GenomeNet

Database: RefSeq
Entry: NC_013284
LinkDB: NC_013284
Original site: NC_013284 
LOCUS       NC_013284              22448 bp    DNA     circular CON 08-JUN-2013
DEFINITION  Cronobacter turicensis z3032 plasmid pCTU2, complete sequence.
ACCESSION   NC_013284
VERSION     NC_013284.1  GI:260585138
DBLINK      Project: 40821
            BioProject: PRJNA40821
KEYWORDS    RefSeq; complete genome.
SOURCE      Cronobacter turicensis z3032
  ORGANISM  Cronobacter turicensis z3032
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Cronobacter.
REFERENCE   1  (bases 1 to 22448)
  AUTHORS   Stephan,R., Lehner,A., Tischler,P. and Rattei,T.
  TITLE     Complete Genome Sequence of Cronobacter turicensis LMG 23827, a
            foodborne pathogen causing deaths in neonates
  JOURNAL   J. Bacteriol. (2010) In press
   PUBMED   21037008
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 22448)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (02-OCT-2009) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 22448)
  AUTHORS   Rattei,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-AUG-2009) Rattei T., Genome Oriented Bioinformatics,
            Technische Universitaet Muenchen, Am Forum 1, Bavaria, 85354
            Freising, GERMANY
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to FN543095.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..22448
                     /organism="Cronobacter turicensis z3032"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:693216"
                     /plasmid="pCTU2"
     gene            47..361
                     /locus_tag="Ctu_2p00010"
                     /db_xref="GeneID:8458413"
     CDS             47..361
                     /locus_tag="Ctu_2p00010"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212713.1"
                     /db_xref="GI:260585139"
                     /db_xref="GeneID:8458413"
                     /translation="MLRREIRKWSAERKFNFGEIVNFQHPRPPANIRPQRIEQAGGSR
                     KNFAAPASKKARPRAAFCGGLPRTPSQPGDISRPSGEYHRLGATNPFKAAFRFLRACE
                     EK"
     gene            complement(472..591)
                     /locus_tag="Ctu_2p00020"
                     /db_xref="GeneID:8458382"
     CDS             complement(472..591)
                     /locus_tag="Ctu_2p00020"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212714.1"
                     /db_xref="GI:260585140"
                     /db_xref="GeneID:8458382"
                     /translation="MPVLRAFGKKPTSGRLPPETRAGRATACIIPVGLDALTA"
     gene            798..2468
                     /locus_tag="Ctu_2p00030"
                     /db_xref="GeneID:8458383"
     CDS             798..2468
                     /locus_tag="Ctu_2p00030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212715.1"
                     /db_xref="GI:260585141"
                     /db_xref="GeneID:8458383"
                     /translation="MQDSPVILSILAGLTLPFIFHLPREERKNAPFWLKCVACASIFF
                     FIFGTISPLTIQGLSYLFKVLDNNIIFKPVLWGLTIAFTFIGLLFHIMTRRLLAGEID
                     HLKHRMIKKSKLERNTRTDVREVKEMLPDSITYNPLDYIDISKGVFIGLDKDDKPQYI
                     TVEEFQSQHADMIGTTGSGKGVSASVLLYQAILLDEGVFVEDPKNDEWAPHVLREACR
                     VAGKEFTLINLNDLNFQLDLLADINHEQLEELFNAGFSLAKKGEGADFYRIADRRAAR
                     KTSAIYEKGMTLRDLFNTDFVKSLEEDVPAFYGELEEIALVNSINATYGFSLKKIFDE
                     GGCCYIIGSMRNQKIISAQRMILTRLIQIAETRDRIKEKPRPIAIFLDELKYHLSRPA
                     LEGLGAARDKGVHILMAHQSIKDLYDCPADLDGDAVAGSVVENCKFMLVYRLRDPDTA
                     EWVARMTGSILVDDEMRKVTTDISLTEKIDTDRMIRQAERYYIDSNMLLNLPKFVGFV
                     FTQNDLAKATKLYHIPAKKKYIELLSFEDKSASPAFNESEQERPSIDL"
     misc_feature    <1245..2333
                     /locus_tag="Ctu_2p00030"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    1287..2321
                     /locus_tag="Ctu_2p00030"
                     /note="Type IV secretion-system coupling protein
