDLTPDQKKAMASMAE
                     RIKKSDQGGT"
     misc_feature    <47704..47877
                     /gene="relEB"
                     /locus_tag="APA01_44130"
                     /note="Protein of unknown function (DUF1044); Region:
                     DUF1044; cl01955"
                     /db_xref="CDD:242799"
     gene            47915..48214
                     /gene="xre"
                     /locus_tag="APA01_44140"
                     /db_xref="GeneID:8426902"
     CDS             47915..48214
                     /gene="xre"
                     /locus_tag="APA01_44140"
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="YP_003189580.1"
                     /db_xref="GI:258513325"
                     /db_xref="GeneID:8426902"
                     /translation="MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRK
                     RTGLSQVRFAARYGFSAAAVRDWEQKRRTPEKAARTLLMLIDKEPQAVERVLVGV"
     misc_feature    48026..48157
                     /gene="xre"
                     /locus_tag="APA01_44140"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(48032..48034,48044..48046,48119..48121)
                     /gene="xre"
                     /locus_tag="APA01_44140"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(48041..48043,48116..48118)
                     /gene="xre"
                     /locus_tag="APA01_44140"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(48062..48067,48098..48100,48107..48109,48119..48124)
                     /gene="xre"
                     /locus_tag="APA01_44140"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            49303..49938
                     /gene="parA"
                     /locus_tag="APA01_44150"
                     /db_xref="GeneID:8426908"
     CDS             49303..49938
                     /gene="parA"
                     /locus_tag="APA01_44150"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning family protein ParA"
                     /protein_id="YP_003189581.1"
                     /db_xref="GI:258513326"
                     /db_xref="GeneID:8426908"
                     /translation="MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQ
                     GSLTNWWNRRTAATPDAGPKLIQLSPENLPDMTEKLRGKFDLVLIDTPPSTHDALRKI
                     ASKADMAVIPTKPTPDDLDAVGPVIRQLRGVVPMAFVISQITNKRSPDAVEATELLSA
                     RAPVIGRTVIRVGYYRAAGAGQSGFETDKTVREEIATVYDNLMALLGDYHA"
     misc_feature    49315..49920
                     /gene="parA"
                     /locus_tag="APA01_44150"
                     /note="ATPases involved in chromosome partitioning [Cell
                     division and chromosome partitioning]; Region: Soj;
                     COG1192"
                     /db_xref="CDD:224113"
     misc_feature    49318..49725
                     /gene="parA"
                     /locus_tag="APA01_44150"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    49339..49359
                     /gene="parA"
                     /locus_tag="APA01_44150"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(49357..49359,49570..49572)
                     /gene="parA"
                     /locus_tag="APA01_44150"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
CONTIG      join(AP011124.1:1..49961)
//
DBGET integrated database retrieval system