GenomeNet

Database: RefSeq
Entry: NC_013284
LinkDB: NC_013284
Original site: NC_013284 
LOCUS       NC_013284              22448 bp    DNA     circular CON 25-NOV-2016
DEFINITION  Cronobacter turicensis z3032 plasmid pCTU2, complete sequence.
ACCESSION   NC_013284
VERSION     NC_013284.1  GI:260585138
DBLINK      BioProject: PRJNA224116
            BioSample: SAMEA2272673
            Assembly: GCF_000027065.2
KEYWORDS    RefSeq; complete genome.
SOURCE      Cronobacter turicensis z3032
  ORGANISM  Cronobacter turicensis z3032
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Cronobacter.
REFERENCE   1
  AUTHORS   Stephan,R., Lehner,A., Tischler,P. and Rattei,T.
  TITLE     Complete genome sequence of Cronobacter turicensis LMG 23827, a
            food-borne pathogen causing deaths in neonates
  JOURNAL   J. Bacteriol. 193 (1), 309-310 (2011)
   PUBMED   21037008
REFERENCE   2  (bases 1 to 22448)
  AUTHORS   Rattei,T.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-AUG-2009) Rattei T., Genome Oriented Bioinformatics,
            Technische Universitaet Muenchen, Am Forum 1, Bavaria, 85354
            Freising, GERMANY
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            FN543095.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 11/24/2016 11:36:52
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.0
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,432
            CDS (total)                       :: 4,314
            Genes (coding)                    :: 4,191
            CDS (coding)                      :: 4,191
            Genes (RNA)                       :: 118
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 84
            ncRNAs                            :: 12
            Pseudo Genes (total)              :: 123
            Pseudo Genes (ambiguous residues) :: 0 of 123
            Pseudo Genes (frameshifted)       :: 68 of 123
            Pseudo Genes (incomplete)         :: 51 of 123
            Pseudo Genes (internal stop)      :: 28 of 123
            Pseudo Genes (multiple problems)  :: 22 of 123
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..22448
                     /organism="Cronobacter turicensis z3032"
                     /mol_type="genomic DNA"
                     /db_xref="taxon:693216"
                     /plasmid="pCTU2"
     gene            62..302
                     /locus_tag="CTU_RS22430"
                     /old_locus_tag="Ctu_2p00010"
                     /pseudo
     CDS             62..302
                     /locus_tag="CTU_RS22430"
                     /old_locus_tag="Ctu_2p00010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001312454.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            386..682
                     /locus_tag="CTU_RS22435"
     CDS             386..682
                     /locus_tag="CTU_RS22435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011998895.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071820357.1"
                     /db_xref="GI:1105107611"
                     /translation="MVARSARRCAAFDVGGFGRASSPDITPMYHAVRASSPTGMIHAV
                     ARPARVSGGRRPLVGFFPKARRTGMSVSDAHDLLGFYGVESWSHCMESRRDSML"
     gene            732..2468
                     /locus_tag="CTU_RS20985"
                     /old_locus_tag="Ctu_2p00030"
     CDS             732..2468
                     /locus_tag="CTU_RS20985"
