GenomeNet

Database: RefSeq
Entry: NC_013964
LinkDB: NC_013964
Original site: NC_013964 
LOCUS       NC_013964             437906 bp    DNA     circular CON 03-AUG-2015
DEFINITION  Haloferax volcanii DS2 plasmid pHV3, complete sequence.
ACCESSION   NC_013964
VERSION     NC_013964.1  GI:292493938
DBLINK      BioProject: PRJNA224116
            BioSample: SAMN02604027
            Assembly: GCF_000025685.1
KEYWORDS    RefSeq.
SOURCE      Haloferax volcanii DS2
  ORGANISM  Haloferax volcanii DS2
            Archaea; Euryarchaeota; Halobacteria; Haloferacales;
            Haloferacaceae; Haloferax.
REFERENCE   1  (bases 1 to 437906)
  AUTHORS   Hartman,A.L., Norais,C., Badger,J.H., Delmas,S., Haldenby,S.,
            Madupu,R., Robinson,J., Khouri,H., Ren,Q., Lowe,T.M.,
            Maupin-Furlow,J., Pohlschroder,M., Daniels,C., Pfeiffer,F.,
            Allers,T. and Eisen,J.A.
  TITLE     The complete genome sequence of Haloferax volcanii DS2, a model
            archaeon
  JOURNAL   PLoS ONE 5 (3), E9605 (2010)
   PUBMED   20333302
  REMARK    Publication Status: Online-Only
REFERENCE   2  (bases 1 to 437906)
  AUTHORS   Madupu,R.M., Hartman,A.L., Norais,C., Badger,J.A., Delma,S.,
            Haldenby,S., Khouri,H., Ren,Q., Lowe,T., Robinson,J., Furlow,J.M.,
            Pohlschroder,M., Pfeiffer,T., Allers,T., Daniels,C. and Eisen,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2010) J. Craig Venter Institute, 9704 Medical
            Center Drive, Rockville, MD 20850, USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            CP001953.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 08/02/2015 02:46:53
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 3,925
            CDS                                       3,805
            Pseudo Genes                           :: 62
            CRISPR Arrays                          :: 3
            rRNAs                                  :: 2, 2, 2 (5S, 16S, 23S)
            complete rRNAs                         :: 2, 2, 2 (5S, 16S, 23S)
            tRNAs                                  :: 51
            ncRNA                                  :: 1
            Frameshifted Genes                     :: 39
            Frameshifted Genes On Monomer Runs     :: 3
            Frameshifted Genes Not On Monomer Runs :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..437906
                     /organism="Haloferax volcanii DS2"
                     /mol_type="genomic DNA"
                     /strain="DS2"
                     /db_xref="taxon:309800"
                     /plasmid="pHV3"
     gene            201..1433
                     /locus_tag="HVO_RS00005"
                     /old_locus_tag="HVO_B0001"
                     /db_xref="GeneID:8919379"
     CDS             201..1433
                     /locus_tag="HVO_RS00005"
                     /old_locus_tag="HVO_B0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cell division control protein Cdc6"
                     /protein_id="WP_004041152.1"
                     /db_xref="GI:490140803"
                     /db_xref="GeneID:8919379"
                     /translation="MTSDESEGGTRDPLFRYDQPIFANEDILKISHLPGPDKIVGRDE
                     HMSKVAQALNPAIFGREPTHLFIFGKTGSGKTLTARLVSERLQHEAVREDVDVRIAVI
                     DCGEQHTEASVIKTLASQVNDPSKSGMTIPERGLSTGDYYNRLWQVLDTCSDVTIVIL
                     DEIDMLRDDEVLRKLSRAGENQKIVDSRIGIIGISNKIDYPEELTERVKSSFAHDELV
                     FPSYDANQLREILENRKDAFKPGVLTDDVIPLASALAAQEHGDARKAIDILRNAGRIA
                     RNESAETVTDDHVRAAKEKSEADRFSELLEGTATQSKAVLYSLVLQTGGRKTAEITTN
                     KIYRQYLTVADDLDMDQLSERRVQELLQELDFLNVIQSEVRGRGRGQGVHGTHRLLED
                     PDIVKRVLLRDSRISTLE"
     gene            1555..2712
                     /locus_tag="HVO_RS00010"
                     /old_locus_tag="HVO_B0002"
                     /db_xref="GeneID:8919138"
     CDS             1555..2712
                     /locus_tag="HVO_RS00010"
                     /old_locus_tag="HVO_B0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041151.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetylornithine deacetylase"
                     /protein_id="WP_004041151.1"
                     /db_xref="GI:490140802"
                     /db_xref="GeneID:8919138"
                     /translation="MDEELRSLLTSLVEIETENPPGDEAAAAQFVSDWLDSRGVSATL
                     VEEPFPDRPQVAARVGDGEPSVVLNGHLDVVPAGDRDQWTHPPYDPTVRDGRLYGRGS
                     ADMKCGVALAMLATVEFADAFESGALDGSLVFHAAVGEETAEPGTKTLLERGYDGTYG
                     VVLEPTALRTATSAKGLGWYEISVGGDPSHASRPDEGDNAIGNARPVLDALEAYDEEI
                     RARSDSLVGRPTATVTRFEAGTKENVVPESATITVDRRFVPAETVEEVDAEIDALLSD
                     VTAEHDLNVEWTRTRVYESAAVPTDSDIAARFRDAAAERADIDPEPWGIRAATDVRNL
                     VNDAGMDAITWGPGSMAQAHAYDEYIELSEVEAGYDILRTALRGLFEAGAD"
     gene            complement(2760..3179)
                     /locus_tag="HVO_RS00015"
                     /old_locus_tag="HVO_B0003"
                     /db_xref="GeneID:8919263"
     CDS             complement(2760..3179)
                     /locus_tag="HVO_RS00015"
                     /old_locus_tag="HVO_B0003"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968446.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="WP_004041150.1"
                     /db_xref="GI:490140801"
                     /db_xref="GeneID:8919263"
                     /translation="MSDAINLETAKTLIEAAEAEAESMGLRMVITVANPEGNLIAQHR
                     MDDAWLASVNISRNKAYTAAALQMPTHELAEGSQPGESLWGLQTTDENRLVVFGGGYP
                     LEVDGELVGTVGVSGGEVSEDMAVASAAVERFEELVE"
     gene            complement(3414..4661)
                     /locus_tag="HVO_RS00020"
                     /old_locus_tag="HVO_B0004"
                     /db_xref="GeneID:8919323"
     CDS             complement(3414..4661)
                     /locus_tag="HVO_RS00020"
                     /old_locus_tag="HVO_B0004"
                     /EC_number="2.1.2.1"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008608059.1"
                     /note="catalyzes the reaction of glycine with
                     5,10-methylenetetrahydrofolate to form L-serine and
                     tetrahydrofolate; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="serine hydroxymethyltransferase"
                     /protein_id="WP_004041149.1"
                     /db_xref="GI:490140800"
                     /db_xref="GeneID:8919323"
                     /translation="MPYDTVRGTDPAVADALAGERERQNDTLAMIASENHVSEAVMEA
                     QSSELTNNYAEGYPGSRYYGGCEYADEVEQLAIDRAKELWGAEHVNVQPHSGSQANMG
                     VFLAVLDPGDKILSLDLTHGGHLSHGHPVNVAGKTYEVEQYEVNAETGYVDYDQLAAK
                     AEAFDPDIIISGYSAYPREVEWERVQAAADSVDAYHLADIAHITGLVAAGEHSSPVGT
                     ADFVTGSTHKTIRSGRGGIIMCDEEHADDVDSAVFPGLQGGPILHNVAGKAVGFGEAL
                     TPEFEEYASQVVDNAAALGERLQERGLELVSEGTDTHLVLVDLRPSHPDTTGKDVEAA