                     DNA-binding domain; Region: TrwB_AAD_bind; pfam10412"
                     /db_xref="CDD:255970"
     gene            2526..3227
                     /locus_tag="Ctu_2p00040"
                     /db_xref="GeneID:8458384"
     CDS             2526..3227
                     /locus_tag="Ctu_2p00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212716.1"
                     /db_xref="GI:260585142"
                     /db_xref="GeneID:8458384"
                     /translation="MLSLLSFLKEETYSDFNTLRNVLGFSKNAHSPLYKILNRAVKEG
                     FIIKHEIPGIKQKITIWGITMQGLAMVVTADDHVFPGYFEPGKLRYWTLEHRLLNQRV
                     RIALEEKGGKNWINGDRSEFKARYPGVRHRPDGIITLNSGAVVAVETERSLKTRARYI
                     NIINSHLAASDAGRWHYAMYVAPDERIKTALMRLFDSIKTVVRNSVPVPFEGKNREMF
                     LFRTIEELEKSAPAD"
     gene            3265..3738
                     /gene="parB"
                     /locus_tag="Ctu_2p00050"
                     /db_xref="GeneID:8458385"
     CDS             3265..3738
                     /gene="parB"
                     /locus_tag="Ctu_2p00050"
                     /EC_number="3.1.31.1"
                     /inference="similar to AA
                     sequence:UniProtKB/Swiss-Prot:P22997"
                     /codon_start=1
                     /transl_table=11
                     /product="Protein parB"
                     /protein_id="YP_003212717.1"
                     /db_xref="GI:260585143"
                     /db_xref="GeneID:8458385"
                     /translation="MKRAVTALMLIASIHPALCLADFSGRIVRVIDGDTVQVLTSGEM
                     VRVRLNGIDAPESSQPFGQKAKQNLINLAAQKDSRIESQDKDRYGRWLGTVVINGVNI
                     NAEQVKAGMAWAYRYHGRASDENMLRIEQEARQHRIGLWSASNPVEPWKWRNQHK"
     misc_feature    3325..3690
                     /gene="parB"
                     /locus_tag="Ctu_2p00050"
                     /note="Staphylococcal nuclease homologues; Region: SNc;
                     smart00318"
                     /db_xref="CDD:214615"
     misc_feature    3349..3690
                     /gene="parB"
                     /locus_tag="Ctu_2p00050"
                     /note="Staphylococcal nuclease homologues. SNase
                     homologues are found in bacteria, archaea, and eukaryotes.
                     They contain no disufide bonds; Region: SNc; cd00175"
                     /db_xref="CDD:238102"
     misc_feature    order(3364..3366,3403..3405,3421..3423,3430..3432,
                     3523..3528,3532..3534)
                     /gene="parB"
                     /locus_tag="Ctu_2p00050"
                     /note="Catalytic site; other site"
                     /db_xref="CDD:238102"
     gene            3795..4139
                     /locus_tag="Ctu_2p00060"
                     /db_xref="GeneID:8458410"
     CDS             3795..4139
                     /locus_tag="Ctu_2p00060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212718.1"
                     /db_xref="GI:260585144"
                     /db_xref="GeneID:8458410"
                     /translation="MFLTKFHPLTHKVDALIIRDLKQSMPVKYWLFRLAEWAARIGIL
                     GFICVFICYFAMGALIQHAGEPVPPSLAEVSARAIIALLILFMVGTITRGALFSDLEK
                     RVNEKKWLNDMQ"
     gene            complement(4178..4411)
                     /locus_tag="Ctu_2p00070"
                     /db_xref="GeneID:8458386"
     CDS             complement(4178..4411)
                     /locus_tag="Ctu_2p00070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212719.1"
                     /db_xref="GI:260585145"
                     /db_xref="GeneID:8458386"
                     /translation="MANVPAKPRNTKGEPPSQQDTEHGFNPTRKSADGRKAQLNLYID
                     MELKREFRSIAAANDMKHGELFEAYQEFWKKHH"
     gene            complement(4452..5099)
                     /locus_tag="Ctu_2p00080"
                     /db_xref="GeneID:8458387"
     CDS             complement(4452..5099)