                     /old_locus_tag="Ctu_2p00030"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017346477.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="WP_041924271.1"
                     /db_xref="GI:754513608"
                     /translation="MGSHLVQRLNGFADAFSVFLLWLQDSPVILSILAGLTLPFIFHL
                     PREERKNAPFWLKCVACASIFFFIFGTISPLTIQGLSYLFKVLDNNIIFKPVLWGLTI
                     AFTFIGLLFHIMTRRLLAGEIDHLKHRMIKKSKLERNTRTDVREVKEMLPDSITYNPL
                     DYIDISKGVFIGLDKDDKPQYITVEEFQSQHADMIGTTGSGKGVSASVLLYQAILLDE
                     GVFVEDPKNDEWAPHVLREACRVAGKEFTLINLNDLNFQLDLLADINHEQLEELFNAG
                     FSLAKKGEGADFYRIADRRAARKTSAIYEKGMTLRDLFNTDFVKSLEEDVPAFYGELE
                     EIALVNSINATYGFSLKKIFDEGGCCYIIGSMRNQKIISAQRMILTRLIQIAETRDRI
                     KEKPRPIAIFLDELKYHLSRPALEGLGAARDKGVHILMAHQSIKDLYDCPADLDGDAV
                     AGSVVENCKFMLVYRLRDPDTAEWVARMTGSILVDDEMRKVTTDISLTEKIDTDRMIR
                     QAERYYIDSNMLLNLPKFVGFVFTQNDLAKATKLYHIPAKKKYIELLSFEDKSASPAF
                     NESEQERPSIDL"
     gene            2526..3227
                     /locus_tag="CTU_RS20990"
                     /old_locus_tag="Ctu_2p00040"
     CDS             2526..3227
                     /locus_tag="CTU_RS20990"
                     /old_locus_tag="Ctu_2p00040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012815853.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815853.1"
                     /db_xref="GI:502540006"
                     /translation="MLSLLSFLKEETYSDFNTLRNVLGFSKNAHSPLYKILNRAVKEG
                     FIIKHEIPGIKQKITIWGITMQGLAMVVTADDHVFPGYFEPGKLRYWTLEHRLLNQRV
                     RIALEEKGGKNWINGDRSEFKARYPGVRHRPDGIITLNSGAVVAVETERSLKTRARYI
                     NIINSHLAASDAGRWHYAMYVAPDERIKTALMRLFDSIKTVVRNSVPVPFEGKNREMF
                     LFRTIEELEKSAPAD"
     gene            3265..3738
                     /locus_tag="CTU_RS20995"
                     /old_locus_tag="Ctu_2p00050"
     CDS             3265..3738
                     /locus_tag="CTU_RS20995"
                     /old_locus_tag="Ctu_2p00050"
                     /EC_number="3.1.31.1"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011998898.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_012815854.1"
                     /db_xref="GI:502540007"
                     /translation="MKRAVTALMLIASIHPALCLADFSGRIVRVIDGDTVQVLTSGEM
                     VRVRLNGIDAPESSQPFGQKAKQNLINLAAQKDSRIESQDKDRYGRWLGTVVINGVNI
                     NAEQVKAGMAWAYRYHGRASDENMLRIEQEARQHRIGLWSASNPVEPWKWRNQHK"
     gene            3795..4139
                     /locus_tag="CTU_RS21000"
                     /old_locus_tag="Ctu_2p00060"
     CDS             3795..4139
                     /locus_tag="CTU_RS21000"
                     /old_locus_tag="Ctu_2p00060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004929374.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815855.1"
                     /db_xref="GI:502540008"
                     /translation="MFLTKFHPLTHKVDALIIRDLKQSMPVKYWLFRLAEWAARIGIL
                     GFICVFICYFAMGALIQHAGEPVPPSLAEVSARAIIALLILFMVGTITRGALFSDLEK
                     RVNEKKWLNDMQ"
     gene            complement(4178..4411)
                     /locus_tag="CTU_RS21005"
                     /old_locus_tag="Ctu_2p00070"
     CDS             complement(4178..4411)
                     /locus_tag="CTU_RS21005"