                     LEEVGIVLNANTVPGESRSAFNPSGIRAGTPALTTRGFDEEACRTVADLIYEIVDAPH
                     DESVEGFVDQKVDELTAEYPLYD"
     gene            5024..6265
                     /locus_tag="HVO_RS00025"
                     /old_locus_tag="HVO_B0005"
                     /db_xref="GeneID:8919017"
     CDS             5024..6265
                     /locus_tag="HVO_RS00025"
                     /old_locus_tag="HVO_B0005"
                     /EC_number="4.3.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041148.1"
                     /note="catalyzes the formation of 2-oxobutanoate from
                     L-threonine; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="WP_004041148.1"
                     /db_xref="GI:490140799"
                     /db_xref="GeneID:8919017"
                     /translation="MSEVESLPVQYSDIERASERLENDRVVKRTPIERSTSLGDLVGA
                     DVYLKMEHLQWTGSFKTRGAYNKIRQDTDRGIDEFVAASAGNHAQGVALAATECGADS
                     TVVMPENAPQTKIDATRDYGAEVELVGEDFQETMAYAQSLAEESDAEFVHAYDDCDIV
                     AGQGTLGVEMYRDLPEMDTVVVPIGGGGLISGIATAIKHHDPEIRVVGVQAEGAETVH
                     ESLDKGVPVTLDDTNTIADGIATGGISELTLRTIEEHVDEVVTVSDGEIAEAILLLLE
                     RAKQVVEGAGAASVAAVLSDDLDVEGETVMPLLCGGNLDMTMLQTVLVHALTSRRQTL
                     RLRVRIRDEPGEMARLSRLIADRDANIHDVRHVRAVDALDVGEAHLLFRIETKGAEHA
                     AAVVDTIEDAGYAVDDVSEPS"
     gene            complement(6420..7298)
                     /locus_tag="HVO_RS00030"
                     /old_locus_tag="HVO_B0006"
                     /db_xref="GeneID:8919155"
     CDS             complement(6420..7298)
                     /locus_tag="HVO_RS00030"
                     /old_locus_tag="HVO_B0006"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041147.1"
                     /db_xref="GI:490140798"
                     /db_xref="GeneID:8919155"
                     /translation="MSVGTSLRRLGEFLEECERTDAASVRESSVTVTDSGASADVEFA
                     LSSDADGDIPVRIRGASLDSDGSIGLTLGVDDVLPSDREHVAVDAADVSLDGDPAVVV
                     TVATDAPTTSSTETADDDADSEPHEAVRNPNVPAFEDTTYLEAVYARYETFERMADAF
                     EMDVTDETVRRYMIDQGVHEPSSYETSLAGDPTGVERPPAPAADGDGSPEALADGIGL
                     PESVTIDQLADAANDAKTVYEFGKALDLERMDALDLLQDLDLLEFVMGRLTTDDDPDV
                     SREDVVARIRQSAGET"
     gene            7541..8191
                     /locus_tag="HVO_RS00035"
                     /old_locus_tag="HVO_B0007"
                     /db_xref="GeneID:8919069"
     CDS             7541..8191
                     /locus_tag="HVO_RS00035"
                     /old_locus_tag="HVO_B0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterio-opsin activator"
                     /protein_id="WP_004041146.1"
                     /db_xref="GI:490140797"
                     /db_xref="GeneID:8919069"
                     /translation="MSLITVADIAHDDLALTPTIQSEAASEIDVISQSATDPETGLFF
                     FVVKGADVSAFEAALEVDHTVSDWQLVSEREESAVYRIGHTPDTILLSPIITELGGLM
                     LDACSNDTAGWRVRLQLSDREALSEVWVYCEANDISFELNRMFRQDGWMNGEPSKLTD
                     AQRDALVAAYEHGYFEEPREAALDDLSEVLDISPTAVSGRIRRGTAELVESILLDE"
     gene            complement(8220..8594)
                     /locus_tag="HVO_RS00040"
                     /old_locus_tag="HVO_B0008"
                     /db_xref="GeneID:8919360"
     CDS             complement(8220..8594)
                     /locus_tag="HVO_RS00040"
                     /old_locus_tag="HVO_B0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097080.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041145.1"
                     /db_xref="GI:490140796"
                     /db_xref="GeneID:8919360"
                     /translation="MPDDESAKLAEKPHAGVVTCPACDLHVSVTEPNDAVDLYRRHAN
                     VTGHDVEWERVAFDVDVESDGVKTALTELGEDHPDGVELGRLAAALADNGVAIGETLD
                     AVRDLRMSGEIYEPQDDYVLAV"
     gene            complement(8587..9729)
                     /locus_tag="HVO_RS00045"
                     /old_locus_tag="HVO_B0009"
                     /db_xref="GeneID:8919248"
     CDS             complement(8587..9729)
                     /locus_tag="HVO_RS00045"
                     /old_locus_tag="HVO_B0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573032.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase"
                     /protein_id="WP_004041144.1"
                     /db_xref="GI:490140795"
                     /db_xref="GeneID:8919248"
                     /translation="MTRWNNNRDEIGAVSADITAETNALPARYFTDPEVHEMEKEKVF
                     GRYWVYAGHETHIPDAGDYFTRTIGDKQIIVTRDGEGDVRAFYNVCAHRGSKMLDDTP
                     MTDPGSLSRITCPYHLWAYELDGSLQSTPKSFEEASLNPDLDDDAVSELDPEENGLME
                     VNTDAIGPLVFVNFEDEPSLSLAEQAGEMKTELEDLPLGEYEHARRYVSEVECNWKTF
                     SGNYSECDHCQANHQDWVQGLELMESELEVNDYHWVLHYKHKEDVDDEMRIHPEHEAK
                     FYYFWPNFTVNMYGTADGYGTYIIDPIDEGRFQLIADYYFRDSELSEEEEKFVQTSRQ
                     LQEEDFELVERQYEGLTSGALGQAQLGPNEHTVHKLHRLAQDAYNA"
     gene            9927..11069
                     /locus_tag="HVO_RS00050"
                     /old_locus_tag="HVO_B0011"
                     /db_xref="GeneID:8919123"
     CDS             9927..11069
                     /locus_tag="HVO_RS00050"
                     /old_locus_tag="HVO_B0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968453.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltryptophan oxidase"
                     /protein_id="WP_004041143.1"
                     /db_xref="GI:490140794"
                     /db_xref="GeneID:8919123"
                     /translation="MSVRDDRYDVAVVGVGGMGSATAYHLADRGLDVVGLERYDIPHS
                     QGSSHGITRIIRRAYYEHPSYVPLIERAYDLWDDLADETGRDIIHRTGSIDAGPVDND
                     VFAGSKRSCEEHDIPHEVLTGAEVNERFPGYELPEDYRAVYQEDGGFVVPEQSIIGYT
                     EAAQARGAEIRARERVEDWAETNDGGVRVRTDRGVYVADALVLAAGAWNYKLADALDG
                     LAIPERQALAWFQPESPATFAPEEFPVWNLSVPEGRFYGFPVHDVPGFKLGKYHHRDE
                     EVDPDDFDREPNRADEAILRDVTEKYFPEAAGPTMSLATCMFTNSPDEHFILDTLPDH
                     PQVAVGAGFSGHGFKFASVIGEILADRAGDGESDLPLDMFSLDRFE"
     gene            11360..13114
                     /locus_tag="HVO_RS00055"
                     /old_locus_tag="HVO_B0012"
                     /db_xref="GeneID:8919032"
     CDS             11360..13114
                     /locus_tag="HVO_RS00055"
                     /old_locus_tag="HVO_B0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061810.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine/betaine ABC transporter"
                     /protein_id="WP_004041142.1"
                     /db_xref="GI:490140793"
                     /db_xref="GeneID:8919032"
                     /translation="MANSNDSTGRSTSELQEDLFYPDMEREPGDRNIQGLGFDIHPVV
                     FPAALLIIGVFVAATLILGEQAASVYSGIRGFFEGNFGWFFLLSVNLFIVVLAYFALS
