GenomeNet

Database: RefSeq
Entry: NC_013212
LinkDB: NC_013212
Original site: NC_013212 
LOCUS       NC_013212              49961 bp    DNA     circular CON 19-AUG-2015
DEFINITION  Acetobacter pasteurianus IFO 3283-01 plasmid pAPA01-030 DNA,
            complete genome.
ACCESSION   NC_013212
VERSION     NC_013212.1  GI:258513263
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000010825.1
KEYWORDS    RefSeq.
SOURCE      Acetobacter pasteurianus IFO 3283-01
  ORGANISM  Acetobacter pasteurianus IFO 3283-01
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhodospirillales;
            Acetobacteraceae; Acetobacter.
REFERENCE   1
  AUTHORS   Azuma,Y., Hosoyama,A., Matsutani,M., Furuya,N., Horikawa,H.,
            Harada,T., Hirakawa,H., Kuhara,S., Matsushita,K., Fujita,N. and
            Shirai,M.
  TITLE     Whole-genome analyses reveal genetic instability of Acetobacter
            pasteurianus
  JOURNAL   Nucleic Acids Res. 37 (17), 5768-5783 (2009)
   PUBMED   19638423
  REMARK    DOI:10.1093/nar/gkp612
REFERENCE   2  (bases 1 to 49961)
  AUTHORS   Azuma,Y. and Hosoyama,A.
  CONSRTM   Acetobacter pasteurianus genome sequencing consortium
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2009) Contact:Yoshinao Azuma Yamaguchi University
            School of Medicine, Department of Microbiology and Immunology;
            Minami-Kogushi 1-1-1, Ube, Yamaguchi 755-8505, Japan URL
            :http://www.bio.nite.go.jp/dogan/Top
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            AP011124.
            This work was done by Acetobacter pasteurianus genome sequencing
            consortium including Department of Microbiology and Immunology,
            Yamaguchi University School of Medicine, National Institute of
            Technology and Evaluation, Genetic Resources Technology, Faculty of
            Agriculture, Kyushu University, Department of Biological Chemistry,
            Faculty of Agriculture, Yamaguchi University and Mizkan Group
            Corporation Central Research Institute.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 08/12/2015 13:03:01
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 3,148
            CDS                                       3,019
            Pseudo Genes                           :: 55
            CRISPR Arrays                          :: 1
            rRNAs                                  :: 5, 5, 5 (5S, 16S, 23S)
            complete rRNAs                         :: 5, 5, 5 (5S, 16S, 23S)
            tRNAs                                  :: 57
            ncRNA                                  :: 1
            Frameshifted Genes                     :: 13
            Frameshifted Genes On Monomer Runs     :: 1
            Frameshifted Genes Not On Monomer Runs :: 0
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..49961
                     /organism="Acetobacter pasteurianus IFO 3283-01"
                     /mol_type="genomic DNA"
                     /sub_species="pasteurianus"
                     /db_xref="taxon:634452"
                     /plasmid="pAPA01-030"
     gene            join(49935..49961,1..300)
                     /locus_tag="APA01_RS15445"
                     /db_xref="GeneID:23318794"
     CDS             join(49935..49961,1..300)
                     /locus_tag="APA01_RS15445"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010686459.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_019089445.1"
                     /db_xref="GI:517919237"
                     /db_xref="GeneID:23318794"
                     /translation="MSKRPSLGSIGLDLDDIEAKPASGQKVAAFHEQALTQPPQDKPG
                     AYVKDKAVNMTVYLLPHDHKRLKQLAVEHDTTIQALVMDGLDVILKDNGQEPLTRWKT
                     RRKPRG"
     gene            510..1070
                     /locus_tag="APA01_RS15450"
                     /old_locus_tag="APA01_43530"
                     /db_xref="GeneID:8426909"
     CDS             510..1070
                     /locus_tag="APA01_RS15450"
                     /old_locus_tag="APA01_43530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041633465.1"
                     /db_xref="GI:753895301"
                     /db_xref="GeneID:8426909"
                     /translation="MAGQIVAYVRVSSADQNTDRQMFDGMTVDKTFTDKCSGGTRNRP
                     ALTEMLGYVREGDTIVCHSIDRLARDLGDLMHLVQTMTRRGVGVRFMKEGLTFTGEDS
                     PMQDLMMHIFGAVAQFERALIHERQKEGQIAARAKGKVPGRKPKLSPEQVTELYNRVA
                     THEPKAQIARDFGISRETLYAYLKAA"
     gene            1194..1433
                     /locus_tag="APA01_RS15455"
                     /old_locus_tag="APA01_43540"
                     /db_xref="GeneID:8426847"
     CDS             1194..1433
                     /locus_tag="APA01_RS15455"
                     /old_locus_tag="APA01_43540"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813361.1"
                     /db_xref="GI:502527012"
                     /db_xref="GeneID:8426847"
                     /translation="MSTTRWNIAVSSEVDQSVRMFLAANGGGRKGDLSRFIEDAVRSY
                     LLEQAVEQAKAASEDMSEAELADLVNEAVQWARGH"
     gene            1433..1855
                     /locus_tag="APA01_RS15460"
                     /old_locus_tag="APA01_43550"
                     /db_xref="GeneID:8426848"
     CDS             1433..1855
                     /locus_tag="APA01_RS15460"
                     /old_locus_tag="APA01_43550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_041633467.1"
                     /db_xref="GI:753895305"
                     /db_xref="GeneID:8426848"
                     /translation="MRVVLDTNILVSALIYPRGAPDAIYRAWRAHRFDLVTSTTQLEE
                     LRRVSRYPKLRSILPPHRVGAMINNMRKASVAEQLPTLPDDVTINDRDDVFLLTMVLA
                     FDADYLVTGDHRAGLLEKGRFQRARIVTPVDFCSIALD"
     gene            complement(1949..2206)
                     /locus_tag="APA01_RS15465"
                     /old_locus_tag="APA01_43560"
                     /db_xref="GeneID:8426849"
     CDS             complement(1949..2206)
                     /locus_tag="APA01_RS15465"
                     /old_locus_tag="APA01_43560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="WP_012813363.1"
                     /db_xref="GI:502527014"
                     /db_xref="GeneID:8426849"
                     /translation="MRDWAKARRERTHHLIELGGLVQKARLVDLTDDDRATLLGAFLD
                     IAGQLQGSNVTTPVDLKTRWRRAGLHAFDAEKEHVERKEQP"
     gene            complement(2253..3143)
                     /locus_tag="APA01_RS15470"
                     /old_locus_tag="APA01_43570"
                     /db_xref="GeneID:8426905"
     CDS             complement(2253..3143)
                     /locus_tag="APA01_RS15470"
                     /old_locus_tag="APA01_43570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813283.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012813364.1"
                     /db_xref="GI:502527015"
                     /db_xref="GeneID:8426905"
                     /translation="MTRFIEEHRQTYGVGSICRVLSIAPSAYYATVARQKNPCVRSQK
                     DKELCDDIRRVWNNNFCVYGARKVWHQLKREGVDVARCTVERLMRRMGLKGVIRGKGV
                     RTTRPDPQRPCPQDLVQRQFHAPAPNRLWVSDFTYVSTWQGFVYVAFIIDVFARVIVG
                     WRVSSTAHTDFVLDALEQALCQRRPEGKVTHHSDRGCQYVSILYTQRLAEAGLVASVG
                     SVGDSYDNALAETINGLYKTELIYRQGPWKNREAVELATLKWVDWFNNRRLLSSIGNI
                     PPAEAEARFYAQQKSHALAA"
     misc_feature    complement(3069..3185)
                     /note="AL1L pseudoknot; Derived by automated computational
                     analysis using gene prediction method: cmsearch."