                     /locus_tag="Ctu_2p00080"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212720.1"
                     /db_xref="GI:260585146"
                     /db_xref="GeneID:8458387"
                     /translation="MTAVIALANGKGGVKKSSMSRAIATEYTKAGWGVLGLDMDIDQG
                     SFLDWGQRRLRNGFEPPVTIQGCGTVSQAKKQIESGQWDLIVIDSAAYATKSLLSLID
                     IVDLLVLPTGFSVDDLRTTVTTVNALRNKGHSTDKMAVVFAGVSESESEYRAAVEYLQ
                     PCGVPVIPGAIPFLTSFSQAQDKGLALTESPFPGPRQKADDVVQGVIDRLTTLTQ"
     misc_feature    complement(4674..5090)
                     /locus_tag="Ctu_2p00080"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(4581..5087)
                     /locus_tag="Ctu_2p00080"
                     /note="CobQ/CobB/MinD/ParA nucleotide binding domain;
                     Region: CbiA; pfam01656"
                     /db_xref="CDD:250775"
     misc_feature    complement(5049..5069)
                     /locus_tag="Ctu_2p00080"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(4836..4838,5049..5051))
                     /locus_tag="Ctu_2p00080"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            complement(5219..6001)
                     /locus_tag="Ctu_2p00090"
                     /db_xref="GeneID:8458388"
     CDS             complement(5219..6001)
                     /locus_tag="Ctu_2p00090"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212721.1"
                     /db_xref="GI:260585147"
                     /db_xref="GeneID:8458388"
                     /translation="MTDIKPAIKAYSELQEAYDWFNATLFDRSLPDLLITLQRGRNTF
                     GYFAPERFTGESSVSELAMNPDYFGGRSLADTLSTLVHEMVHVWQHYAPVKKCRGGYH
                     DRVWGGKMEDIGLMPSNTGVPGGKKTGQQMTHYIIRGGRFQKAVYDLLKNGFSISWYD
                     RWSTGAAVMSKINGDILDDWLAVTDENDTDLINRLTLTVSKSRPELMADDDEAAVMIK
                     PPVKGTGTRTKFTCPECGVNAWAKPSAVLLCGECECQLEAAK"
     misc_feature    complement(<5648..5962)
                     /locus_tag="Ctu_2p00090"
                     /note="SprT-like family; Region: SprT-like; pfam10263"
                     /db_xref="CDD:255861"
     gene            complement(6282..6422)
                     /locus_tag="Ctu_2p00100"
                     /db_xref="GeneID:8458389"
     CDS             complement(6282..6422)
                     /locus_tag="Ctu_2p00100"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212722.1"
                     /db_xref="GI:260585148"
                     /db_xref="GeneID:8458389"
                     /translation="MAYHTNAISLFYRVREKVYPIPFFNKRPLKTGAVNAFYVKSLTL
                     IR"
     gene            6480..7094
                     /locus_tag="Ctu_2p00110"
                     /db_xref="GeneID:8458390"
     CDS             6480..7094
                     /locus_tag="Ctu_2p00110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212723.1"
                     /db_xref="GI:260585149"
                     /db_xref="GeneID:8458390"
                     /translation="MSIPTLPGSVFSVIVRTAEYFFFNRKSRQRREAEAASQLVSVLD
                     RFVVGCDAVAEDDGYPPFTNPEYHDYRDRTPQSETVLLAVPDIPGRELLPISISDRVR
                     VIESLQNDTSRALMEARECDDGSGDGFYAKRQEIFSLLGFKAVELTRELRSAYRLSPP
                     SIEHRNREKRIEEKLRYHDGFSVKIRRIEQRIARKAKMAAGKIT"
     gene            7448..7576
                     /locus_tag="Ctu_2p00120"
                     /db_xref="GeneID:8458391"
     CDS             7448..7576
                     /locus_tag="Ctu_2p00120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212724.1"
                     /db_xref="GI:260585150"
                     /db_xref="GeneID:8458391"
                     /translation="MKNLYRIYQTTLCAPRLFLADVLMLIDLWEKLQHLFPGGIVH"
     gene            complement(7968..8099)
                     /locus_tag="Ctu_2p00130"
                     /db_xref="GeneID:8458392"
     CDS             complement(7968..8099)