                     KYGKITLGGVEAEKEFSDFSWMAMLFSAGMGIGLMFYSVSEPLYYFSNVPGFFDAEAG
                     SGGAGIAAMTQTFFHWRFHPWAIYGLVGLGLAFFSFNRGLPLTFRSIFWPLLGERIYG
                     WPGHLIDLVAVFATLFGLATSLGLGVAQINTGLSYILGGSMLGVLSVPNNTGMQIALI
                     AVITLIATASVAAGLEGGIRRLSTVNVFLMFVLLTFVLAAGATMSIFGAWVQGLGNYF
                     SDFLSLAFFTGTLGDGASTVNAWTVFYWAWWIAWSPFVGMFVARISKGRTVREFVFGV
                     FVLPSLFSTVWLSAFGGSALFNSLQGNGAVLATYNEAGQTVAMFALLEQFPFSAVSGL
                     LAVTLIVTFFVTSSDSGSLVVDHLTSGGKHNVPRTQRIFWAVIEGLVASLLLYGGGLG
                     ALQTAAIATGFPFAVVLVIMCYTVYLGLDKEYELLQSEEFAERIEDLADEDIDIDVGR
                     SQTSVVTNVRQNPGTTDD"
     gene            13523..16036
                     /locus_tag="HVO_RS00060"
                     /old_locus_tag="HVO_B0014"
                     /db_xref="GeneID:8919270"
     CDS             13523..16036
                     /locus_tag="HVO_RS00060"
                     /old_locus_tag="HVO_B0014"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573040.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycine cleavage system protein T"
                     /protein_id="WP_004041140.1"
                     /db_xref="GI:490140791"
                     /db_xref="GeneID:8919270"
                     /translation="MNTWSTFPERAGTVVVGAGCVGCSAAYHLAESGREDVVVLDRGP
                     LFETGGSTSHAPGLVFQTAGNKLMTEMASYTRDLYDGFGDFRTCGGIEVAYTEDRWDF
                     LKRKREWGQSYGIDEGQLLTPEEVESRVPQINADVIYGGYYVPSDGKADAVSAAESMA
                     EEAREAGVEFYGHTEVTDIDTTDGSVDAVETEHGRIEADEVLVATNIWGPLFGEMVGT
                     DIPLVPCAHQYLVSDELDELEGAEREIEQPLLRHQDHSLYYRQHGERYGIGSYNHESL
                     LVDPADIYGPDKLDDLGLEYPSLREFTEEHFYENTHPDHDRSAFDAASELVPGFEDCE
                     WTSAINGMFSFTPDGMPILGPDEDTEGLWWALAVWVTQSGGAGDIVASWMEDGTPRLD
                     GSRVNASGAHVSRFQSHTGSREYTYGRGAQQYREVYQLVHPREQPDGQRALRRSPFYD
                     RQADLGAEFYDSDGWEVPQWYESNETLLETYDVPDRPDWLSQNWSKVQGAEHQHLREK
                     VGMVDMTTFTPIEVSGPGALEFLQGLLTNDMDVTPGRMRYSAMLNEDGGVLADLTVAR
                     LGDERFVLFTGGGSSATLHSRWVTEHAPDDGSVDVTAHVSSRTGIGVFGPDSRKVLSD
                     LVEADLSNDEFPFYSAQETYLGSIPVTMLRLSYAGELGWEIYAPTEYGSQLWDAIREA
                     GEEYDIAPVGWAALDSTSMEKGFRLWGTDLTPEHNPYEAGIGFAADLDTDFVGKAALV
                     ADKNDDSPSDRIVPITLDEEEAVVDAGHPVFVDDEVVGYCCRADYGYTIDAGIAYAYL
                     PEEYASSGQDVEIRYEGDAHPATVRSGPLFDPDRDKMIR"
     gene            complement(16218..16595)
                     /locus_tag="HVO_RS00065"
                     /db_xref="GeneID:25143362"
     CDS             complement(16218..16595)
                     /locus_tag="HVO_RS00065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061806.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049914704.1"
                     /db_xref="GI:909671350"
                     /db_xref="GeneID:25143362"
                     /translation="MNVAETDFLLALIKDEDWLGDAAEAVYRNHRDELWTSQFTLIEL
                     LMVAYREERDTERVITNVAALLEVRGDVDTVLTAATYVEDHGFTPFDALHLVESDGDT
                     IVSSDETYESFAPRLDLKTVEDE"
     gene            complement(16592..16822)
                     /locus_tag="HVO_RS00070"
                     /old_locus_tag="HVO_B0016"
                     /db_xref="GeneID:8919045"
     CDS             complement(16592..16822)
                     /locus_tag="HVO_RS00070"
                     /old_locus_tag="HVO_B0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968458.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041138.1"
                     /db_xref="GI:490140789"
                     /db_xref="GeneID:8919045"
                     /translation="MSEATLDGRGRLTLPKEIRERYGEHYHIVQLHDGIKLIPIEDDP
                     LGALRTEFADVEKTAEELRRGARNAALDEAGR"
     gene            complement(16978..17400)
                     /locus_tag="HVO_RS00075"
                     /old_locus_tag="HVO_B0017"
                     /db_xref="GeneID:8919184"
     CDS             complement(16978..17400)
                     /locus_tag="HVO_RS00075"
                     /old_locus_tag="HVO_B0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041137.1"
                     /db_xref="GI:490140788"
                     /db_xref="GeneID:8919184"
                     /translation="MSEDPFGDLDAAMGSGETDSGPEPEPEPADEDAGTDDAVESDDE
                     SATESASAEPVDPRERPAFEFDETVHKALYVLEAVADEFDDIITYDVERELTRDHGLK
                     GVTKSELHNAALAVATEHPEEIVERVLEQRGVDDEDSE"
     gene            complement(17397..18260)
                     /locus_tag="HVO_RS00080"
                     /old_locus_tag="HVO_B0018"
                     /db_xref="GeneID:8919296"
     CDS             complement(17397..18260)
                     /locus_tag="HVO_RS00080"
                     /old_locus_tag="HVO_B0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_004041136.1"
                     /db_xref="GI:490140787"
                     /db_xref="GeneID:8919296"
                     /translation="MSRAVSVCLLKGGIGKSTTSINLARELAHRGSDVLLVDLDPNGH
                     TTTGLGFGEEFYSEAHLGDVLLDDAELEPRELILETGFEIDLLPSNDRIEQVESDLGG
                     VMMGSARLKQRVIDPLLGDDYDYVVVDCPAARGKLNDNALYATQNLVLPMRPESGALS
                     GLEKTVKRLITPAREHFDLEILAVVPTDLRDRIDHDRPTRRLVEALVSKPNIASKLPN
                     FAYTDPDVFEAIDDGEWDGDLPKPGIRHRSAIDASIREHMPLRDYDSTCDQLACYDEL
                     AQIVEEGEVAR"
     gene            18522..19892
                     /locus_tag="HVO_RS00085"
                     /old_locus_tag="HVO_B0019"
                     /db_xref="GeneID:8919210"
     CDS             18522..19892
                     /locus_tag="HVO_RS00085"
                     /old_locus_tag="HVO_B0019"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097067.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:sulfate symporter"
                     /protein_id="WP_013034953.1"
                     /db_xref="GI:502799977"
                     /db_xref="GeneID:8919210"
                     /translation="MTLAVAAALLLAVVGLHPVSVLPVRSQYALSVFVVALLLWLTKP
                     VPYAISSLACVSLLYALGVVDTFEAAVSGFTSSLVYFLLVLLLLGNAVRSVGLDTQLA
                     NRLLSPDSTPRGAFRSIARNVLVLALFMPSAMARAVAFIPIVEEVTEELDLPSGSGFE
                     RATFLLLGHINPIASMALMTGGGMALVTSGILATSVRPLSWVEWAVLMVPPTVALYVL
                     AAAAAGLLNTVDADSTVDPGTSGIADASADGELTREQGLVAAVMAGTVLAWVVGSFAG
                     LPEILPAVAAVSVLALPGVDVIDADDVKGLSWGVLFLIGATLSILDALKATQTIALVV
                     DLLARFVPFEAFSHWQLVGLLLGFAVTVRVLFSTGSAAIVVILPIVLRFAETFGVTRL
                     YLGLAVLLVVGSTTILPFNTTAVLVSLDRGPLTNRDVTLFGFVTMGLSLVVVTLSWLF
                     YWPLVA"
     gene            20051..20704
                     /locus_tag="HVO_RS00090"
                     /old_locus_tag="HVO_B0020"
                     /db_xref="GeneID:8919107"
     CDS             20051..20704
                     /locus_tag="HVO_RS00090"