                     /old_locus_tag="Ctu_2p00070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011998900.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011998900.1"
                     /db_xref="GI:500804258"
                     /translation="MANVPAKPRNTKGEPPSQQDTEHGFNPTRKSADGRKAQLNLYID
                     MELKREFRSIAAANDMKHGELFEAYQEFWKKHH"
     gene            complement(4452..5099)
                     /locus_tag="CTU_RS21010"
                     /old_locus_tag="Ctu_2p00080"
     CDS             complement(4452..5099)
                     /locus_tag="CTU_RS21010"
                     /old_locus_tag="Ctu_2p00080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012815856.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815856.1"
                     /db_xref="GI:502540009"
                     /translation="MTAVIALANGKGGVKKSSMSRAIATEYTKAGWGVLGLDMDIDQG
                     SFLDWGQRRLRNGFEPPVTIQGCGTVSQAKKQIESGQWDLIVIDSAAYATKSLLSLID
                     IVDLLVLPTGFSVDDLRTTVTTVNALRNKGHSTDKMAVVFAGVSESESEYRAAVEYLQ
                     PCGVPVIPGAIPFLTSFSQAQDKGLALTESPFPGPRQKADDVVQGVIDRLTTLTQ"
     gene            complement(5219..6001)
                     /locus_tag="CTU_RS21015"
                     /old_locus_tag="Ctu_2p00090"
     CDS             complement(5219..6001)
                     /locus_tag="CTU_RS21015"
                     /old_locus_tag="Ctu_2p00090"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_004178131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="zinc metalloprotease"
                     /protein_id="WP_012815857.1"
                     /db_xref="GI:502540010"
                     /translation="MTDIKPAIKAYSELQEAYDWFNATLFDRSLPDLLITLQRGRNTF
                     GYFAPERFTGESSVSELAMNPDYFGGRSLADTLSTLVHEMVHVWQHYAPVKKCRGGYH
                     DRVWGGKMEDIGLMPSNTGVPGGKKTGQQMTHYIIRGGRFQKAVYDLLKNGFSISWYD
                     RWSTGAAVMSKINGDILDDWLAVTDENDTDLINRLTLTVSKSRPELMADDDEAAVMIK
                     PPVKGTGTRTKFTCPECGVNAWAKPSAVLLCGECECQLEAAK"
     gene            6480..7094
                     /locus_tag="CTU_RS21020"
                     /old_locus_tag="Ctu_2p00110"
     CDS             6480..7094
                     /locus_tag="CTU_RS21020"
                     /old_locus_tag="Ctu_2p00110"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_019104936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815859.1"
                     /db_xref="GI:502540013"
                     /translation="MSIPTLPGSVFSVIVRTAEYFFFNRKSRQRREAEAASQLVSVLD
                     RFVVGCDAVAEDDGYPPFTNPEYHDYRDRTPQSETVLLAVPDIPGRELLPISISDRVR
                     VIESLQNDTSRALMEARECDDGSGDGFYAKRQEIFSLLGFKAVELTRELRSAYRLSPP
                     SIEHRNREKRIEEKLRYHDGFSVKIRRIEQRIARKAKMAAGKIT"
     gene            complement(8311..8772)
                     /locus_tag="CTU_RS21025"
     CDS             complement(8311..8772)
                     /locus_tag="CTU_RS21025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_008324109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041924275.1"
                     /db_xref="GI:754513612"
                     /translation="MLAILDDLDLRDWQTRHNLETLAERAGLATYSDAGHKSISRASR
                     GCDRLFWLNAIITEKAQFNPYDARCACKHIEVTEDFFAILGIPLKQVYRERARLLKAD
                     PEEMITSWDSRLIAIRVENWKRKAMAGLARMQAKRQAARERKKEYYSPTTA"
     gene            complement(9473..9829)
                     /locus_tag="CTU_RS21030"