     gene            complement(3140..3463)
                     /locus_tag="APA01_RS15475"
                     /old_locus_tag="APA01_43580"
                     /db_xref="GeneID:8426850"
     CDS             complement(3140..3463)
                     /locus_tag="APA01_RS15475"
                     /old_locus_tag="APA01_43580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006560345.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012813365.1"
                     /db_xref="GI:502527016"
                     /db_xref="GeneID:8426850"
                     /translation="MSNKSKRFPPEFRERAARMVLEEEKNHPSRWSAVMMIAPKLDIH
                     PDTLSKWTRLHERANAPAVSELPDREKIRQLERENRELRQANDILRKASAYFAQAELD
                     RIFKP"
     gene            3462..3941
                     /locus_tag="APA01_RS15480"
                     /old_locus_tag="APA01_43590"
                     /db_xref="GeneID:8426851"
     CDS             3462..3941
                     /locus_tag="APA01_RS15480"
                     /old_locus_tag="APA01_43590"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813366.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813366.1"
                     /db_xref="GI:502527017"
                     /db_xref="GeneID:8426851"
                     /translation="MNPSYLSGRSVSTKPGAIQPASRRLEGVFEKAIGEVRKERQALA
                     SIVGEANNRRDQWFYLIFIGLMAFLFGVGVAPLLFNHITWKNFDERVASFIVGGQDRW
                     ESGAAMMRDARPEQWNSFMWEDRLVQDNMPKIRDCRIAATQVGQPKPCVITIKPDAQ"
     repeat_region   3522..5757
     gene            complement(4027..6345)
                     /locus_tag="APA01_RS15485"
                     /old_locus_tag="APA01_43600"
                     /db_xref="GeneID:8426852"
     CDS             complement(4027..6345)
                     /locus_tag="APA01_RS15485"
                     /old_locus_tag="APA01_43600"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813367.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012813367.1"
                     /db_xref="GI:502527018"
                     /db_xref="GeneID:8426852"
                     /translation="MDYWNDTSVSNGETLNDITLTSANDTHDRLFVSSGGVANNVHVG
                     GGAYAYIYGGTISTITVSSGGLVHMVSGGTVKDLHVLSGGIGYIPSGTLSGSVIDNGG
                     LLEVLVSGSATSVTVENNGVVKIRSGGLINASNILSGGSIIVSSGGQSIGTVISSGGS
                     LTFTGGGSGSYTSLLAGGTLNIGSGTTYDNQHTTSLTATSGAQINVLSGGVLTDADAA
                     AFGNIVVSKGGRGQDIIISSGGGLGVAGIASDTTVNNGGVIEINSGGVSNNNHVNNGG
                     KIYADSGSILGLTSISSGGSAIVASGATISDVVTIQDGGTATIWNNTSGTIDLSGDTN
                     HGLTISGLESGGTVSTVISGWSGSKPGNSDSIDLPGVSADGASYAYPSDDQVVVTLAN
                     GNTITLNIPGVKNTGFVLSDDHHGGASAEVCFLSGSMIRTSEGDVAVEDIQIGDEVIA
                     FDWRNDEDVVRQVVWVGKARATVRPDLPDDEAGWPVRILKDAIADGVPYKDMLITAEH
                     CLFFRDRFVPVRMLVNGVSIFYDKSITSYDYYHVETEQHSVITADGMLTESYLDTGNR
                     SSFRQEGKIATLRGAVKNWADHAGAPLGVERSFVEPLFRALQWRENSVVGTKISTTKI
                     ETTTDPDLHLITQTGAVIRPMRKTAHHYSFMLPPNTESVRIVSRSSRPSDVIGPFVDD
                     RRYMGVAVADVQLQCAKQQFDITSHLQDEKPSGWHDTDWTDCAWTNGNAELPLGDHLT
                     HGKMGILSMTIRAAGPYLLNTKPNSDMKKHSA"
     repeat_region   6490..6756
     gene            complement(6764..7375)
                     /locus_tag="APA01_RS15490"
                     /db_xref="GeneID:23318795"
     CDS             complement(6764..7375)
                     /locus_tag="APA01_RS15490"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012812468.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041633469.1"
                     /db_xref="GI:753895309"
                     /db_xref="GeneID:23318795"
                     /translation="MVAGCAAFHPLGEARRMGAAARTGSGTTGSGIRNDFSGWHKHQG
                     SPQSGGSPKKGASFEERDHREALGRSRGGYGTKVCVIADGHGKAFGFALAPGQAHELP
                     LAPAMLDSLPATPLWVVADKGYASNAMRERIWDMGARPAIPAKRRDGPVACPKWAYRC
                     RHLVENLWARLKEWRAVATRYEKTATSFLVVIHIAAAADWIKP"
     repeat_region   7626..7742
     repeat_region   7877..9072
     gene            complement(7916..8743)
                     /locus_tag="APA01_RS15495"
                     /old_locus_tag="APA01_43650"
                     /db_xref="GeneID:8426857"
     CDS             complement(7916..8743)
                     /locus_tag="APA01_RS15495"
                     /old_locus_tag="APA01_43650"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012813371.1"
                     /db_xref="GI:502527022"
                     /db_xref="GeneID:8426857"
                     /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAA
                     ENDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYRELEFNLRIKPRR
                     RLVREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLP
                     ACRVVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAY
                     IERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
     gene            complement(8740..9003)
                     /locus_tag="APA01_RS15500"
                     /old_locus_tag="APA01_43660"
                     /db_xref="GeneID:8426858"
     CDS             complement(8740..9003)
                     /locus_tag="APA01_RS15500"
                     /old_locus_tag="APA01_43660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010516767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012813372.1"
                     /db_xref="GI:502527023"
                     /db_xref="GeneID:8426858"
                     /translation="MKSGRFTDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAK
                     YGGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
     gene            9099..9491
                     /locus_tag="APA01_RS15505"
                     /old_locus_tag="APA01_43670"
                     /db_xref="GeneID:8426859"
     CDS             9099..9491
                     /locus_tag="APA01_RS15505"
                     /old_locus_tag="APA01_43670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="WP_012813373.1"
                     /db_xref="GI:502527024"
                     /db_xref="GeneID:8426859"
                     /translation="MARSTFDLFAIVKEIIQKGAQFYSLSEPWADTTTSTGRLMLAVL
                     GGLADVERDLIRTRTAEGRARAVQLGVKMGRPTKIADIQRQDIIKRRQNGEFLKDIAE
                     DFGISVGTVSRITTGADSHKSRKNKKGF"
     gene            complement(9725..10318)
                     /locus_tag="APA01_RS15510"
                     /old_locus_tag="APA01_43680"
                     /db_xref="GeneID:8426860"
     CDS             complement(9725..10318)
                     /locus_tag="APA01_RS15510"
                     /old_locus_tag="APA01_43680"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003630649.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="WP_003630649.1"
                     /db_xref="GI:489726533"