                     /locus_tag="Ctu_2p00130"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212725.1"
                     /db_xref="GI:260585151"
                     /db_xref="GeneID:8458392"
                     /translation="MVYLLITYVIKDKPKKKNITVIPLSKWITERQRRKRLRDSTPR"
     gene            complement(8311..8910)
                     /locus_tag="Ctu_2p00140"
                     /db_xref="GeneID:8458393"
     CDS             complement(8311..8910)
                     /locus_tag="Ctu_2p00140"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212726.1"
                     /db_xref="GI:260585152"
                     /db_xref="GeneID:8458393"
                     /translation="MNRWLKALATVAGRIKIKSELRRRIRHNRYWVNEANKYGIETLC
                     ELMLAILDDLDLRDWQTRHNLETLAERAGLATYSDAGHKSISRASRGCDRLFWLNAII
                     TEKAQFNPYDARCACKHIEVTEDFFAILGIPLKQVYRERARLLKADPEEMITSWDSRL
                     IAIRVENWKRKAMAGLARMQAKRQAARERKKEYYSPTTA"
     misc_feature    complement(8338..>8775)
                     /locus_tag="Ctu_2p00140"
                     /note="IncFII RepA protein family; Region: IncFII_repA;
                     cl11495"
                     /db_xref="CDD:264402"
     gene            complement(9473..9829)
                     /locus_tag="Ctu_2p00150"
                     /db_xref="GeneID:8458394"
     CDS             complement(9473..9829)
                     /locus_tag="Ctu_2p00150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212727.1"
                     /db_xref="GI:260585153"
                     /db_xref="GeneID:8458394"
                     /translation="MVPKRLKEAREAAGISQEKLAQLVDLESVNSRSKISNYEAGRFA
                     PSFEFVCRVAKALGYPEYYFYTVSDATAQILLQQHREGFHLQEGIAGEVQKMAEQLDD
                     VRKLVAELNECLKHRS"
     misc_feature    complement(<9638..9829)
                     /locus_tag="Ctu_2p00150"
                     /note="Predicted transcriptional regulators
                     [Transcription]; Region: HipB; COG1396"
                     /db_xref="CDD:224314"
     misc_feature    complement(9638..9820)
                     /locus_tag="Ctu_2p00150"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(9710..9712,9797..9799,9809..9811))
                     /locus_tag="Ctu_2p00150"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(9713..9715,9800..9802))
                     /locus_tag="Ctu_2p00150"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(9707..9712,9722..9724,9731..9733,
                     9776..9781))
                     /locus_tag="Ctu_2p00150"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            10056..10526
                     /gene="rfaH"
                     /locus_tag="Ctu_2p00160"
                     /db_xref="GeneID:8458395"
     CDS             10056..10526
                     /gene="rfaH"
                     /locus_tag="Ctu_2p00160"
                     /inference="similar to AA
                     sequence:UniProtKB/Swiss-Prot:P0AFW0"
                     /codon_start=1
                     /transl_table=11
                     /product="Transcriptional activator rfaH"
                     /protein_id="YP_003212728.1"
                     /db_xref="GI:260585154"
                     /db_xref="GeneID:8458395"
                     /translation="MPIREDLMYKWYVLYCNSQDIQRISRRAEDIGVEVFCPRYIKVT
                     PRTDCRAVRQEEKPLFPSYLFLRFDVNVVHTSTITSIPGAHGFVSFGAAPCTVPESVI
                     TAIECARLLALNPDEDVFECRNISPDLLLKIQELSQIRTPLQRQVAFSRLLQNQ"
     misc_feature    10080..10376
                     /gene="rfaH"
                     /locus_tag="Ctu_2p00160"
                     /note="N-Utilization Substance G (NusG) N-terminal domain
                     in the NusG Specialized Paralog (SP), AnFA1; Region:
                     NGN_SP_AnfA1; cd09894"
                     /db_xref="CDD:193583"
     gene            10601..10816
                     /locus_tag="Ctu_2p00170"
                     /db_xref="GeneID:8458411"