                     /old_locus_tag="Ctu_2p00150"
     CDS             complement(9473..9829)
                     /locus_tag="CTU_RS21030"
                     /old_locus_tag="Ctu_2p00150"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006687072.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_006687072.1"
                     /db_xref="GI:493737892"
                     /translation="MVPKRLKEAREAAGISQEKLAQLVDLESVNSRSKISNYEAGRFA
                     PSFEFVCRVAKALGYPEYYFYTVSDATAQILLQQHREGFHLQEGIAGEVQKMAEQLDD
                     VRKLVAELNECLKHRS"
     gene            10077..10526
                     /locus_tag="CTU_RS21035"
                     /old_locus_tag="Ctu_2p00160"
     CDS             10077..10526
                     /locus_tag="CTU_RS21035"
                     /old_locus_tag="Ctu_2p00160"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011172004.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional antiterminator NusG"
                     /protein_id="WP_041924272.1"
                     /db_xref="GI:754513609"
                     /translation="MYKWYVLYCNSQDIQRISRRAEDIGVEVFCPRYIKVTPRTDCRA
                     VRQEEKPLFPSYLFLRFDVNVVHTSTITSIPGAHGFVSFGAAPCTVPESVITAIECAR
                     LLALNPDEDVFECRNISPDLLLKIQELSQIRTPLQRQVAFSRLLQNQ"
     gene            10601..10816
                     /locus_tag="CTU_RS21040"
                     /old_locus_tag="Ctu_2p00170"
     CDS             10601..10816
                     /locus_tag="CTU_RS21040"
                     /old_locus_tag="Ctu_2p00170"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012815864.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815864.1"
                     /db_xref="GI:502540018"
                     /translation="MPKSVPGKSSTAVIYIGKGRYQDLAKHAREISYLSEANIRPSTF
                     LHYLIDQFSDQAHSELLKQLLADKQKE"
     gene            10820..11041
                     /locus_tag="CTU_RS21045"
                     /old_locus_tag="Ctu_2p00180"
     CDS             10820..11041
                     /locus_tag="CTU_RS21045"
                     /old_locus_tag="Ctu_2p00180"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012815865.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815865.1"
                     /db_xref="GI:502540019"
                     /translation="MRKPSYHVYVTQEVPTGENGEKSTYWTKVGAAFPHNGKSGLNIM
                     ITPGISVSGKLVLLEPKDDNDAPQGAPVN"
     gene            11057..11767
                     /locus_tag="CTU_RS21050"
                     /old_locus_tag="Ctu_2p00190"
     CDS             11057..11767
                     /locus_tag="CTU_RS21050"
                     /old_locus_tag="Ctu_2p00190"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_015874990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_012815866.1"
                     /db_xref="GI:502540020"
                     /translation="MLSTSAFLAVAMQCAATVHPSTSLDVVRVESGFNPYAIAEIVPR
                     PERQPGDKGFITHMPTNKEDAQRIVTQIEAKGRRYSVGLMQITSTNFDTYGVTASDLF
                     NPCTNLSVYEKIITDCYERGGTLKRALSCYYSGNFNTGQQPETALAKTSYVQRIGYSP
                     DKPRYAVPGTSEDKISSPATLTAVPVEAPPSQQVIWPATVVRGVPAQLRQKKSPALYY
                     PAKVIRGSRDLTKNEEDK"
     gene            11764..12042
                     /locus_tag="CTU_RS21055"
                     /old_locus_tag="Ctu_2p00200"
     CDS             11764..12042
                     /locus_tag="CTU_RS21055"