                     /db_xref="GeneID:8426860"
                     /translation="MTHILIGYARCSTDKQDLAVQKQELLKLGVSADRIYTDKGFTGT
                     NRDRPGLDQALAAVRSGDTLVVPKLDRLARSVPDARAIGDSLAARGVKLQLGTSVHDP
                     SDPMGKLFFNILATFAEFEADLIKLRTREGMAVARAKGKLRGKKPKLSDRQQKELRRM
                     YDTGDYSISDLADLFSISRPTVYRTLGRQPVTSVLAA"
     gene            10437..11936
                     /locus_tag="APA01_RS15515"
                     /old_locus_tag="APA01_43690"
                     /db_xref="GeneID:8426861"
     CDS             10437..11936
                     /locus_tag="APA01_RS15515"
                     /old_locus_tag="APA01_43690"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003630651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012812886.1"
                     /db_xref="GI:502523259"
                     /db_xref="GeneID:8426861"
                     /translation="MILYRTGAITMADDRVLGTDSTEVAMRMAVLRPYLIDNVPLTKI
                     AVDAAIPIRTVRRWIARYRLSGPAGLMRPTRPDAGTRTFPKEMVELIEGMALLKPQSS
                     IATIHRRIVMLAAEQGWRKPSYGSVRSIVREINPAILTLAHEGSAAFRDKYELVHRHR
                     ASRPNATWQADHTQLDILILDAGGKAARPWLTTVMDDYSRVVAGYMVMLGAPSALNTS
                     LALRQAIWRKADPMWPVCGIPDVLHVDHGSDFTSLHLEQASADLHFRLIYSGVARPQG
                     RGKIERLFRTINTELLPELPGNLRNGKPSSPPRLSLAELDATIGDYIVSTYNTRPHST
                     IGVPPAKAWCGDGWLPRMPETVDELDTLLVMVARPRTVHRDGIRFEGLRYFDPTLAAY
                     VGEPVMIRYDPRDMGEIRIFHRNTFLCRAVSADHAGDSITLKDIQTARIAHRRHLRNQ
                     IAERKARVADFFPSPVFRPTQPAVPVTLSGTEAKGRQKGRRLRIYSEGD"
     gene            11936..12760
                     /locus_tag="APA01_RS15520"
                     /old_locus_tag="APA01_43700"
                     /db_xref="GeneID:8426862"
     CDS             11936..12760
                     /locus_tag="APA01_RS15520"
                     /old_locus_tag="APA01_43700"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_012813374.1"
                     /db_xref="GI:502527025"
                     /db_xref="GeneID:8426862"
                     /translation="MRTARTTSFIATQEHRRFSEFADAVRKHRYIGLCHGPAGVGKTL
                     SARRYTHWHVVGKTLEEWGPRGSDQAKVNAHLAKSRAIFFTPTVSCSVQELRHDVPAL
                     IACAEICIDDHVRPHIQGQARIIDHTTRYIELLIVDEAERLSMTALEWLRDLFDRQGI
                     SLIFIGMPGIDKRMARYPQLFSRVGFSHHYRPLQEQELTFVLTRRWRDLGLSLDGADF
                     TDAQAVAAIVRLTGGNFRLLHRLFVQIERIMRLNELTVITEDVVEAARSTLVIGVT"
     gene            12838..13455
                     /locus_tag="APA01_RS15525"
                     /old_locus_tag="APA01_43710"
                     /db_xref="GeneID:8426863"
     CDS             12838..13455
                     /locus_tag="APA01_RS15525"
                     /old_locus_tag="APA01_43710"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006559417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="WP_041633471.1"
                     /db_xref="GI:753895312"
                     /db_xref="GeneID:8426863"
                     /translation="MGQRAVIYCRVSTADQSCARQKDELKRFAERAGYEVLDVFMETG
                     SGVRVDRAERRNVMALAQAREIDAILVTELSRWGRSTIDLISTLQELESYRVSLIAIT
                     GMAFDLATPHGRMLATVLAGIAEFERDLISERVKSGLAAAKARGKVLGRQKGERPKSD
                     RLAPKVLALVAEKRSYRWIARDLGISKNTVAAIVQRDQVRPSLPS"
     gene            13498..14133
                     /locus_tag="APA01_RS15530"
                     /old_locus_tag="APA01_43720"
                     /db_xref="GeneID:8426864"
     CDS             13498..14133
                     /locus_tag="APA01_RS15530"
                     /old_locus_tag="APA01_43720"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006559416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine--protein transferase"
                     /protein_id="WP_012813376.1"
                     /db_xref="GI:502527027"
                     /db_xref="GeneID:8426864"
                     /translation="MKVLAVLSQKGGVGKTTLATCLAVAAEQAGKVAAIIDLDPQATA
                     SFWKDVRQLDTPAVASIQPIRLPAMLKACADAGTDLVIIDGAAVARDVAYEAARHADF
                     VLIPTKTAVFDTMSMTHTLDVVRQLDKAFAVVLTFVPPQGQETGDAIKAVTELGATVC
                     PVTVGNRKAFFRAQAAGQAVQEFETHGPAANEIKRLYEYTDIQLYKNREVV"
     gene            14160..14411
                     /locus_tag="APA01_RS15535"
                     /old_locus_tag="APA01_43730"
                     /db_xref="GeneID:8426897"
     CDS             14160..14411
                     /locus_tag="APA01_RS15535"
                     /old_locus_tag="APA01_43730"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006559415.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813377.1"
                     /db_xref="GI:502527028"
                     /db_xref="GeneID:8426897"
                     /translation="MLDRAKGSGEAMPTPSPKPDISSRKPTLNGRKGTKLIGGHFSPE
                     VSTQLRIIAAEEGTTVQSLLGEALDDLFVKKGRIRIVSG"
     gene            complement(14447..15547)
                     /locus_tag="APA01_RS15540"
                     /old_locus_tag="APA01_43740"
                     /db_xref="GeneID:8426865"
     CDS             complement(14447..15547)
                     /locus_tag="APA01_RS15540"
                     /old_locus_tag="APA01_43740"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010511350.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid replication initiator RepA"
                     /protein_id="WP_012813378.1"
                     /db_xref="GI:502527029"
                     /db_xref="GeneID:8426865"
                     /translation="MKPRIKPDRQRNPELALIVSETPNVDGRSVLLPERYPTPDLFIC
                     DVLDAIPKDDMASMEHPIFSLATKPDRRIFRYEHNGNTVEIVPSIKGLATIHDKDILI
                     YCISQLIAKMNQGELPNRTLHLTARDLLVWTNRQTDGDGYKRLRSAFERLAGTRITTN
                     IKADGEEVTEGFGLINEWRIVRKTNSGQMSEIKVTLSEWLFRMIEGRSVLTLHRDYFR
                     LRKPLERRIYELARKHCGAQEKWVVSIEILQKKTGASSHIRVFRSMLRDLAINNHLPD
                     YAVEINSNTVTFRNRETMDTVKVIEPKLQKPFVDPEGFHDARGVAPGYDVYALYDEWV
                     SWWNDSGQPELQNPSAAFVGFCRNRHKRNPIR"
     gene            16600..17007
                     /locus_tag="APA01_RS15545"
                     /old_locus_tag="APA01_43750"
                     /db_xref="GeneID:8426903"
     CDS             16600..17007
                     /locus_tag="APA01_RS15545"
                     /old_locus_tag="APA01_43750"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006560442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813379.1"
                     /db_xref="GI:502527030"
                     /db_xref="GeneID:8426903"
                     /translation="MANDMNYQTAREADTLHRATVPHAVSARLIRARRALHVTLSNGV
                     EMSVPVDLLQDLHGASLNDLAEIEITPLGNDLHWPRLDADVLVEGLIHGIYGSRSWMA
                     AQMGRVGGSSASPAKAAAARRNGAKGGRPRNVA"
     gene            17110..17337
                     /locus_tag="APA01_RS15550"