     CDS             10601..10816
                     /locus_tag="Ctu_2p00170"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212729.1"
                     /db_xref="GI:260585155"
                     /db_xref="GeneID:8458411"
                     /translation="MPKSVPGKSSTAVIYIGKGRYQDLAKHAREISYLSEANIRPSTF
                     LHYLIDQFSDQAHSELLKQLLADKQKE"
     gene            10820..11041
                     /locus_tag="Ctu_2p00180"
                     /db_xref="GeneID:8458396"
     CDS             10820..11041
                     /locus_tag="Ctu_2p00180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212730.1"
                     /db_xref="GI:260585156"
                     /db_xref="GeneID:8458396"
                     /translation="MRKPSYHVYVTQEVPTGENGEKSTYWTKVGAAFPHNGKSGLNIM
                     ITPGISVSGKLVLLEPKDDNDAPQGAPVN"
     gene            11057..11767
                     /locus_tag="Ctu_2p00190"
                     /db_xref="GeneID:8458397"
     CDS             11057..11767
                     /locus_tag="Ctu_2p00190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212731.1"
                     /db_xref="GI:260585157"
                     /db_xref="GeneID:8458397"
                     /translation="MLSTSAFLAVAMQCAATVHPSTSLDVVRVESGFNPYAIAEIVPR
                     PERQPGDKGFITHMPTNKEDAQRIVTQIEAKGRRYSVGLMQITSTNFDTYGVTASDLF
                     NPCTNLSVYEKIITDCYERGGTLKRALSCYYSGNFNTGQQPETALAKTSYVQRIGYSP
                     DKPRYAVPGTSEDKISSPATLTAVPVEAPPSQQVIWPATVVRGVPAQLRQKKSPALYY
                     PAKVIRGSRDLTKNEEDK"
     misc_feature    11132..11524
                     /locus_tag="Ctu_2p00190"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(11144..11146,11315..11317,11396..11398,11450..11452)
                     /locus_tag="Ctu_2p00190"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    11144..11146
                     /locus_tag="Ctu_2p00190"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            11764..12042
                     /locus_tag="Ctu_2p00200"
                     /db_xref="GeneID:8458398"
     CDS             11764..12042
                     /locus_tag="Ctu_2p00200"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212732.1"
                     /db_xref="GI:260585158"
                     /db_xref="GeneID:8458398"
                     /translation="MNMFKALTRVSPSLAALAASPAFADGFTRANTVGQKIATGLHGL
                     AAITITVAVIWIGYKTLWKGESLSQCGYIIIGGILIGGGSEIAALIMG"
     gene            12076..14799
                     /locus_tag="Ctu_2p00210"
                     /db_xref="GeneID:8458399"
     CDS             12076..14799
                     /locus_tag="Ctu_2p00210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212733.1"
                     /db_xref="GI:260585159"
                     /db_xref="GeneID:8458399"
                     /translation="MKRPAALWGVPMVPLLGVTGVTIIVAIWTSVSLLLLLPVEFLVM
                     KSLTRNEPMRFNLIAVWLRARGKPVANRLFGATTFMPVEHEPVDITEFIDAMKLNQSA
                     TIRKYIPYSSHIHPNVIRSPKSDLYCTWEVMGTPFDCESEETLQIGTNQLHGLIRSFE
                     GLPVTFYVHNIREQFTDSLHKESGNPYADKISELYYASLKDAPFRRNRLFITVCFRPF
                     VGLEKAERKRMKDTEKLKELDGALQEMLEIKSTLDTAFSRYGARSLGTFTEGKAVYSS
                     QLAFYEYLLTHQWRRVRVTRTPAYDVMGAAALFFSAESGQINHVSGTSYFRGLEVKEF
                     SEETGTGMMDSLLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSSDDDAISQRLDL
                     DVALDLLTSGKIAYGKHHFSIMVHSPTLDSLVADTNEISNALNNIGITPVPAEISLSA
                     AYMAQLPGNYNLRPRKGELSSQNFVELAALHNFYPGKRDRAPWGDAMALLRTPSGDGY
                     YLNLHNTLADKDEFDEKNPASTCILGTNGSGKTMLMTFLENMQQKYRRADSFSPDART
                     KRLTTVYLDKDRGAEMNIRALGGRYYRVISGERTGWNPFSLPATKRNINFIKQLMKIL
                     CTRNGSTITPRDEQRLSVAVDAVMSNEPEYRLFGITRLRENLPEPATKEAQENGLDIR
                     LSQWAQGGEFGWVFDNESDTFDISNCDNFGIDGTEFLDDANVCAPISFYLLYRITSLL