                     /old_locus_tag="Ctu_2p00200"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_006687078.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815867.1"
                     /db_xref="GI:502540021"
                     /translation="MNMFKALTRVSPSLAALAASPAFADGFTRANTVGQKIATGLHGL
                     AAITITVAVIWIGYKTLWKGESLSQCGYIIIGGILIGGGSEIAALIMG"
     gene            12055..14799
                     /locus_tag="CTU_RS21060"
                     /old_locus_tag="Ctu_2p00210"
     CDS             12055..14799
                     /locus_tag="CTU_RS21060"
                     /old_locus_tag="Ctu_2p00210"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017346464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_041924273.1"
                     /db_xref="GI:754513610"
                     /translation="MAKLLKAMKRPAALWGVPMVPLLGVTGVTIIVAIWTSVSLLLLL
                     PVEFLVMKSLTRNEPMRFNLIAVWLRARGKPVANRLFGATTFMPVEHEPVDITEFIDA
                     MKLNQSATIRKYIPYSSHIHPNVIRSPKSDLYCTWEVMGTPFDCESEETLQIGTNQLH
                     GLIRSFEGLPVTFYVHNIREQFTDSLHKESGNPYADKISELYYASLKDAPFRRNRLFI
                     TVCFRPFVGLEKAERKRMKDTEKLKELDGALQEMLEIKSTLDTAFSRYGARSLGTFTE
                     GKAVYSSQLAFYEYLLTHQWRRVRVTRTPAYDVMGAAALFFSAESGQINHVSGTSYFR
                     GLEVKEFSEETGTGMMDSLLYAPCDYVITQSYTCMSREEAKKAIKRTRRLLMSSDDDA
                     ISQRLDLDVALDLLTSGKIAYGKHHFSIMVHSPTLDSLVADTNEISNALNNIGITPVP
                     AEISLSAAYMAQLPGNYNLRPRKGELSSQNFVELAALHNFYPGKRDRAPWGDAMALLR
                     TPSGDGYYLNLHNTLADKDEFDEKNPASTCILGTNGSGKTMLMTFLENMQQKYRRADS
                     FSPDARTKRLTTVYLDKDRGAEMNIRALGGRYYRVISGERTGWNPFSLPATKRNINFI
                     KQLMKILCTRNGSTITPRDEQRLSVAVDAVMSNEPEYRLFGITRLRENLPEPATKEAQ
                     ENGLDIRLSQWAQGGEFGWVFDNESDTFDISNCDNFGIDGTEFLDDANVCAPISFYLL
                     YRITSLLDGRRLVIYMDEFWKWLRDPVFKDFAYNKLKTIRKLNGFLVVGTQSPHEIIK
                     DDIAPAVIEQCGTQILAANPSADRSHYVDGMKFEPEVFDVVKGLDPQARQYVVVKNQF
                     RRGDTKRFAARVTLDLSGIGRYTKVMSGDAPNLEIFESIYREGMQPHEWLDTYMAKAL
                     "
     gene            14815..15522
                     /locus_tag="CTU_RS21065"
                     /old_locus_tag="Ctu_2p00220"
     CDS             14815..15522
                     /locus_tag="CTU_RS21065"
                     /old_locus_tag="Ctu_2p00220"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002911685.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815869.1"
                     /db_xref="GI:502540023"
                     /translation="MKTRFRALFFVCMMVSPLANAGIPVLVDADPMREAEWLKEAQRW
                     METAKHYQSQIQAYKDQLATATGARDIADFVNQAKSLTADLERLRKPGQALNDLLMSG
                     GSSGQFDELYEKYKIFNTCNTGQSGSYADVCKQEVINKAVQLEQTNDIQRDVDKTLAE
                     IDRLSNRIALSKDSKESQDLANSIQLKSVMLNTLTNQWEMSVKAAEKREQVLKEERNK
                     QWNKQQLNAPTADLNNL"
     gene            15530..15772
                     /locus_tag="CTU_RS22440"
                     /old_locus_tag="Ctu_2p00230"
     CDS             15530..15772
                     /locus_tag="CTU_RS22440"
                     /old_locus_tag="Ctu_2p00230"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000949384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815870.1"
                     /db_xref="GI:502540024"
                     /translation="MLSKKTILASSLALCFAVIGCKEEAKTTKWYREHPDELKVVYEK