                     /old_locus_tag="HVO_B0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterio-opsin activator"
                     /protein_id="WP_004041134.1"
                     /db_xref="GI:490140785"
                     /db_xref="GeneID:8919107"
                     /translation="MSKIDRRLRDARSIELDNAFYVEDGTWIESLTIASNAPFDVESL
                     LADISGVTVFYDEEIPTASTDVQIRRVTILANESYPFILGLVLRQETIPNRIVLQDGV
                     FEVVATAQDWDHFRELADEIQETLGEFELRSVTQDEAPGEPLDSGRLKEVLISKLTDD
                     QLAVLETAFNHGYFHIPRETSETELAEELGIAQSTLSERLRTAERNLLELIYGPRQE"
     gene            20822..22756
                     /locus_tag="HVO_RS00095"
                     /old_locus_tag="HVO_B0021"
                     /db_xref="GeneID:8919171"
     CDS             20822..22756
                     /locus_tag="HVO_RS00095"
                     /old_locus_tag="HVO_B0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034943.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_013034943.1"
                     /db_xref="GI:502799967"
                     /db_xref="GeneID:8919171"
                     /translation="MSEKNRDSSGVERGTGLTRRDYVAATATALGVTGLAGCTGGGGS
                     GNGGTDGGSSLTPDVPSGTPETVETKYWREWETIDADEPPLDYSATAGAVLDPVPLEF
                     SSEDDPWMREHALMVQRGLDALGVKTQLNDRPLNQLYAQSWDTKGLEAIISMSTHGPD
                     PQRGLDPNPLLMRRSETSLSNYDNYYHPDLQEVLTEQSQTTDRPEREELVAEAQRIFS
                     EDVGALITLFPDIITAVNTERWSGYVQTPGNGPTKDSFVWSEVNLQPQTDDRTYIKGV
                     TTSMNSLNLPWAAGGAEAKRLTFIYDGLFDATPDLEVVPALATGGGFVDDTTVELTLR
                     EGVEWHDGEPFTAEDVKFTVELYKEHSSTSQTPFYEPVESVEVLGDHEVRFNLKGPDA
                     AFMTQRVVRSVIIPKHKWEDVENPSQHNPESPVGTGPFTYENWELGTRFEVSKNEGHW
                     MFDDDWRADVLGDQATTGEGVDRVIWINVGNIDSMIGSLQGGEIDAIGTTLSNSQADR
                     AASTAGVEKMTSGNFAPLDTKLMFSCPLVRDKEFRVALAKSIDTEGFAADVLQDRATV
                     PSGENPISDLTPWHTSDTTHYEFDIDGAKSLLEQAGYTRDDDGNLRFPNGDAWAAFVE
                     RIQPGNMHKRRDELGQADFS"
     gene            22808..23803
                     /locus_tag="HVO_RS00100"
                     /old_locus_tag="HVO_B0022"
                     /db_xref="GeneID:8919081"
     CDS             22808..23803
                     /locus_tag="HVO_RS00100"
                     /old_locus_tag="HVO_B0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_049914703.1"
                     /db_xref="GI:909671349"
                     /db_xref="GeneID:8919081"
                     /translation="MSEFQRFLAKRLAISIVLTLVAVSVIFVVLRLLPGSPFESLVTA
                     GNLSQQQITEIRAMYGLDQPMWRQYLSYLQSILLFQFGYSILRSQPVWGVLAPRLVNT
                     LILLVPALVTTAVLSSLLGMYVGWNRGSKLEKLSIIATTFLRSTPVFITGILFVIIFA
                     YNLELVPAFGMRSISASPEGYVETFASFDFLHHYILPFTVSVLYYSGDFLLLARNGVV
                     EKRGSEFLKLHRAKGLSEMQQLARAGRNSMLPILTYFALRLGMIFQGLILLEVVFGWP
                     GIGRELVLAIQQQDYPLVQAAVFIMALAVIVANLVADVLYAYFDPTVSTSGGGAA"
     gene            23800..24720
                     /locus_tag="HVO_RS00105"
                     /old_locus_tag="HVO_B0023"
                     /db_xref="GeneID:8919345"
     CDS             23800..24720
                     /locus_tag="HVO_RS00105"
                     /old_locus_tag="HVO_B0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_004041131.1"
                     /db_xref="GI:490140782"
                     /db_xref="GeneID:8919345"
                     /translation="MSTETKPEAELKKRVEGVAETLRDQFTFLRRDRLAFAGVLIVAA
                     FVFLGLLGPALAPHDPIEHTVRDDAGSMLRLSEPTGAAPFGTTAYGKDVLSQFLAGAQ
                     PTFIVGLFGGIGTGALGFLVGLVSGYYGGWVDEVLMRLTDLTFSLPFTPMALLLLTFV
                     TPSVWLMTGIIVAFLWKMPARVVRSEVLSVRERTFVKSARASGASDLRTMLYHVAPNV
                     LPIGFLYTAYGIAWAIAAQASLAFLGFGDPTVTSWGRMLRQVFESGNMRVAWWWVLPP
                     ALGIAAITTSVFLIGRAYEEVINPEIQTEQ"
     gene            24717..26834
                     /locus_tag="HVO_RS00110"
                     /old_locus_tag="HVO_B0024"
                     /db_xref="GeneID:8919222"
     CDS             24717..26834
                     /locus_tag="HVO_RS00110"
                     /old_locus_tag="HVO_B0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573057.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004041130.1"
                     /db_xref="GI:490140781"
                     /db_xref="GeneID:8919222"
                     /translation="MSLLDITDLTVTYSTDSGTVHAVNDVSFSIDEGVNYGLAGESGS
                     GKSTLAEAVLGLLPSNGSVESGSIEFQGRDLTGLSERERRDVLWEDIAYIPQSAMDSL
                     DPVMSTGAQIRQAIQTHRNVTDDKARSRVRELFEIVGLDPDRIDDYPHEFSGGMRQRV
                     TIAMALALEPDLIIADEPTTGLDVIVQDKIIDKILEIQDRMDSSLLLITHEIGVIAET
                     CDELSILYGGKVMEQGSVDNVLVNPTNPYTMGLKNSFPEIEEGGQDPVSIPGSPPNLS
                     EAPGACVFKDRCPFATEECEASHPDLVDLPNRNHRSACHHVTKAAQMRCDATDPETWG
                     IPDSHDESDRGEVLLETDGLEKYYEQSQPLLEQLRGNDPNYVRAVDGVSLRVRRSEIL
                     GIAGESGCGKSTLGETIALLKQPTGGEFVFDGEPYEHYVDGNMREFRRKVQIIFQDPF
                     DSLNPRQTVRQLVGEPLTIHDYRTDERERAIIETLEKVGLTPARKFLDQYPHQLSGGQ
                     RQRVAVAKALVLDPDFLICDEPASMLDVSLKVNLLNLLRELADTEDIGIVYISHDLAS
                     LVQVSDRLAIMYLGRVIEEGDVESIAAEPKHPYTTSLLAAAPEKDPTVDRDRVLLDGE
                     PPNPVDLPSGCVFAPRCPKAEDECRESEPGLDTVRSGEYRAACYFPDGETPAADDLAD
                     DRSDSQYGDSEFSPPASGDSASD"
     gene            complement(27220..28260)
                     /locus_tag="HVO_RS00115"
                     /old_locus_tag="HVO_B0025"
                     /db_xref="GeneID:8919234"
     CDS             complement(27220..28260)
                     /locus_tag="HVO_RS00115"
                     /old_locus_tag="HVO_B0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008608136.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_004041129.1"
                     /db_xref="GI:490140780"
                     /db_xref="GeneID:8919234"
                     /translation="MRGLAKVERSSGAMEFVERQKPKPGAGEVLVEVDYAGLCGSDAG
                     IYEFESAFERMDLPTVIGHEYAGRVVEVGDGVTEFGVGDRVVERPIRGCGECYQCRIG
                     EENVCQDAVITGVDHDGAYERFIAVPERALHPIPDDVKQQHAAVAEPTSIAARAVIEN
                     SRVGAGDRVLVEGPGPIGLLTAQVAGAQGGTVVVSGVGQDADYRLPLAEELGFETVNV
                     ADDDTEARRERHTGGVGYDVVFDTTGHPSGLTTAVDEVRKGGQIVLVGQTGETSMPYS
                     PLVRAEIDLQCSYASMYEDFERSFRLIRDGDVDCETFVDTRFSLFEADEAFETFIEGG
                     TCKPVFDISELA"
     gene            28359..29132
                     /locus_tag="HVO_RS00120"
                     /old_locus_tag="HVO_B0026"
                     /db_xref="GeneID:8919363"
     CDS             28359..29132
                     /locus_tag="HVO_RS00120"
                     /old_locus_tag="HVO_B0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097058.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_004041128.1"
                     /db_xref="GI:490140779"