                     DGRRLVIYMDEFWKWLRDPVFKDFAYNKLKTIRKLNGFLVVGTQSPHEIIKDDIAPAV
                     IEQCGTQILAANPSADRSHYVDGMKFEPEVFDVVKGLDPQARQYVVVKNQFRRGDTKR
                     FAARVTLDLSGIGRYTKVMSGDAPNLEIFESIYREGMQPHEWLDTYMAKAL"
     misc_feature    12082..12321
                     /locus_tag="Ctu_2p00210"
                     /note="Type IV secretory pathway, VirB3-like protein;
                     Region: VirB3; cl01501"
                     /db_xref="CDD:260966"
     misc_feature    12373..14790
                     /locus_tag="Ctu_2p00210"
                     /note="type IV secretion/conjugal transfer ATPase, VirB4
                     family; Region: VirB4_CagE; TIGR00929"
                     /db_xref="CDD:233193"
     misc_feature    12865..13470
                     /locus_tag="Ctu_2p00210"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     gene            14815..15522
                     /locus_tag="Ctu_2p00220"
                     /db_xref="GeneID:8458400"
     CDS             14815..15522
                     /locus_tag="Ctu_2p00220"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212734.1"
                     /db_xref="GI:260585160"
                     /db_xref="GeneID:8458400"
                     /translation="MKTRFRALFFVCMMVSPLANAGIPVLVDADPMREAEWLKEAQRW
                     METAKHYQSQIQAYKDQLATATGARDIADFVNQAKSLTADLERLRKPGQALNDLLMSG
                     GSSGQFDELYEKYKIFNTCNTGQSGSYADVCKQEVINKAVQLEQTNDIQRDVDKTLAE
                     IDRLSNRIALSKDSKESQDLANSIQLKSVMLNTLTNQWEMSVKAAEKREQVLKEERNK
                     QWNKQQLNAPTADLNNL"
     misc_feature    14878..15462
                     /locus_tag="Ctu_2p00220"
                     /note="Type IV secretion system proteins; Region: T4SS;
                     pfam07996"
                     /db_xref="CDD:254572"
     gene            15530..15772
                     /locus_tag="Ctu_2p00230"
                     /db_xref="GeneID:8458401"
     CDS             15530..15772
                     /locus_tag="Ctu_2p00230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212735.1"
                     /db_xref="GI:260585161"
                     /db_xref="GeneID:8458401"
                     /translation="MLSKKTILASSLALCFAVIGCKEEAKTTKWYREHPDELKVVYEK
                     CQKSGDASENCKNANEAHSQIKQLNAPTPDLNNLEE"
     misc_feature    <15620..15736
                     /locus_tag="Ctu_2p00230"
                     /note="RNA recognition motif (RRM) superfamily; Region:
                     RRM_SF; cl17169"
                     /db_xref="CDD:266524"
     gene            15776..16849
                     /locus_tag="Ctu_2p00240"
                     /db_xref="GeneID:8458402"
     CDS             15776..16849
                     /locus_tag="Ctu_2p00240"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212736.1"
                     /db_xref="GI:260585162"
                     /db_xref="GeneID:8458402"
                     /translation="MSAGLFVGVDKYLIGGITDATKGLMMSYSSMMMGLAAMSATLYI
                     TWRGYQTLAGKLSTPMEDVVWDIMRMAIILSFVANAEGYLDGVIDAINGLKEGFSGSD
                     SIWQLLDSLWNKAKVLGKTLHDMDDSTYIKDEGMTAQFYVWLGVFVLMIVTAFVSMVA
                     EVMILLLSITAPVFIFCLIYGFLRPMFNNWLQNIFAAILTILFSALSLRIVVTYLNLV
                     LDKATRVADNSAIVELGAQVCLAGVCAAILVYISAKLAAALAGASATVSMQGLAAMGI
                     GAAAFGAGKLAGGATKQTTRSIRDNIQGWKDASAGKPLTPGGGAGYNASKARKYAIEQ
                     MIARNEARRLAQSRESAVKKFNS"
     misc_feature    15893..16525
                     /locus_tag="Ctu_2p00240"
                     /note="TrbL/VirB6 plasmid conjugal transfer protein;
                     Region: TrbL; pfam04610"
                     /db_xref="CDD:252701"
     gene            16927..17064
                     /locus_tag="Ctu_2p00250"
                     /db_xref="GeneID:8458403"
     CDS             16927..17064
                     /locus_tag="Ctu_2p00250"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212737.1"