                     CQKSGDASENCKNANEAHSQIKQLNAPTPDLNNLEE"
     gene            15776..16849
                     /locus_tag="CTU_RS21070"
                     /old_locus_tag="Ctu_2p00240"
     CDS             15776..16849
                     /locus_tag="CTU_RS21070"
                     /old_locus_tag="Ctu_2p00240"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_001593439.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815871.1"
                     /db_xref="GI:502540025"
                     /translation="MSAGLFVGVDKYLIGGITDATKGLMMSYSSMMMGLAAMSATLYI
                     TWRGYQTLAGKLSTPMEDVVWDIMRMAIILSFVANAEGYLDGVIDAINGLKEGFSGSD
                     SIWQLLDSLWNKAKVLGKTLHDMDDSTYIKDEGMTAQFYVWLGVFVLMIVTAFVSMVA
                     EVMILLLSITAPVFIFCLIYGFLRPMFNNWLQNIFAAILTILFSALSLRIVVTYLNLV
                     LDKATRVADNSAIVELGAQVCLAGVCAAILVYISAKLAAALAGASATVSMQGLAAMGI
                     GAAAFGAGKLAGGATKQTTRSIRDNIQGWKDASAGKPLTPGGGAGYNASKARKYAIEQ
                     MIARNEARRLAQSRESAVKKFNS"
     gene            17057..17740
                     /locus_tag="CTU_RS21075"
                     /old_locus_tag="Ctu_2p00260"
     CDS             17057..17740
                     /locus_tag="CTU_RS21075"
                     /old_locus_tag="Ctu_2p00260"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009653100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_012815873.1"
                     /db_xref="GI:502540027"
                     /translation="MSEQKLIAESRTFEQQMIDRDKRATKAGFIVGGVGLLIAVLALV
                     AVVVMLPLKQTDVELYTVDNHTGRVEHITRTSKTSLTAEEAYQKAMAANYVKIRERYV
                     YPSLQDDYETVQMYNSPEVNNDYLALYAGKNAPDKVYNNGANTVKIDILSSQITDGTA
                     PDKVATIRYKKTIRRLVDNQTRYEYWDARFTFHSDPNKEMSDEEREVNYFGFTVTSWQ
                     TDREIRGGE"
     gene            17737..18645
                     /locus_tag="CTU_RS21080"
                     /old_locus_tag="Ctu_2p00270"
     CDS             17737..18645
                     /locus_tag="CTU_RS21080"
                     /old_locus_tag="Ctu_2p00270"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000976328.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer protein VirB9"
                     /protein_id="WP_071820358.1"
                     /db_xref="GI:1105107612"
                     /translation="MMNKITPVFLALMMSGAAWGAAMPQASRYDARIQQVIYNPQNVT
                     VINTMPGFMTTLVFDNDEAVIDAKPGFEEAWEAKKDANRVYVRPLALQQGAPGQDGNT
                     AQVVIPPNSQDWHTNMLVVTTKRLYNVELNVIDDKSAQQPAFQVSYSYPGEARDKANR
                     EASARQKEWEQKQQEARIEKSLNSAQTPRNWDYTKYPGQGSFSIDPDFAYDDGRFTFV
                     GFSPAKSIPSVTKELNGKEHTVNTGIQKKGDYTVLVIQEVTPRLVLRSGNAVVGLENK
                     SYGRVQAPDGSTVSPKVERVEKPESN"
     gene            18688..19992
                     /locus_tag="CTU_RS21085"
                     /old_locus_tag="Ctu_2p00280"
     CDS             18688..19992
                     /locus_tag="CTU_RS21085"
                     /old_locus_tag="Ctu_2p00280"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012131839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type VI secretion protein"
                     /protein_id="WP_041924274.1"
                     /db_xref="GI:754513611"
                     /translation="MKDEDQTLPPDEHQVAPAQAGEDVAELEREARAKREAAMLNEHD
                     DDEKDPVQPAVNKLKKRKRGKMTAFLALVAVALIFLTWGGNWVYRNFLAQPKEEKQEE