                     /db_xref="GeneID:8919363"
                     /translation="MVAYEHTPVSVSDKRVVVVGGTSGIGQAIALGFASEGADVLATS
                     RRESAVDETADAIEELGANAVRETCDVTDPASLERVRERAVEEFGGVDVVVASQGAIS
                     RETVRDIDDDAWDHVTDIALGGVRRVTQELAPAVADGGSIINISSLAARLSMANLPAY
                     SAAKGGVEAFTRASAKELAPEIRVNAIAPGFVITPQNADTYAEGTEKRERIDERTPLG
                     RVAEREEIVGAAVFLASDASSFVTGEVVTVDGGFADSAF"
     gene            29918..30787
                     /locus_tag="HVO_RS00125"
                     /old_locus_tag="HVO_B0027"
                     /db_xref="GeneID:8919100"
     CDS             29918..30787
                     /locus_tag="HVO_RS00125"
                     /old_locus_tag="HVO_B0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fumarylacetoacetate hydrolase"
                     /protein_id="WP_004061785.1"
                     /db_xref="GI:490163131"
                     /db_xref="GeneID:8919100"
                     /translation="MHYHQLAVSGERRLTASRDSTTYDLTSADADLRTFGDLARVASI
                     ARTSVDRLAAELTEDADVVDDAFVDRHATVPVDAEEIWAAGVTYQISEQAREEESSMP
                     DMYFDVYDADRPEVFFKATPSRTVEPGDAIGVRGDSEWDVPEPELGIVLRRGEIVGYT
                     VGNDVSSRSIEGENPLYLPQAKVYDRCCSIGPCVVTPEDVEDPHELEMSMTIERDGEV
                     IYDDATNTSEMVRSCDELVSYFTRHNTVPELAVILTGTSLVPEQPFDLQEGDHVDITI
                     EGIGTLSNSVTTV"
     gene            30784..31956
                     /locus_tag="HVO_RS00130"
                     /old_locus_tag="HVO_B0028"
                     /db_xref="GeneID:8919161"
     CDS             30784..31956
                     /locus_tag="HVO_RS00130"
                     /old_locus_tag="HVO_B0028"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041126.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-fructose oxidoreductase"
                     /protein_id="WP_004041126.1"
                     /db_xref="GI:490140777"
                     /db_xref="GeneID:8919161"
                     /translation="MSPAPTDIVEEFTRRDWQGDDVTGTVRVAMIGLGWWTRDEAIPA
                     VEASEFCETTVVVSSSKEKAEGATALTESITHGLTYDEFHEGVAADAYDAVYVVTPNG
                     LHLPYVETAAELGKAVLCEKPLEASVERAEKLVAACDRADVPLMVAYRMQTEPAVRRA
                     RELVEAGVIGEPVFVHGHMSQRLLDEVVPDPDQWRLDPELSGGATVMDIGLYPLNTAR
                     FVLDADPVRVRATARVDDEAFEAVGDEHVSFGVDFDDGTLAVCTASQSAYQLSHLRVT
                     GTEGELEIEPAFYNRQKRGFRLSWGDQSADYDFEQVNQMTEEFDYFASRLLSDSDPAP
                     DGDHALVDMRAMDAIYAAAERGTDVAVDAADSDSADSDSADAAAANHDADPDSDGT"
     gene            32017..32994
                     /locus_tag="HVO_RS00135"
                     /old_locus_tag="HVO_B0029"
                     /db_xref="GeneID:8919277"
     CDS             32017..32994
                     /locus_tag="HVO_RS00135"
                     /old_locus_tag="HVO_B0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041125.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-fructose oxidoreductase"
                     /protein_id="WP_004041125.1"
                     /db_xref="GI:490140776"
                     /db_xref="GeneID:8919277"
                     /translation="MMFGILGTAGIGVKSVIPAVQASEHEAAAIASRDEARASAVADE
                     LGIPTAYGSYEALLADDSLDAVYIPLPNGLHADWVRAAADRGLHVLCEKPLTASADET
                     AAVFDYCEDAGVTLMEAFMYRFHPLTERAAELVASELGAVVSVTSNFSFRLPDGADDI
                     RIDPDLAGGSVMDVGCYAVSAARLFLGTPDRVYATTTDTRDCGVDTRMSGVLEYDSGA
                     TARVESSFDTPETQYYRVQTTDGRLEANPAFNVDPTAAAELTYATDGRVVTETFDPTD
                     SYRREVEAFARAVETGETPRVDREESVSVMRTIDAIYESAETGAAVELD"
     gene            complement(33019..33894)
                     /locus_tag="HVO_RS00140"
                     /old_locus_tag="HVO_B0030"
                     /db_xref="GeneID:8919047"
     CDS             complement(33019..33894)
                     /locus_tag="HVO_RS00140"
                     /old_locus_tag="HVO_B0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600029.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolaconase"
                     /protein_id="WP_004041124.1"
                     /db_xref="GI:490140775"
                     /db_xref="GeneID:8919047"
                     /translation="MTVTRVVDTSCRLGEGPVWHPDEKRLYWVDIESGRLHRYDPETG
                     AHDCPVETSVIAGVTIQRDGSLLAFMDRGRVGRVVDGDRRESARIVDSPTRFNDVIAD
                     PAGRVFCGTMPSDTAGGRLFRLDTDGTVTTVETGVGIPNGMGFTRDRERFYFTETEAR
                     TVYRYAYDEETGAVSARERFVESPETPGLPDGMTVDSAGHIWSARWEGGCVVEYDADG
                     TELGRFDVPTEKVTSVAFGGPDLDSLYVTTAGGDGDGSAGEGDESTGDAAGALFRLDV
                     AATGRPEFRSDVRLG"
     gene            complement(34036..34776)
                     /locus_tag="HVO_RS00145"
                     /old_locus_tag="HVO_B0031"
                     /db_xref="GeneID:8919218"
     CDS             complement(34036..34776)
                     /locus_tag="HVO_RS00145"
                     /old_locus_tag="HVO_B0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573070.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain dehydrogenase"
                     /protein_id="WP_049914725.1"
                     /db_xref="GI:909671371"
                     /db_xref="GeneID:8919218"
                     /translation="MEDPLDGRTALVTGASSGIGAATARVLAEDGADVCLAARRVERL
                     ESLADEIRDATDAAVSVVPTDVTDSDAVRALVDATVERFGSLDIVVCNAGLGIDKPVA
                     ELTDEEYRLMTGVNVDGMFYTAREALPHLEASEGNLVFLGSMSGNHPRPHNPVYAATK
                     WWVRGFASSLQGSIGEENVGVTCVNPTEVRTEFGSESGETLEASFEEGEVTEAIEVAD
                     AIAYAVRQRSPNTVLSLDLYRRDKLSHF"
     gene            34897..35661
                     /locus_tag="HVO_RS00150"
                     /old_locus_tag="HVO_B0032"
                     /db_xref="GeneID:8919002"
     CDS             34897..35661
                     /locus_tag="HVO_RS00150"
                     /old_locus_tag="HVO_B0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_004041122.1"
                     /db_xref="GI:490140773"
                     /db_xref="GeneID:8919002"
                     /translation="MARIAVTGAAGNVGRVTVEALASDHDVTPITHREREGLDSVILD
                     VRDEDALTEAFEGHDIVVHLAANPNPDAAWDSVYEVNIGGTYNVYEAALAADIDRLVF
                     ASTNHVHQMYNIADATRPETLAADAEAVGVSDPPRPDSYYGVSKVFGEALGNYYADRH
                     GLEVLNLRIGWLLTADEVREKMDEEESVARYVRAMWLSPGDCEQGMRRAVEASLPDSP
                     LAVNLISANDDRYLSLTETMRAIGYRPRDNSATVVE"
     gene            35981..37297
                     /locus_tag="HVO_RS00155"
                     /old_locus_tag="HVO_B0034"
                     /db_xref="GeneID:8919348"
     CDS             35981..37297
                     /locus_tag="HVO_RS00155"
                     /old_locus_tag="HVO_B0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061774.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_004041121.1"
                     /db_xref="GI:490140772"