                     /db_xref="GI:260585163"
                     /db_xref="GeneID:8458403"
                     /translation="MKRLIALALLCALSGCARNSLPPAFSGKGEPVNTPQIMAELNSH
                     E"
     gene            17057..17740
                     /locus_tag="Ctu_2p00260"
                     /db_xref="GeneID:8458404"
     CDS             17057..17740
                     /locus_tag="Ctu_2p00260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212738.1"
                     /db_xref="GI:260585164"
                     /db_xref="GeneID:8458404"
                     /translation="MSEQKLIAESRTFEQQMIDRDKRATKAGFIVGGVGLLIAVLALV
                     AVVVMLPLKQTDVELYTVDNHTGRVEHITRTSKTSLTAEEAYQKAMAANYVKIRERYV
                     YPSLQDDYETVQMYNSPEVNNDYLALYAGKNAPDKVYNNGANTVKIDILSSQITDGTA
                     PDKVATIRYKKTIRRLVDNQTRYEYWDARFTFHSDPNKEMSDEEREVNYFGFTVTSWQ
                     TDREIRGGE"
     misc_feature    17081..17722
                     /locus_tag="Ctu_2p00260"
                     /note="VirB8 protein; Region: VirB8; pfam04335"
                     /db_xref="CDD:252532"
     gene            17740..18645
                     /locus_tag="Ctu_2p00270"
                     /db_xref="GeneID:8458405"
     CDS             17740..18645
                     /locus_tag="Ctu_2p00270"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212739.1"
                     /db_xref="GI:260585165"
                     /db_xref="GeneID:8458405"
                     /translation="MNKITPVFLALMMSGAAWGAAMPQASRYDARIQQVIYNPQNVTV
                     INTMPGFMTTLVFDNDEAVIDAKPGFEEAWEAKKDANRVYVRPLALQQGAPGQDGNTA
                     QVVIPPNSQDWHTNMLVVTTKRLYNVELNVIDDKSAQQPAFQVSYSYPGEARDKANRE
                     ASARQKEWEQKQQEARIEKSLNSAQTPRNWDYTKYPGQGSFSIDPDFAYDDGRFTFVG
                     FSPAKSIPSVTKELNGKEHTVNTGIQKKGDYTVLVIQEVTPRLVLRSGNAVVGLENKS
                     YGRVQAPDGSTVSPKVERVEKPESN"
     misc_feature    18295..18567
                     /locus_tag="Ctu_2p00270"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    order(18307..18321,18331..18336,18349..18366,18523..18525,
                     18538..18558)
                     /locus_tag="Ctu_2p00270"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            18802..19992
                     /locus_tag="Ctu_2p00280"
                     /db_xref="GeneID:8458406"
     CDS             18802..19992
                     /locus_tag="Ctu_2p00280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212740.1"
                     /db_xref="GI:260585166"
                     /db_xref="GeneID:8458406"
                     /translation="MLNEHDDDEKDPVQPAVNKLKKRKRGKMTAFLALVAVALIFLTW
                     GGNWVYRNFLAQPKEEKQEEPAPQTSQTDYRKRNDLGMATDTGQQEQPQQDNSQGSTE
                     GNNTVGTGQAAPAAPLQLDKARFLVRRDGEASSQGQVKTRQQEMAQLSGATSTDATAP
                     AQAQGQGQGQGQGQGQQQDAAAATTGQSPAVVRRIPLNPDLYIPENRSIPCSLDYRFV
                     SDRAGKLRCTITTDIWSASGNTKLIEKGTTATGIYRTGGEDGMKHGQGRAFVIITKLR
                     TKQKPYLDIPMVDTSAAGALGEAGMDGWVDNHFSDRFAGALLVGMIPDVAAWASNSAG
                     QKDRNTDYTENSRQAMADMARTTLENSINIPPTLYKNQGEIINLITGQDIDFSNIYTL
                     RMKE"
     misc_feature    18853..19050
                     /locus_tag="Ctu_2p00280"
                     /note="Septum formation initiator; Region: DivIC; cl17659"
                     /db_xref="CDD:266763"
     misc_feature    18886..19986
                     /locus_tag="Ctu_2p00280"
                     /note="Type IV secretory pathway, VirB10 components
                     [Intracellular trafficking and secretion]; Region: VirB10;
                     COG2948"
                     /db_xref="CDD:225499"
     misc_feature    19402..19959
                     /locus_tag="Ctu_2p00280"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            19989..21101
                     /gene="virB11"
                     /locus_tag="Ctu_2p00290"