                     PAPQTSQTDYRKRNDLGMATDTGQQEQPQQDNSQGSTEGNNTVGTGQAAPAAPLQLDK
                     ARFLVRRDGEASSQGQVKTRQQEMAQLSGATSTDATAPAQAQGQGQGQGQGQGQQQDA
                     AAATTGQSPAVVRRIPLNPDLYIPENRSIPCSLDYRFVSDRAGKLRCTITTDIWSASG
                     NTKLIEKGTTATGIYRTGGEDGMKHGQGRAFVIITKLRTKQKPYLDIPMVDTSAAGAL
                     GEAGMDGWVDNHFSDRFAGALLVGMIPDVAAWASNSAGQKDRNTDYTENSRQAMADMA
                     RTTLENSINIPPTLYKNQGEIINLITGQDIDFSNIYTLRMKE"
     gene            19989..21101
                     /locus_tag="CTU_RS21090"
                     /old_locus_tag="Ctu_2p00290"
     CDS             19989..21101
                     /locus_tag="CTU_RS21090"
                     /old_locus_tag="Ctu_2p00290"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016157228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_012815876.1"
                     /db_xref="GI:502540030"
                     /translation="MTATNISLDRYKQRFFGDFLELPGLTEIAVNRPDELFTKIDGVW
                     TQHAVSLSYDDCYNFARCLAKHHNDNIEDIKPGLSATLESGERCQLVVPPACERGTVS
                     ATIRKPSRVQIPHQSYIDAGFYNRVTGSEQTETHDAELIELYNTKNIPLFMEKCVEYG
                     KTIAVAGETSTGKTTYMKMLIGYIPLDLRITTIEDNPEITFFKHYMKMLIGYIPLDLR
                     ITTIEDNPEITFFKHKNYVHLFYPSESSDEKGSIVTPASLLRWNYRMNPDRILLTEVR
                     GAEAWDFLKITGSGHEGSMTSIHAGSAMEAIDGFITRCYENPQCAQLPYAFMLRKVLD
                     SLDVIVSIDLDGNIRRMNDIYFRPVHRKEYFEAMKS"
     gene            21098..21496
                     /locus_tag="CTU_RS22445"
                     /old_locus_tag="Ctu_2p00310"
     CDS             21098..21496
                     /locus_tag="CTU_RS22445"
                     /old_locus_tag="Ctu_2p00310"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_000592251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Cag pathogenicity island protein Cag12"
                     /protein_id="WP_071820359.1"
                     /db_xref="GI:1105107613"
                     /translation="MINVKHTIFITSLLCGCSSPPPPVPVEWDKPANSVNSTMPQWDD
                     NSIIIPSREVNGKWSAVIRATDFDDTLWTPAVFYAAAHSPRIVISTPSGDNFFKAKSW
                     LRQHGAKGVIEYQPTLNCIACSETSIYFSR"
     gene            21523..21828
                     /locus_tag="CTU_RS21095"
                     /old_locus_tag="Ctu_2p00320"
     CDS             21523..21828
                     /locus_tag="CTU_RS21095"
                     /old_locus_tag="Ctu_2p00320"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_009635187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011998919.1"
                     /db_xref="GI:500804372"
                     /translation="MKRTVISAALLCLFAGAPFYSFAADPCKVAFCMYGKATGNSGGS
                     ECKSAERDFFNIVKKNKHGFQPGRTFDARKAFLGECPDAGKEAINTILSKYGRKRGG"
     gene            22108..22413
                     /locus_tag="CTU_RS21100"
                     /old_locus_tag="Ctu_2p00330"
     CDS             22108..22413
                     /locus_tag="CTU_RS21100"
                     /old_locus_tag="Ctu_2p00330"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011998920.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012815878.1"
                     /db_xref="GI:502540032"
                     /translation="MNNQDLFIKNINSKEQDRISVKKIVDNISKSAHHGCGLYHEVYH
                     ARLLNELRNHTEYLNAVDAAKLTDYAASQGLYIDDDSLRAAEEAEAECWREIRAQQE"
CONTIG      join(FN543095.1:1..22448)
//
DBGET integrated database retrieval system