                     /old_locus_tag="APA01_43760"
                     /db_xref="GeneID:8426866"
     CDS             17110..17337
                     /locus_tag="APA01_RS15550"
                     /old_locus_tag="APA01_43760"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014106734.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_012813380.1"
                     /db_xref="GI:502527031"
                     /db_xref="GeneID:8426866"
                     /translation="MVELKVRKFGNSLGVVLPKEVISRLNTQDGAPLYLTEAPDGGYR
                     LVPYDPDFESKMTKAEDIMRRYRDTLHVLAQ"
     gene            17334..17729
                     /locus_tag="APA01_RS15555"
                     /old_locus_tag="APA01_43770"
                     /db_xref="GeneID:8426896"
     CDS             17334..17729
                     /locus_tag="APA01_RS15555"
                     /old_locus_tag="APA01_43770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019088713.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="death-on-curing protein"
                     /protein_id="WP_012813381.1"
                     /db_xref="GI:502527033"
                     /db_xref="GeneID:8426896"
                     /translation="MTVFVWIDEREALILHDRLLGLHGGASGLRDAGLLKSALARPQQ
                     HAAYADPLDPVHLAAVYTAGIVKNHPFIDGNKRTGFVLGVLFLELNGYRFTAAQEDAA
                     NAVLALAAGQMDELGYAAFLTANVASERV"
     gene            17857..18102
                     /locus_tag="APA01_RS15560"
                     /old_locus_tag="APA01_43780"
                     /db_xref="GeneID:8426867"
     CDS             17857..18102
                     /locus_tag="APA01_RS15560"
                     /old_locus_tag="APA01_43780"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006560453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death protein"
                     /protein_id="WP_006560453.1"
                     /db_xref="GI:493607987"
                     /db_xref="GeneID:8426867"
                     /translation="MRTVNIHEAKTHLSRLIDAAMKGESFIIAKAGRPMVRVSPITAP
                     EELQQRRLGFLAGKIRVPEDFDRMGQDDIVSLFDGPA"
     gene            18099..18485
                     /locus_tag="APA01_RS15565"
                     /old_locus_tag="APA01_43790"
                     /db_xref="GeneID:8426899"
     CDS             18099..18485
                     /locus_tag="APA01_RS15565"
                     /old_locus_tag="APA01_43790"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014106733.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="twitching motility protein PilT"
                     /protein_id="WP_012813382.1"
                     /db_xref="GI:502527034"
                     /db_xref="GeneID:8426899"
                     /translation="MRLLLDTHLLLWAAGEPDKLSARARTLMEDPGNDLVFSAASLWE
                     ITIKTGLGRADFQVDPHLLRRGLIENGYEELPITSQHALAVGQLPDVHRDPFDRILVA
                     QATVEGLLLLTHDPLVKAYPGPIEAV"
     gene            18755..18946
                     /locus_tag="APA01_RS15570"
                     /db_xref="GeneID:23318796"
     CDS             18755..18946
                     /locus_tag="APA01_RS15570"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010518061.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041633473.1"
                     /db_xref="GI:753895319"
                     /db_xref="GeneID:23318796"
                     /translation="MEGKLPCLAPIITAANTVAIIAGPTSRIAVAMEAHVKPLNLLTG
                     TVICTISVLAVIMTGMLPA"
     gene            complement(19295..19627)
                     /locus_tag="APA01_RS15575"
                     /old_locus_tag="APA01_43830"
                     /db_xref="GeneID:8426870"
     CDS             complement(19295..19627)
                     /locus_tag="APA01_RS15575"
                     /old_locus_tag="APA01_43830"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813386.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813386.1"
                     /db_xref="GI:502527038"
                     /db_xref="GeneID:8426870"
                     /translation="MAPEYPSPEWFSDTINRHQWMWNLNARFVARAAKRMTDTDAFIL
                     LNEAVNLEIAETAANLLREGVPEKIVADFVIAYSQTQRAELLDNVCDYAWRISAPVAA
                     TKHEAMKT"
     gene            complement(19731..19970)
                     /locus_tag="APA01_RS15580"
                     /old_locus_tag="APA01_43840"
                     /db_xref="GeneID:8426871"
     CDS             complement(19731..19970)
                     /locus_tag="APA01_RS15580"
                     /old_locus_tag="APA01_43840"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010512299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraD"
                     /protein_id="WP_012813387.1"
                     /db_xref="GI:502527039"
                     /db_xref="GeneID:8426871"
                     /translation="MRDWAKARRERTHHLIELGGLVQKAGLVDLTDDDRATLLGAFLD
                     IAGQLQEGNETTPDDLKSRWRRAGLHAFDRHREHD"
     gene            complement(20035..20328)
                     /locus_tag="APA01_RS15585"
                     /old_locus_tag="APA01_43850"
                     /db_xref="GeneID:8426906"
     CDS             complement(20035..20328)
                     /locus_tag="APA01_RS15585"
                     /old_locus_tag="APA01_43850"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_018308596.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraC"
                     /protein_id="WP_041633480.1"
                     /db_xref="GI:753895333"
                     /db_xref="GeneID:8426906"
                     /translation="MRKPRDIDAELEELQKRARALKAKRIVQFGELVEATGADTLSIE
                     ALAGVLLAAVEQADSKPEAVARWTERGAAFFQAGGKKGSRKGTGNDQNGSAGA"
     gene            20491..23577
                     /locus_tag="APA01_RS15590"
                     /old_locus_tag="APA01_43860"
                     /db_xref="GeneID:8426872"
     CDS             20491..23577
                     /locus_tag="APA01_RS15590"
                     /old_locus_tag="APA01_43860"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019088721.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TrbA"
                     /protein_id="WP_012813389.1"
                     /db_xref="GI:502527041"
                     /db_xref="GeneID:8426872"
                     /translation="MAIYHLHAKVISRATGRSAVAAAAYRAASRLHDVRLDRDHDFSN
                     KSGVVHSEILLPDGAPERFLDRATLWNEVEAIEKRKDAQLAREVEFSIPREMTQAQGI
                     ALARDFVREQFVERGMVADLNVHWDIGEDGQAKPHAHVMLSTRSVDENGFGAKERSWN
                     DKELLLTWRERWASLANERLAELDLDVRIDHRSFAAQGIDLEPQNKIGPAGMRREERG
                     EDAERVADHLEIARRNGERLLAEPHVALEALTRQQSTFTRQDMARFVDRQTVDAEQFT
                     AVMVRVEACPELVALGKDGHGRERFSTRAMIGVEQRLEEASLAMGQSQGHAVPLAVRR
                     AAMQHSGLGEEQALAVGEVTKSRDLSVVVGYAGTGKSTMLGVARAAWEEAGYRVRGAA