                     /db_xref="GeneID:8458407"
     CDS             19989..21101
                     /gene="virB11"
                     /locus_tag="Ctu_2p00290"
                     /inference="similar to AA
                     sequence:UniProtKB/Swiss-Prot:P0C534"
                     /codon_start=1
                     /transl_table=11
                     /product="Type IV secretion system protein virB11"
                     /protein_id="YP_003212741.1"
                     /db_xref="GI:260585167"
                     /db_xref="GeneID:8458407"
                     /translation="MTATNISLDRYKQRFFGDFLELPGLTEIAVNRPDELFTKIDGVW
                     TQHAVSLSYDDCYNFARCLAKHHNDNIEDIKPGLSATLESGERCQLVVPPACERGTVS
                     ATIRKPSRVQIPHQSYIDAGFYNRVTGSEQTETHDAELIELYNTKNIPLFMEKCVEYG
                     KTIAVAGETSTGKTTYMKMLIGYIPLDLRITTIEDNPEITFFKHYMKMLIGYIPLDLR
                     ITTIEDNPEITFFKHKNYVHLFYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVR
                     GAEAWDFLKITGSGHEGSMTSIHAGSAMEAIDGFITRCYENPQCAQLPYAFMLRKVLD
                     SLDVIVSIDLDGNIRRMNDIYFRPVHRKEYFEAMKS"
     misc_feature    20043..21056
                     /gene="virB11"
                     /locus_tag="Ctu_2p00290"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(20487..20492,20502..20510)
                     /gene="virB11"
                     /locus_tag="Ctu_2p00290"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(20490..20492,20502..20510,20562..20564,20568..20573,
                     20805..20810)
                     /gene="virB11"
                     /locus_tag="Ctu_2p00290"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    20793..20807
                     /gene="virB11"
                     /locus_tag="Ctu_2p00290"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            21173..21496
                     /locus_tag="Ctu_2p00310"
                     /db_xref="GeneID:8458412"
     CDS             21173..21496
                     /locus_tag="Ctu_2p00310"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212742.1"
                     /db_xref="GI:260585168"
                     /db_xref="GeneID:8458412"
                     /translation="MEWDKPANSVNSTMPQWDDNSIIIPSREVNGKWSAVIRATDFDD
                     TLWTPAVFYAAAHSPRIVISTPSGDNFFKAKSWLRQHGAKGVIEYQPTLNCIACSETS
                     IYFSR"
     misc_feature    21176..21445
                     /locus_tag="Ctu_2p00310"
                     /note="Cag pathogenicity island protein Cag12; Region:
                     Cag12; pfam13117"
                     /db_xref="CDD:257508"
     gene            21523..21828
                     /locus_tag="Ctu_2p00320"
                     /db_xref="GeneID:8458408"
     CDS             21523..21828
                     /locus_tag="Ctu_2p00320"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212743.1"
                     /db_xref="GI:260585169"
                     /db_xref="GeneID:8458408"
                     /translation="MKRTVISAALLCLFAGAPFYSFAADPCKVAFCMYGKATGNSGGS
                     ECKSAERDFFNIVKKNKHGFQPGRTFDARKAFLGECPDAGKEAINTILSKYGRKRGG"
     misc_feature    21601..>21807
                     /locus_tag="Ctu_2p00320"
                     /note="TrbM; Region: TrbM; pfam07424"
                     /db_xref="CDD:191743"
     gene            22108..22413
                     /locus_tag="Ctu_2p00330"
                     /db_xref="GeneID:8458409"
     CDS             22108..22413
                     /locus_tag="Ctu_2p00330"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003212744.1"
                     /db_xref="GI:260585170"
                     /db_xref="GeneID:8458409"
                     /translation="MNNQDLFIKNINSKEQDRISVKKIVDNISKSAHHGCGLYHEVYH
                     ARLLNELRNHTEYLNAVDAAKLTDYAASQGLYIDDDSLRAAEEAEAECWREIRAQQE"
CONTIG      join(FN543095.1:1..22448)
//
DBGET integrated database retrieval system