                     /db_xref="GeneID:8919348"
                     /translation="MGAAAGIAGCTGGGGTETESTESGNGNGSGGSTDDTETSGSSSG
                     ESWDSQLEVLHGWAGGDGEAAVTALIEAFEEEHPEMDTNFQAVGASANVNLNATILRR
                     LANNNPMSSFANWPGKNLERYSGALMDLEADVWDAEGFKDTMQSRAVELCKFNDKMPA
                     VPIGSHRMNNLFYNTAVFEEAGIDASSLDSVDALLDALETIDQNTDVTPMAQAMVAPW
                     TNLQLWAQILTSQSGVEAYTNFIEGNPDRAAVVEALEALKTINENYITADASSISFTT
                     AGQKVISGKAATIHQGNWVYGMFRADDSFNYKEQWDWIPFPGTEGIYFYHVDSIVAPS
                     NNPSREETIAWQKFVGSKKAQIAFNNPKGSVPLRTDIDPSELTDFLAMTYEDLTDSEA
                     YPPTIAHGLAVTPKTMGACKTAFGDNFMGPFNVEATADALVAAVSE"
     gene            37352..38305
                     /locus_tag="HVO_RS00160"
                     /old_locus_tag="HVO_B0035"
                     /db_xref="GeneID:8919131"
     CDS             37352..38305
                     /locus_tag="HVO_RS00160"
                     /old_locus_tag="HVO_B0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004041120.1"
                     /db_xref="GI:490140771"
                     /db_xref="GeneID:8919131"
                     /translation="MATHDNTEHVSDATDEAVGWESKLRYFLNSDFVRSAPYWGIPFV
                     LMSIAVYGGTGYNFAISFTDYEGLGTPDYSTLDLEMYAQALSSDAFIAAAQNNLVLLV
                     GFTTICLVLGLFLAILLDHGIRFSEKFQTVYLLPMSLSFVVTAQLWLWMFNVESGILN
                     LVVTTLGFNPVDWLGNPSIALGAVILALIWQFSGYTMVVYLAGLQSIPDDQFEAARVD
                     GASITRTYLRIIVPQLKEASVSAAVVLMVFALKAFTFLYALVGRYRPPNGTDILATLM
                     VRRAFKFGEWAYSAAIATMLLIMALGVIGPYLYYQYKQGGL"
     gene            38308..39237
                     /locus_tag="HVO_RS00165"
                     /old_locus_tag="HVO_B0036"
                     /db_xref="GeneID:8919031"
     CDS             38308..39237
                     /locus_tag="HVO_RS00165"
                     /old_locus_tag="HVO_B0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004041119.1"
                     /db_xref="GI:490140770"
                     /db_xref="GeneID:8919031"
                     /translation="MSQSSSTGNFDVASLVEDVNLRRVAQYALVVFFLGFFLVPLETG
                     IMTAIKTNESVARSLPFAPPVGEGFTLGNIQFALEQLSGSFFNSLIMSIPATIGSVLF
                     GSMAAYGLTMVNWRAQMGMLMLFVVGVFVPYQAVLVPLARFWNNIFPLARMIEPMVAS
                     IPFFQGYHAELVPLVITHIAYGIPICTILFRSYYQSLPNSLVEAGKIDGASITKIYRR
                     IILPISKPMFGVVFIYQFTQIYNEFLFAFTLVTGSDAPAAPVTLVLPAIGASTSGINF
                     GIRMSAAFLAAVPTLILYVAFAEQFAKGLRTEA"
     gene            39241..40392
                     /locus_tag="HVO_RS00170"
                     /old_locus_tag="HVO_B0037"
                     /db_xref="GeneID:8919354"
     CDS             39241..40392
                     /locus_tag="HVO_RS00170"
                     /old_locus_tag="HVO_B0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041118.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_004041118.1"
                     /db_xref="GI:490140769"
                     /db_xref="GeneID:8919354"
                     /translation="MGQIQLTDLTKRFGDTVAVDDLSLDIDDEEFLVLVGPSGCGKST
                     TLRMLAGLETPTSGDIYIGGDHMNYRVPQNRDIAMVFQDYALYPHMTVRQNIRFGLEE
                     EEGYTSAERDERVVEVAETLGIADLLDRKPDELSGGQQQRVALGRAIVRDPEVFLMDE
                     PLSNLDAKLRAEMRTELQNLQDQLAVTTVYVTHNQTEAMTMADRIAVMDDGELQQVAS
                     PFECYHEPNNLFVAEFIGEPMINLVRGTRSESTFVGEHFSYPLDEDVMESVDDRDDFV
                     LGVRPEDIEVADAAPDDAALDDHDLQMDVTVVEPHGDQNVLHLSHPDQPSADDALQAV
                     TEGMHLVTRGDRVTVTIPPDKIHLFDAETGTAVHNRRHDQEADFTQLEQ"
     gene            40395..41546
                     /locus_tag="HVO_RS00175"
                     /old_locus_tag="HVO_B0038"
                     /db_xref="GeneID:8919050"
     CDS             40395..41546
                     /locus_tag="HVO_RS00175"
                     /old_locus_tag="HVO_B0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041117.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_004041117.1"
                     /db_xref="GI:490140768"
                     /db_xref="GeneID:8919050"
                     /translation="MARLTLDDVTKVYTDEGGGDIVAVEEISLDIDDGEFLVLVGPSG
                     CGKSTTLRMMAGLETVTEGELRLEDRVLNGVSAQDRDIAMVFQSYALYPHKSVRGNMS
                     FGLEESTGLPDDEIRQRVEETTDMLGISDLLDRKPGQLSGGQQQRVALGRAIVRDPEV
                     FLMDEPLSNLDAKLRAEMRTELQRLQGELGVTTVYVTHDQTEAMTMGDRVAVLDDGEL
                     QQVGTPLDCYHRPNNLFVAGFIGEPSMNLFDGSLSGDTFRGDGFDYPLSGATRDQLGG
                     ASGLTLGIRPEDVTVGERRSGQRTFDAEVVVVEPQGNENAVHLRFVDGDEGTQFTATT
                     TGQSRVEAGDRTTVSFPEDAIHLFDGETGDALKNRELPSNRAIDAFVSN"
     gene            complement(41808..43046)
                     /locus_tag="HVO_RS00180"
                     /old_locus_tag="HVO_B0038A"
                     /db_xref="GeneID:8919180"
     CDS             complement(41808..43046)
                     /locus_tag="HVO_RS00180"
                     /old_locus_tag="HVO_B0038A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004972176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-xylonate dehydratase"
                     /protein_id="WP_004041116.1"
                     /db_xref="GI:490140767"
                     /db_xref="GeneID:8919180"
                     /translation="MVEQAKLSDPNAEYTMRDLSAETIDITNPRGGVRDAEITDVQTT
                     MVDGNYPWILVRVYTDAGVVGTGEAYWGGGDTAIIERMKPFLVGENPLDIDRLYEHLV
                     QKMSGEGSVSGKVISAISGIEIALHDVAGKLLDVPAYQLVGGKYRDEVRVYCDLHTED
                     EANPQACAEEGVRVVEELGYDAIKFDLDVPSGHEKDRANRHLRNPEIDHKVEIVEAVT
                     EAVGDRADVAFDCHWSFTGGSAKRLASELEDYDVWWLEDPVPPENHDVQKLVTQSTTT
                     PIAVGENVYRKFGQRTLLEPQAVDIIAPDLPRVGGMRETRKIADLADMYYIPVAMHNV
                     SSPIGTMASAQVAAAIPNSLALEYHSYQLGWWEDLVEEDDLIQNGHMEIPEKPGLGLT
                     LDLDAVEAHMVEGETLFDEE"
     gene            43203..44651
                     /locus_tag="HVO_RS00185"
                     /old_locus_tag="HVO_B0039"
                     /db_xref="GeneID:8919187"
     CDS             43203..44651
                     /locus_tag="HVO_RS00185"
                     /old_locus_tag="HVO_B0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041115.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_004041115.1"
                     /db_xref="GI:490140766"
                     /db_xref="GeneID:8919187"
                     /translation="MTDPSKNYVNGEWVTSETGETTEVTNPANPSEVVAAYQHSNEND
                     AAAAVDAAVAAEDEWRNTPGPERGRILREAGTLLAQRKDELTEILTAEEGKARPEAAG
                     EVQRAIDIFHYFSSKAADLGGTKKGASGPNTNLYTRQEPVGVAALITPWNYPIAIPAW
                     KLAPALAAGNTVVLKPASIAPGVVIEIARALDEAGLPDGVLNVVTGPGSSVGSEFIGN
                     EGTDLVSFTGSSQVGEMVYEQATDAGKRVQTELGGKNPTLVADSANPAEAADIVANGG
                     FGTTGQSCTACSRAIVHEDVYDDFVAELVDRAESLDVGPGTDHEMGPQVSESELSSTL
                     EYIDIAEAEGATLVAGGGVPEGEAVETGHFVEPTVFTDVDPDMRIAQEEVFGPVVAVI