                     LSGIAAEGLEAGSGIESRTLASLERAWERGFDLLERGDVLVVDEAGMVGSRQMERVLS
                     VAREAGAKVVLVGDPEQLQAIEAGGAFRAVAERVGSVEITTVRRQREGWQQAATKELA
                     TGRTEQALGRYEAAGLVRGHDTLEEARAGVVAGWEEARQAAPEESQIMLAHRRVDVRA
                     LNEAAREIRRDAGELGDDVLVPTAQGERVFANGERVYFLRNDRELGVKNGTLGTVRSI
                     VGSAEAGDLAMSVQLDGPGGAGTGRVVSVSVAEYDALDHGYAATIHKSQGVTVDRAHV
                     LATGSMDRHGAYVALSRHRESVSVHWGRDDVGDRDGLVRRLSCERLKDTTLDYPHVRD
                     RDTGFARRRGLHVPESEIVVEREKAASGPRQDRQAEGVPMPDPASAQQKRGMFDGLDL
                     SVRPGRCTTEKDVSAGLDAGAGKGESGIEREAPVSPFAGLRLPRVQREQVPAGLDGFV
                     PGSDPLHQAVERYARAWVDAERMVRQELPVLEHQKKALLEAGRDLERIRRGGEADLRA
                     ALKHQPEIRQALYGLEGPARARKLVEGLEHEDRVRKRPDLRAARFVKTWDGLSREQQG
                     VAFKELKRDAQLESILREKSRELGIRKGSTLDHGLHPHQREQALSRSRSRGMDMGM"
     gene            23643..23894
                     /locus_tag="APA01_RS15595"
                     /old_locus_tag="APA01_43870"
                     /db_xref="GeneID:8426904"
     CDS             23643..23894
                     /locus_tag="APA01_RS15595"
                     /old_locus_tag="APA01_43870"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012555439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_041633476.1"
                     /db_xref="GI:753895325"
                     /db_xref="GeneID:8426904"
                     /translation="MSSVVIRNLPEETHRALKAQAMLHGRSTEAEIRTILEAAVRPPQ
                     RVRLGSLLASIGREAGVREQDVTALQVRDQTPAEPLSFE"
     gene            23891..24313
                     /locus_tag="APA01_RS15600"
                     /old_locus_tag="APA01_43880"
                     /db_xref="GeneID:8426873"
     CDS             23891..24313
                     /locus_tag="APA01_RS15600"
                     /old_locus_tag="APA01_43880"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813391.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stability protein StbB"
                     /protein_id="WP_012813391.1"
                     /db_xref="GI:502527043"
                     /db_xref="GeneID:8426873"
                     /translation="MILLDTNVISEPWKPVPEPRVLAWIDRQAIETLFLSAVTVAELR
                     FGIGAMPAGRRRSVLHERLEQEVLPLFAGRVLSFDLAASQAYAELMVRARSEGRAIGK
                     ADGYIAATAASRGYVVASRDVSPFEAAGVRVLNPWEDT"
     gene            24313..24540
                     /locus_tag="APA01_RS15605"
                     /old_locus_tag="APA01_43890"
                     /db_xref="GeneID:8426874"
     CDS             24313..24540
                     /locus_tag="APA01_RS15605"
                     /old_locus_tag="APA01_43890"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813392.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813392.1"
                     /db_xref="GI:502527044"
                     /db_xref="GeneID:8426874"
                     /translation="MSETDPAARAFEDLCAEMTVLRRSVEALPQAWRDNRPPDYTEDL
                     ARVVKAMNAVGMHMKAIDADFSHLRQFRVIL"
     repeat_region   24496..26163
     gene            complement(24683..25984)
                     /locus_tag="APA01_RS15610"
                     /old_locus_tag="APA01_43900"
                     /db_xref="GeneID:8426875"
     CDS             complement(24683..25984)
                     /locus_tag="APA01_RS15610"
                     /old_locus_tag="APA01_43900"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014457060.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041633315.1"
                     /db_xref="GI:753894579"
                     /db_xref="GeneID:8426875"
                     /translation="MSSDGGVILVKQADDILGLSRRFAACFRDKRHPAFVEYRVEDLV
                     RQRIMGLALGYEDLNDHDALRHDLIFGLASGRLSGGRANCAALAGKSTLNRLERSGHK
                     ADRYCRIIADHEALATLFVTLFLDQHERAPARIVLDVDATDDRIHGHQEGRAFHGYYG
                     HNCYLPLYIFCGDHLLSATLRTADRDPGNEALADISRIVEQIRNRWPRVRILVRGDSG
                     FARDSLMTWCEDNHVDFLFGLAGNTRLYDRIASLSAEVRDEAATTGRAARGFASFDWI
                     TKDSWTRRRRVVAKAEWRHGNRYHRFIVTTLPQGMSDPRHLYEQIYCARGDMENRIKE
                     CQMDLFSDRTSSHTIRANQLRLWFSAAAYVLLTALQRLALGQTSLETATCGTIRARLL
                     KIATRVTLSVRRIVLSMPDMFPCQHEFALAHARLRRLRQAI"
     gene            complement(<26147..26365)
                     /locus_tag="APA01_RS15615"
                     /old_locus_tag="APA01_43910"
                     /pseudo
                     /db_xref="GeneID:8426876"
     CDS             complement(<26147..26365)
                     /locus_tag="APA01_RS15615"
                     /old_locus_tag="APA01_43910"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019087712.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /db_xref="GeneID:8426876"
     gene            complement(26520..26993)
                     /locus_tag="APA01_RS15620"
                     /old_locus_tag="APA01_43920"
                     /db_xref="GeneID:8426877"
     CDS             complement(26520..26993)
                     /locus_tag="APA01_RS15620"
                     /old_locus_tag="APA01_43920"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813394.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine--protein transferase"
                     /protein_id="WP_012813394.1"
                     /db_xref="GI:502527046"
                     /db_xref="GeneID:8426877"
                     /translation="MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQ
                     GSLTNWWNRRTAATPDAGPKLIQLSPENLPDMTEKLRGKFDLVLIDTPPSTHDALRKI
                     ASKADMAVIPTKPTPDDLDAVGPVIRQLRGVVPMAFVISQITNKGSVHRTGTDIR"
     repeat_region   26556..28857
     gene            complement(28082..28381)
                     /locus_tag="APA01_RS15625"
                     /old_locus_tag="APA01_43930"
                     /db_xref="GeneID:8426898"
     CDS             complement(28082..28381)
                     /locus_tag="APA01_RS15625"
                     /old_locus_tag="APA01_43930"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_012813395.1"
                     /db_xref="GI:502527047"
                     /db_xref="GeneID:8426898"
                     /translation="MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRK
                     RTGLSQVRFAARYGFSAAAVRDWEQKRRTPEKAARTLLMLIDKEPQAVERVLVGV"
     gene            complement(28383..28721)
                     /locus_tag="APA01_RS15630"
                     /old_locus_tag="APA01_43940"
                     /db_xref="GeneID:8426907"
     CDS             complement(28383..28721)
                     /locus_tag="APA01_RS15630"
                     /old_locus_tag="APA01_43940"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation repressor RelE/RelB/StbE"
                     /protein_id="WP_012813396.1"
                     /db_xref="GI:502527048"
                     /db_xref="GeneID:8426907"
                     /translation="MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTG
                     GVRKLRFAGSGRGKRGGVRVIWYVASDRIPVYALLIYGKNEQDDLTPDQKKAMASMAE
                     RIKKSDQGGT"
     gene            28904..29188
                     /locus_tag="APA01_RS15635"
                     /db_xref="GeneID:23318797"
     CDS             28904..29188
                     /locus_tag="APA01_RS15635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019089638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041633485.1"
                     /db_xref="GI:753895342"
                     /db_xref="GeneID:23318797"
                     /translation="MSKSSSPYVRRLLWIVACFVGGFALLCVSGWALVVNGSTQDSAM
                     VTVLRWLPVATGAITVAAGFFLLFLPVPEDPEDFFLPDDTDGELERTDGK"
     gene            complement(29249..30058)
                     /locus_tag="APA01_RS15640"
                     /old_locus_tag="APA01_43960"
                     /db_xref="GeneID:8426878"
     CDS             complement(29249..30058)
                     /locus_tag="APA01_RS15640"
                     /old_locus_tag="APA01_43960"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="esterase"
                     /protein_id="WP_012813398.1"
                     /db_xref="GI:502527050"
                     /db_xref="GeneID:8426878"
                     /translation="MTEHLTKRWQTLPATPAPLASFKGQHAPINGCSLYYTEGGTGDD
                     VIIMLHGGMANSDYWGIQAAYLAKTHRVILVDSRGHGRSTLGDKPLSYAQMADDIIHL
                     MNHLEIPNASLVGWSDGGVQSIILASEHPDRIKRIFAYGPHMSASGLNLACSGNKVVN
                     AFVKRATEDYRELSPTPDKFDVFSKTLRGLWKWEHDAEFTEDRLNAIRCPAWVVGGDR
                     DEMIHRAHLEYLVAHIPDSSYMILPETSHFAFLQAPLLFNEALADFLSVKA"
     repeat_region   30094..31290
     gene            complement(30133..30960)
                     /locus_tag="APA01_RS15645"
                     /old_locus_tag="APA01_43970"
                     /db_xref="GeneID:8426879"
     CDS             complement(30133..30960)
                     /locus_tag="APA01_RS15645"
                     /old_locus_tag="APA01_43970"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012813109.1"
                     /db_xref="GI:502526225"
                     /db_xref="GeneID:8426879"
                     /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAA
                     ENDRIADLLVGLTQAHRRWGFGLCFLYLRNVQGHVWNHKRVYRIYRELELNLRIKPRR
                     RLVREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLP
                     ACRVVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAY
                     IERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
     gene            complement(30957..31220)
                     /locus_tag="APA01_RS15650"
                     /old_locus_tag="APA01_43980"
                     /db_xref="GeneID:8426880"
     CDS             complement(30957..31220)
                     /locus_tag="APA01_RS15650"
                     /old_locus_tag="APA01_43980"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010516767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012812704.1"
                     /db_xref="GI:502522386"
                     /db_xref="GeneID:8426880"
                     /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAK
                     YGGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
     gene            complement(31330..32517)
                     /locus_tag="APA01_RS15655"
                     /old_locus_tag="APA01_43990"
                     /db_xref="GeneID:8426881"
     CDS             complement(31330..32517)
                     /locus_tag="APA01_RS15655"
                     /old_locus_tag="APA01_43990"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813399.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813399.1"
                     /db_xref="GI:502527051"
                     /db_xref="GeneID:8426881"
                     /translation="MAELSDEELLAELGVSLETKKKAALTAEEERIIAGFEDICRFYE
                     EHGHAPAHGEDRDIFERLYAVRLDRIRALEKCRSLLAQRDPHGLLSVSGKEAESPDPD
                     TLDDDALLAELGIEAEPAAESITVLKHVKSRAEVRAAEEIASREPCKDFETFRPFFAQ
                     VQEDLKSGVRETRPFGQEAGIRQGEFFILKGQMVYVAHVGEEFETEYGRRDSRLRVIY
                     DNGTESDVLLRSLQRALYKDEAGRRITDPTVGPLFGTTVEPDDLESGTIYVLRSLSDN
                     PYIAQHRNLIHKIGVTGGDVKKRIANAKHDATYLLADVEVVATYKLFNINRTKLEKIF
                     HRVLAPAQIDLTIQDRFGHPVHPKEWFLVPINIVSQIVDKISDGSIDGFIYDPKTVGL
                     VKA"
     gene            complement(32510..34594)
                     /locus_tag="APA01_RS15660"
                     /old_locus_tag="APA01_44000"
                     /db_xref="GeneID:8426882"
     CDS             complement(32510..34594)
                     /locus_tag="APA01_RS15660"
                     /old_locus_tag="APA01_44000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010511343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DEAD/DEAH box helicase"
                     /protein_id="WP_012813400.1"
                     /db_xref="GI:502527056"
                     /db_xref="GeneID:8426882"
                     /translation="MTINPVIPAVSLRTGQTGLSARTNELGMRPMQEAVYEKRGEQYL
                     LIKSPPASGKSRALMFVALDKLAHQGVKKALIVVPERSIGGSFMNEPLSKFGFWADWI
                     VQPKWNLCNAPGSDEGQVARSKVKAVGEFLKSKDQTLVCTHATFRFAAEELGIAAFDG
                     CLVAVDEFHHVSADPKNRLGYYLNQLIARGETHIIAMTGSYFRGDAVAVLSPEDEGKF
                     ETVTYTYYQQLNGYQYLKELDLGYYFYTGSYLDAIDRVLDGTRKTIVHIPNVNSREST
                     TQKHKEVEHILSVLGDWEGEDEETGFHLVRRTDGRVLRIADLVEDEPVRRNKVVSALK
                     DPAQKNNRDHVDIIIALGMAKEGFDWIWCEQALTVGYRSSLTEIIQIIGRATRDAPGK
                     TRAEFINLIAEPDASQEKVTDAVNDMLKAIAASLLMEQVLTPRFEFTPKTEESAPLDG
                     YDYGEEGYKPNGTNVGFNAQTGQFHMEIKGLVSPKSPEAQRICREDLNEVVASFVQDK
                     PSLEHGLFDEETAPQELTQVRLGKIIRDRYPELSDEDQEAVRQHAVAAFNLTQKGQKA
                     AEEVTQAAGGEEKIGGNTALIEGMRKIAMNVRDLDIDLIDAINPFEEAYKILAKSMNA
                     ETLKQVQEVIAGRHIALTIEEARDLAKRALLFKKERGRLPELTSPDAWERKMAEGVAV
                     LARKTAEERANG"
     gene            complement(34598..37306)
                     /locus_tag="APA01_RS15665"
                     /old_locus_tag="APA01_44010"
                     /db_xref="GeneID:8426883"
     CDS             complement(34598..37306)
                     /locus_tag="APA01_RS15665"
                     /old_locus_tag="APA01_44010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lactate dehydrogenase"
                     /protein_id="WP_012813401.1"
                     /db_xref="GI:502527059"
                     /db_xref="GeneID:8426883"
                     /translation="MNPVEIEEAVSRIAEAPFNPGEFPFEFLQAFGNRDVTIKRLRKD
                     NRSDVPGAVLQRNNIHLAVCPEGHVAQTLNLLRESPKTQSAKARFLLATDGVTFEAED