                     EVSDFDEGLAVANDVDYGLSASIVTDDHTEANRFVDEVEAGVVKVNDKTTGLELHVPF
                     GGFKRSSSETWREQGDAGLDFYTIEKTVYDSY"
     gene            complement(44953..45708)
                     /locus_tag="HVO_RS00190"
                     /old_locus_tag="HVO_B0040"
                     /db_xref="GeneID:8919114"
     CDS             complement(44953..45708)
                     /locus_tag="HVO_RS00190"
                     /old_locus_tag="HVO_B0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968482.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_004041114.1"
                     /db_xref="GI:490140765"
                     /db_xref="GeneID:8919114"
                     /translation="MDAKHPVRTTEKTLALVEELMQKGPCGVTELAGDLDMGKSAVHN
                     HLTTLQKHGYVLKDGDDYRVGLKFLEVGGHSRKSMEVYQVAEPEVKSLAADTGELANL
                     LVEEQGMGVYLMRAKGDDAVDLDTYAGLRTNLHTTALGKAILANLPESRVDEIIERHG
                     LEQKTPKSIGTRQELFQVLEGVRERGYAIDDGERLEGLRCLAAPIKSSSGEVLGAISV
                     SAPASRVSDEDLHGALPERVLSAANVVELNINY"
     gene            complement(46367..48205)
                     /locus_tag="HVO_RS00195"
                     /old_locus_tag="HVO_B0041"
                     /db_xref="GeneID:8919030"
     CDS             complement(46367..48205)
                     /locus_tag="HVO_RS00195"
                     /old_locus_tag="HVO_B0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_004041113.1"
                     /db_xref="GI:490140764"
                     /db_xref="GeneID:8919030"
                     /translation="MNPNDTTLRDALDADVWETVERRLLTKMLEEFAYEEIIEPRKVD
                     AGDDRHGYRFDLGEVSYRFEAADRLMDSLHVYGDTVERRADGTWESLRDPLRLLRDLG
                     ETTDLDGLTEGNLVREYKRTLLADAHIESRKRDRGGFDPTDLDYARLEGEMEGHPWIT
                     YNKGRLGWGYDDYKRYAPERKAPVTLSWAAVRKEHATFVGAEGVDHDSLVSGELGDHY
                     ERFRSRLDAKGYDPDAYFFMPVHDWQWEHTVVPLFPDHIAAGDIVPLGDGPDEYLPQQ
                     SVRTFVNVDDAEKHHVKVPMRILNTLVWRGLPGERTELAPTVTEYIKGIYERDDFLQE
                     QGLILPGEIAGLNYDHADFTDIDGSPYQYHELLGAVWRESIYTFLEDDERAITLSSLM
                     HVDGAGEPFVSRLVEQSGLSLDEWLGEFFDTVLPPLLHFLYRYGTVFSPHGQNTILVV
                     EDGVPTRLAVKDFADDVNVSDQSLPELESLPDDVHDVLRKEPPEGLCQFIFSGLFVCV
                     LRYVADVLEEHESYPEREFWTHARRAVLDYQAQFPELQSRFDLFDLLRPEFTKLSLNR
                     NRIFDYGYDDSPGRPHASEHGTVTNALYEVADERPDGASQTGTADD"
     gene            complement(48214..49587)
                     /locus_tag="HVO_RS00200"
                     /old_locus_tag="HVO_B0042"
                     /db_xref="GeneID:8919197"
     CDS             complement(48214..49587)
                     /locus_tag="HVO_RS00200"
                     /old_locus_tag="HVO_B0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061759.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="lysine 6-monooxygenase"
                     /protein_id="WP_004041112.1"
                     /db_xref="GI:490140763"
                     /db_xref="GeneID:8919197"
                     /translation="MSEPRVRDVVGIGLGPFNLGLAALLDGAPEDVDAAFLERDAEFA
                     WHEGMLIEGTTLEVPFLADLVTLADPTSPHSYLNYLRETGRVYEFYFYETFQIPRREY
                     NDYLRWVADRLDACRFEREVTEVRWDDREEWYAVTARNPDTGDRFEYRAENLALGIGS
                     RPHVPKHLRGHPTEDVFHTARYRGSRERVGEADTVTVVGSGQSAAEVFQDLLERQPDH
                     GYRLDWLTRSDGFFPMEYSKLGLQHFTPEYERYVYDLPQAVKDDLIPNQDLLYKGIDP
                     ETSAEIYDLLYRRSVGGRDPDVGLFAMTEVRDIEAVNDAYALDCHQWQAEESFVHESE
                     VVILGTGYERPIPAFLEPLEDAIDWDEQGRFGVTEDHRLAVDAPGDVFLQNAEVHTHG
                     VGVPDLGLGCYRNAKFVNRLVGREVYPDDVDTVFQDFSVAQFLDHAPNASRAEGSETP
                     PTPTQDD"
     gene            complement(49584..50225)
                     /locus_tag="HVO_RS00205"
                     /old_locus_tag="HVO_B0043"
                     /db_xref="GeneID:8919377"
     CDS             complement(49584..50225)
                     /locus_tag="HVO_RS00205"
                     /old_locus_tag="HVO_B0043"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061757.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="WP_004041111.1"
                     /db_xref="GI:490140762"
                     /db_xref="GeneID:8919377"
                     /translation="MTDAPATATANAATADAGREYAYRVRDETIDRTIAFAEVDPALD
                     VDRLHAWLGSDHVKPYWQLDLPKPAFRAKLDEKLADDHLTPYVGLLDHTPMSYWEAYR
                     AADDVVATCYDAAPEDRGVHLLIGPPEYLGHGHSIPLLRAMTAFQFRATGATRVVSEP
                     DVRNERVIHVFERCGYEPQGRIDLPDKEALLMHCERDRFFDTVAENAETEVGR"
     gene            complement(50222..52003)
                     /locus_tag="HVO_RS00210"
                     /old_locus_tag="HVO_B0044"
                     /db_xref="GeneID:8919005"
     CDS             complement(50222..52003)
                     /locus_tag="HVO_RS00210"
                     /old_locus_tag="HVO_B0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron transporter"
                     /protein_id="WP_004041110.1"
                     /db_xref="GI:490140761"
                     /db_xref="GeneID:8919005"
                     /translation="MNPNDTAESATIHSFLNCYLRETGDYAVVPAGDVPVEADAEVVV
                     HAPLSQQGVDLYVPLSYRSPTGRHQFDLPGVYRLPDGETFPLDYTVLVTLVTSELRLD
                     RDETGAADELLLRVVKSCQNIERFVEARRGDEERLYGFDTTFRDAEQSLVFGHPLHPT
                     PKSRQGIPAHESRAYAPELRGSFPLAYFSADPEFVSQNSTREESAAEWVKSALRADDS
                     VPESFVTEHVEGDEVLLPVHPWQADYLRSQPEVQAHLGDGLEYVGQVGREFYPTSSVR
                     TLYAPDAPFMVKGSLNVKVTNSERTNKLPELERGVAITELLDTELGGDLESRFPAFDV
                     VRDPAYLTVDLGDGESGFETVLRENPFRGNAAANATPVVGLCQDHLDDGSSRLATLVE
                     GIADHEGRATPAVAEDWFRQYLELSVRPVLWLYLERGLGVEAHQQNSVLTLDGGYPET
                     FRYRDNQGYYLPESMYDEVDALLPGIGERADTVCPDAVADERIRYYVVINNAFGLVNA
                     FGTAGLVDERRLLGVLRDELESLREYDRPSSSLLDDLLTNPTIPCKANLLTRFHDMDE
                     LEGSLANQSVYADIDNPLVTELEVPAP"
     gene            complement(52000..53565)
                     /locus_tag="HVO_RS00215"
                     /old_locus_tag="HVO_B0045"
                     /db_xref="GeneID:8919259"
     CDS             complement(52000..53565)
                     /locus_tag="HVO_RS00215"
                     /old_locus_tag="HVO_B0045"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041109.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2,4-diaminobutyrate decarboxylase"
                     /protein_id="WP_004041109.1"
                     /db_xref="GI:490140760"
                     /db_xref="GeneID:8919259"
                     /translation="MNGVGDVDGERRDPRPDAAKWFLSGDDDDRARYRDAMRRACDLV
                     LDEFAAEATPYSGATPEEVDDALARFEMLPHEGDGVAAALDRTEPILRNSVGVSDPTC
                     IAHLQCPPTIPALAAEALLTATNQSMDSWDQSPAATQLERRFVGELCDLFGYEDGDGV
                     FTSGGTQSNFVGLLLARNKVVLEEYGVDVQHEGLPPEARDLRILCSADAHFTATQAAS