                     RTEDEHITDVFTHLADRFGFFLPLAGITTVQKIKNNPIDVKATSRLNRLYVELLKENP
                     DWATEERRHDMNHFMARLIFCFFAEDTGIFLNNLFTRTIQTMTEGATDQTHEVMAELF
                     RTMDLDTRNDDREKGGVKSWARDFPYVNGNLFSGTTDCPKFNKLARTYLLRAGELNWA
                     QINPDIFGSMIQAVADEGERGALGMHYTSVPNIRKVLNPLFLDGLREELEKAGQNTQK
                     LHALKERLSGIRVFDPACGSGNFLVIAYKDMRDIQSEIDDRLKIERAERKSVIPLANF
                     YGIEIRDFAVEIARLSLLIAEFQSDEIHIDQKQARLNVLPLKDTGHIICGNALERDWF
                     DVCAPQKSSEIYICGNPPYKGSQWQSAEQKADLEQIFGQRTKSWKSLDYVAGWFMKAA
                     DYGQKTGSSSAFVSTNSICQGRQVAILWPLIFGLNYEISFAHTSFKWANLAAHNAGVT
                     VAIIGIAPVSDCQKILFSNGNDGKTIRQETGHINAYLVPGSDVVVEKHSRPLSSVSDM
                     DFGSMPNDGGHLLLSWDDVERLRLTEHQKEKFIKPVYGSSEYIRGNMRFCIWVTDDLR
                     NEAFQIPSLKERFDNVCDQRIKSERLTTKELSKYPYKFGEVRQVGNEEIIAIPAISSE
                     NRPFLPVGVLPKGNIVTNKIYALYDAPLWNMALIASRLHWVWIGTVCVRMRTDFSYSN
                     TLGWNTFPVPTLTEKNRADLTRCAEDILLAREAHFPATIADLYDPDKMPDNLRAAHDR
                     NDEVLERIYIGRRFRNDTERLEKLFDLYSKMIAKKGGKMKKKKDAA"
     gene            complement(37346..38440)
                     /locus_tag="APA01_RS15670"
                     /old_locus_tag="APA01_44020"
                     /db_xref="GeneID:8426884"
     CDS             complement(37346..38440)
                     /locus_tag="APA01_RS15670"
                     /old_locus_tag="APA01_44020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019088725.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell filamentation protein Fic"
                     /protein_id="WP_012813402.1"
                     /db_xref="GI:502527065"
                     /db_xref="GeneID:8426884"
                     /translation="MLTPTYHIRPLPPQAEIETVPVLKALVEANKALAELKGRAATIP
                     NQGILIDTLALQEAKASSEIENIVTTQDELFQADLFPEGPDSMAAKEVALYRDALHLG
                     FRLLKETDGLILNKGLIAIFQRLKKRGDGFRNTPGTALKNERTGEVVFVPPQDGREII
                     GHMSDLERFVNDDGLCDLDPLIKMALIHHQFESIHPFPDGNGRVGRILNVLYLTRTGL
                     LDIPILYLSRYITRHKDEYYHLLQKVRDEGAWEVWILYMLRAVAETSRITLELIEGMR
                     AQMATMKQRMRTELPKIYSQELLNNLFRHPYTKIEYVQSDLSIARQTAGKYLDQLSEK
                     GLLSKHRSGRSNYYINAPLVRLFLEVSGGA"
     gene            complement(38767..39237)
                     /locus_tag="APA01_RS15675"
                     /old_locus_tag="APA01_44030"
                     /db_xref="GeneID:8426895"
     CDS             complement(38767..39237)
                     /locus_tag="APA01_RS15675"
                     /old_locus_tag="APA01_44030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813403.1"
                     /db_xref="GI:502527067"
                     /db_xref="GeneID:8426895"
                     /translation="MKESRKRTGSTISGLVRKHLSEIEKRMIEGESRDQILDWLKEET
                     GREIERTTFFTVFYRARKWAEKNKIKAAYLAALSAQPVQSVAPEPAILTSSKKKPKKH
                     VERAADKPEVRRENVLPENPTGQQRLRAALAIGKPPPVLDWEEDDRFAKYRNGK"
     gene            39775..40191
                     /locus_tag="APA01_RS15680"
                     /old_locus_tag="APA01_44040"
                     /db_xref="GeneID:8426885"
     CDS             39775..40191
                     /locus_tag="APA01_RS15680"
                     /old_locus_tag="APA01_44040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010512442.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813404.1"
                     /db_xref="GI:502527068"
                     /db_xref="GeneID:8426885"
                     /translation="MRERKYTVRFTEDEAEWLQEVALDGNVSGYIRDTVLRQSKSDRK
                     LVSMNERLVDLGQDMRLVTDLLHDLDQKVAGTPTAPDATGSQEPEGIPDELMAMVLEI
                     LLLVRSFSAPHERQMAQADVAQIGLPIWRKANLRDR"
     gene            complement(40261..40647)
                     /locus_tag="APA01_RS15685"
                     /old_locus_tag="APA01_44050"
                     /db_xref="GeneID:8426886"
     CDS             complement(40261..40647)
                     /locus_tag="APA01_RS15685"
                     /old_locus_tag="APA01_44050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_003631194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_003631194.1"
                     /db_xref="GI:489727078"
                     /db_xref="GeneID:8426886"
                     /translation="MVRDRSVVASGRVFAPGEIVLADWRGDALPKEPNKLRPAVVVED
                     ELFPPEWPNVMLVPLTDDENLVIPDLAVRIDPSADNGCSKSCWAISALLTTTSKHRLR
                     ITGSKVRPDQLFTIRRQIALLVGADG"
     gene            complement(40637..40972)
                     /locus_tag="APA01_RS15690"
                     /old_locus_tag="APA01_44060"
                     /db_xref="GeneID:8426887"
     CDS             complement(40637..40972)
                     /locus_tag="APA01_RS15690"
                     /old_locus_tag="APA01_44060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813406.1"
                     /db_xref="GI:502527072"
                     /db_xref="GeneID:8426887"
                     /translation="MFGGDRLDLRVFLVVVEYIIVLQNQHTICMEEAMASPLSIRLDE
                     RLRLNLEQEAAASGIPLSQLVRDLLETGAKRARRDRIRRDSARVARYVAATPSAQELF
                     EETGGTHGA"
     gene            complement(41074..41574)
                     /locus_tag="APA01_RS15695"
                     /old_locus_tag="APA01_44070"
                     /db_xref="GeneID:8426888"
     CDS             complement(41074..41574)
                     /locus_tag="APA01_RS15695"
                     /old_locus_tag="APA01_44070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA resolvase"
                     /protein_id="WP_052583252.1"
                     /db_xref="GI:918718417"
                     /db_xref="GeneID:8426888"
                     /translation="MRVDGVKVDKIFTDKCSGGTRNRPALTEMLRYVREGDTIICHSI
                     DRLARDLQDLLHLVETLTDRGVGVRFIKEAMTFEGNASPMQTMILQVMGSFAQFERSL
                     IKERQREGQQAARARGKLPGRRKSLSPEQITELKARVSAHEPKARIARDLGISRETLY
                     AYLKAA"
     repeat_region   41566..43233
     gene            complement(41753..43138)
                     /locus_tag="APA01_RS15700"
                     /old_locus_tag="APA01_44080"
                     /db_xref="GeneID:8426889"
     CDS             complement(41753..43138)
                     /locus_tag="APA01_RS15700"
                     /old_locus_tag="APA01_44080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014457579.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012813229.1"
                     /db_xref="GI:502526630"
                     /db_xref="GeneID:8426889"
                     /translation="MQTECSAGAYEFPASCGRRVVARFDGGRMSSDGGVILVKQADDI
                     LGLSRRFAACFRDKRHPGFVEYRVEDLVRQRIMGLALGYEDLNDHDALRHDLIFGLAS
                     GRLSGGRANCAALAGKSTLNRLERSGQQADRYCRIIADHEALATLFVTLFLDQHEHAP
                     ARIVLDVDATDDRIHGHQEGRAFHGYYGHNCYLPLYVFCGDHLLSATLRTADRDPGKE
                     ALADIRRIVEQIRSRWPRVRILVRGDSGFARDSLMTWCEDNHVDFLFGLAGNTRLYDR
                     IASLSAEVRDEAATTGRAARGFASFDWITKDSWTRRRRVVAKAEWRHGNRYHRFIVTT
                     LPQGMSDPRHLYEQIYCARGDMENRIKECQMDLFSDRTSSHTIRANQLRLWFSAAAYV
                     LLTALQRLALGQTSLETATCGTIRARLLKIATRVTLSVRRIVLSMPDMFPCQHEFALA
                     HARLRRLRQAI"
     gene            43256..43723
                     /locus_tag="APA01_RS15705"
                     /old_locus_tag="APA01_44090"
                     /db_xref="GeneID:8426890"
     CDS             43256..43723
                     /locus_tag="APA01_RS15705"
                     /old_locus_tag="APA01_44090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012813408.1"
                     /db_xref="GI:502527083"
                     /db_xref="GeneID:8426890"
                     /translation="MTPQAYGQGIREEGLAASRRLEGVFEKAIGEVRKERQALASIVG
                     EANNRRDQWFYLIFIGLMAFLFGVGVAPLLFNHITWKNFDERVASFIVGGQDRWESGA
                     AMMRDARPEQWNSFMWEDRLVQDNMPKIRDCRIAATQVGQPKPCVITIKPDAQ"
     repeat_region   43304..45539
     gene            complement(43809..45986)
                     /locus_tag="APA01_RS15710"
                     /old_locus_tag="APA01_44100"
                     /db_xref="GeneID:8426891"
     CDS             complement(43809..45986)
                     /locus_tag="APA01_RS15710"
                     /old_locus_tag="APA01_44100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012813409.1"
                     /db_xref="GI:502527086"
                     /db_xref="GeneID:8426891"
                     /translation="MSIVNPSNGTPYLTPGTTTFTSGQVVSGVTVPSNSKEVLSSGAT
                     GMQQTIKEASGNTGGGEILVLSGAQLLQNTDAGVWLNEGKIIVHDGGFISGGAATAGG
                     ITTILSGGIAEEITAGNAGSIGTVIFSSGAILKGTTVARSGGTISGGTATSGAQIKVL
                     SGGVLTDADAAAFGNIVVSKGGRGQDIIISSGGGLGVAGIASDTTVNNGGVIEINSGG
                     VSNNNHVNNGGKIYADSGSILGLTSISSGGSAIVASGATISDVVTIQDGGTATIWNNT
                     SGTIDLSGDTNHGLTISGLESGGTVSTVISGWSGSKPGNSDSIDLPGVSADGASYAYP
                     SDDQVVVTLANGNTITLNIPGVKNTGFVLSDDHHGGASAEVCFLSGSMIRTSEGDVAV
                     EDIQIGDEVIAFDWRNDEDVVRQVVWVGKARATVRPDLPDDEAGWPVRILKDAIADGV
                     PYKDMLITAEHCLFFRDRFVPVRMLVNGVSIFYDKSITSYDYYHVETEQHSVITADGM
                     LTESYLDTGNRSSFRQEGKIATLRGAVKNWADHAGAPLGVERSFVEPLFRALQWRENS
                     VVGTKISTTKIETTTDPDLHLITQTGAVIRPMRKTAHHYSFMLPPNTESVRIVSRSSR
                     PSDVIGPFVDDRRYMGVAVADVQLQCAKQQFDITSHLQDEKPSGWHDTDWTDCAWTNG
                     NAELPLGDHLTHGKMGILSMTIRAAGPYLLNTKPNSDMKKHSA"
     repeat_region   45837..46103
     repeat_region   46128..49740
     gene            46313..46576
                     /locus_tag="APA01_RS15715"
                     /old_locus_tag="APA01_44110"
                     /db_xref="GeneID:8426892"
     CDS             46313..46576
                     /locus_tag="APA01_RS15715"
                     /old_locus_tag="APA01_44110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010516767.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012812704.1"
                     /db_xref="GI:502522386"
                     /db_xref="GeneID:8426892"
                     /translation="MKSDRFSDAQIMGVIRQAEGGVPVPDLCREHGISNATFYRWRAK
                     YGGMDASMISQMKALEEENRRLKRMYADLSMQTDILKEALGKK"
     gene            46573..47400
                     /locus_tag="APA01_RS15720"
                     /old_locus_tag="APA01_44120"
                     /db_xref="GeneID:8426893"
     CDS             46573..47400
                     /locus_tag="APA01_RS15720"
                     /old_locus_tag="APA01_44120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012813371.1"
                     /db_xref="GI:502527022"
                     /db_xref="GeneID:8426893"
                     /translation="MKRPAQRRELAAQAVAHHGVSIALACRIFGISETCFRYRPRLAA
                     ENDRIAALLVGLTQAHRRWGFGLCFLYLRNVQGQLWNHKRVYRIYRELEFNLRIKPRR
                     RLVREKPEKLSVPALPNTVWSMDFMADRLLDGRAFRLLNILDEFNREGLAIEVDFSLP
                     ACRVVRCLEQVMEWRGRPEAIRMDNGPEYVSHTLVSWAEKQGITLIYTQPGNPQQNAY
                     IERYNRTVRQEWLEQYLFESIQDVQEVATQWLWTYNHDRPNMGNSGLTPAQKLKTAA"
     gene            47575..47913
                     /locus_tag="APA01_RS15725"
                     /old_locus_tag="APA01_44130"
                     /db_xref="GeneID:8426894"
     CDS             47575..47913
                     /locus_tag="APA01_RS15725"
                     /old_locus_tag="APA01_44130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813396.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation repressor RelE/RelB/StbE"
                     /protein_id="WP_012813396.1"
                     /db_xref="GI:502527048"
                     /db_xref="GeneID:8426894"
                     /translation="MHSVIETPIFTKRADALLSREERAELIRLLAENPRQGDVIPGTG
                     GVRKLRFAGSGRGKRGGVRVIWYVASDRIPVYALLIYGKNEQDDLTPDQKKAMASMAE
                     RIKKSDQGGT"
     gene            47915..48214
                     /locus_tag="APA01_RS15730"
                     /old_locus_tag="APA01_44140"
                     /db_xref="GeneID:8426902"
     CDS             47915..48214
                     /locus_tag="APA01_RS15730"
                     /old_locus_tag="APA01_44140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012813395.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="XRE family transcriptional regulator"
                     /protein_id="WP_012813395.1"
                     /db_xref="GI:502527047"
                     /db_xref="GeneID:8426902"
                     /translation="MAEQMNIADELLTSMEQAVGIAAGTVKPGRIWTPPEINVADIRK
                     RTGLSQVRFAARYGFSAAAVRDWEQKRRTPEKAARTLLMLIDKEPQAVERVLVGV"
     gene            49303..49938
                     /locus_tag="APA01_RS15735"
                     /old_locus_tag="APA01_44150"
                     /db_xref="GeneID:8426908"
     CDS             49303..49938
                     /locus_tag="APA01_RS15735"
                     /old_locus_tag="APA01_44150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019089444.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine--protein transferase"
                     /protein_id="WP_012813410.1"
                     /db_xref="GI:502527089"
                     /db_xref="GeneID:8426908"
                     /translation="MKTGKIVVISKLKGGSGATTLTRELATSALDAGKSVAIIDLDAQ
                     GSLTNWWNRRTAATPDAGPKLIQLSPENLPDMTEKLRGKFDLVLIDTPPSTHDALRKI
                     ASKADMAVIPTKPTPDDLDAVGPVIRQLRGVVPMAFVISQITNKRSPDAVEATELLSA
                     RAPVIGRTVIRVGYYRAAGAGQSGFETDKTVREEIATVYDNLMALLGDYHA"
CONTIG      join(AP011124.1:1..49961)
//
DBGET integrated database retrieval system