                     HLGLGENAVVTVPTDDDRRLSMAAFDEAVADLRERGKRPFAIVATAGKTDFGSIDPLG
                     PLAERAAELDCWYHVDAAWGGALALSDDHADKLAGIEAADSVAVDFHKLFYQPISCGA
                     VLVRDASAYDLIDRNAAYLNPVRDDDAGVPNLVSKSVQTTRRFDALKPFVTMQALGRE
                     GLASMVEYTIDLAADAARLVEADPDLRLVHDSDLNVVVFRYVPDHGRDGGGPADGPVN
                     GPSADDLNEAIRDSLLDDGEAVVARTTVDGETCLKLTLLNPRTTREDLRDLLREISDR
                     GTALEPTTDDRHA"
     gene            complement(53562..54941)
                     /locus_tag="HVO_RS00220"
                     /old_locus_tag="HVO_B0046"
                     /db_xref="GeneID:8919229"
     CDS             complement(53562..54941)
                     /locus_tag="HVO_RS00220"
                     /old_locus_tag="HVO_B0046"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605877.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="diadenosine tetraphosphatase"
                     /protein_id="WP_004041108.1"
                     /db_xref="GI:490140759"
                     /db_xref="GeneID:8919229"
                     /translation="MTDPAAGNEALLEQQAARESSARTYPRHLPHAIREASGVTVTDM
                     DGEEYYDCLAGAGTLALGHNHPRVVEAMERVLAEDRPLHTLDITTPVKERFVDTLFDS
                     LPDEFADSARVQFCSPAGTDAVEAALKLVKTATGNRSVLGFQGGYHGMTNGALSLMGD
                     TDPKENVPGLMPDVHHLPYPYEYRCPFGVGGDECHELAARYVERTLDDPESGITEPAG
                     MVVELVQGEGGAIPAPDDWTREVRRMTRERDIPLVVDEIQTGLGRTGELYAFEHADIV
                     PDAVTLSKAIGGSLPLSVVVYDESLDVWEPGAHAGTFRGNQLAMAAGIATIEHVLEHD
                     LDDHAARMGERLRGHLDATERAHDAVGDVRGRGLMLGVELVDPAGESDACGRYPANPD
                     LADAVREACFDRGLILELGGRHGSVVRFLPPLVVSPSDVDAVGSIFADAVEAAIEDAD
                     ADGRREVAA"
     gene            complement(55399..56601)
                     /locus_tag="HVO_RS00225"
                     /old_locus_tag="HVO_B0047"
                     /db_xref="GeneID:8919294"
     CDS             complement(55399..56601)
                     /locus_tag="HVO_RS00225"
                     /old_locus_tag="HVO_B0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_004041107.1"
                     /db_xref="GI:490140758"
                     /db_xref="GeneID:8919294"
                     /translation="MANDGQSGRESTRREYLQYGGAVIAGGLLAGCTGGSGSETTTTA
                     SEPETTTAATTEAATETETETTTEAAESYSVSIEPVGEVTFDSVPEAWIANNGSWADM
                     GVALGLDTPMGVWLPGRYHTQYYDEIPDVSVDKSSIRQLWGDSGVGKEQFYELNADVH
                     IADPNFLLNRGQWSEADIEEISTQVGPFFGNSIFSRGYAWHEDYRYYTLYEAFEKFAQ
                     VFQREDRFEAFEQVHEEFQSNLAPVVPAQGERPSAAVVWAGGDEPEEFYPYVIDEGTS
                     FKHLNDLKVNDALATTEVRDFYSNRGAVDFETLLEVDPEVLLVRGQEAKTREEFQNTV
                     VSFMENHEVAGELTAVQNGDVYRAGALYQGPITNLVVTDRLARTLYDADERLFDAQRV
                     ADIANGNL"
     gene            complement(56690..57502)
                     /locus_tag="HVO_RS00230"
                     /old_locus_tag="HVO_B0048"
                     /db_xref="GeneID:8919063"
     CDS             complement(56690..57502)
                     /locus_tag="HVO_RS00230"
                     /old_locus_tag="HVO_B0048"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-6Y C(5)-methyltransferase"
                     /protein_id="WP_004041106.1"
                     /db_xref="GI:490140757"
                     /db_xref="GeneID:8919063"
                     /translation="MSEDESDPYDLDSGPDPAAFAAAAPEPSIDETDGGGEDADAPVY
                     AVGVGPGNLEYLTPRGRQAIREADVVVGFETVVDFVADETDADLLTCGYADEADALAE
                     FGRRVAAGDRGTAVLMGDPNHSGYQFLGKVQRTVERPVRVIPGISSLQIAASRARTPM
                     EDTRFVTLHKSGSLDADLDRLAEAAGERHLLVLPRPFDWMPGDIAEFLLDSDADASLD
                     ALVLERLTHDDERITRTTLGGLRDSAGGSGPDSTPYSDLSVLAVRAPVDAAD"
     gene            complement(57495..58175)
                     /locus_tag="HVO_RS00235"
                     /old_locus_tag="HVO_B0049"
                     /db_xref="GeneID:8919058"
     CDS             complement(57495..58175)
                     /locus_tag="HVO_RS00235"
                     /old_locus_tag="HVO_B0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605880.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="precorrin isomerase"
                     /protein_id="WP_004041105.1"
                     /db_xref="GI:490140756"
                     /db_xref="GeneID:8919058"
                     /translation="MTERDAYADLGATTQEAMDIAETSMDIVRTFVPDETLNDRLRQK
                     AVHSTGDIEFQHLIRCQNDPVVAGARAVLDERPVVTDITMAKAGITGRGHDCQVRKAI
                     GNGAELAAETGMTRTAAAVLELDKEGVYDGAIAVVGNAPTAALALCDCIENGTRPAAV
                     VATPVGFVKAEESRKRVRDVADEYGVPAVTNVGKRGGSGLAAALTNELIHVASDVRNG
                     DVDLANHE"
     gene            complement(58168..62022)
                     /locus_tag="HVO_RS00240"
                     /old_locus_tag="HVO_B0050"
                     /db_xref="GeneID:8919019"
     CDS             complement(58168..62022)
                     /locus_tag="HVO_RS00240"
                     /old_locus_tag="HVO_B0050"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600019.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobaltochelatase"
                     /protein_id="WP_004041104.1"
                     /db_xref="GI:490140755"
                     /db_xref="GeneID:8919019"
                     /translation="MTPTIGLYTATENELGAVQRAARRLDGIDLVVRSASDLDDVSDA
                     DAFVDELESTTAAVFWLHGAEDSMPGYDHAVERLEAAGVPLVVKATGDAFARRDTTVA
                     DADRERVCEYLDRGGAVNVENLCRFLAAEYAGVETEVDDPVELPTEGVYHPDYPGVEY
                     DELLDTHDPDKPTIGVWFYESHWTHANTRYVDALVERLESLGANVLPAFCNPATDEEG
                     QENAEWVARNWFSDDDGPVVDAVVSSFMFSLSMSERGRDADDEGSAAEDVFLTELGVP
                     VLQAITTMRSRSRYESSDTGVMGFELALSVALPEFDGNVITHPISGKERMEDEAGVGS
                     APKQHFPIEDRVDHVARLAVNWARLRHLPNDEKNVAVVLHNYPPSDDGIGTAFGMDSP
                     ESTVNLLSELRERGYAVGDLPADGQALIDDLTSQLTLDDRWVAPEDVRDLSVDVVAPD
                     QYADWFADADDRFRDNVVEEWGDPPERPFAIPGVEFENVLVTVQPPRGFGMDPSKVYH
                     DSDLQPPHDYVAFYAWLRESFEADAVVHLGTHGSLEWLPGKTVGLNGESAPDQLVSDL
                     PNVYPYIINNPGEGTQAKRRSYAAIVDYLTPVMRTAGTYDDLADLEELAREYREAGMD
                     EARPERGDQLRELLVDAVDDLDLAAELGFDDAEAIRGADGDVGSDEAEVEFDELVERV
                     HEYLTDVKTTQIRMGLHTMGEPPANDRLVEYLVALTRLPNADTPSLRESVAGVMGVDY
                     DRMRDEPGTYDDDLGMYLSEAADRVYDQCVELVSALAERDFDVPESEVDAGPDDEVNM
                     NLLVVDIDQLGDARAKRGAHDDLREVLAFICDEAAPRVAAAENEIPQTADALDGEYVR
                     PGGSGAPTRGGVDLLPTGRNFYTLDPRKVPAKPAWSVGERVAEGVLDRHYDDHGEYPE
                     EFGVVAWGTPTVRTRGETIAQVLAFMGVEPVWTDAGRVDDVEPIPLDDLDRPRIDVTT
                     RVSGLFRDAFPQAASVVNDAVDAVVDLDEPHEMNYVKKHVEEDAAEFESEGVDPDEAE
                     TLAKHRVFTTTPGGYGAGTNKAVDEGEWDDRSDLADVFVQWGGYALGSRGKVTEAHDA
                     FERRLSGVEATVKIEDTAEQDEFDSSDWYAFHGGFVSAVGEISGSDPASYVGDSSDPD
                     NVSVYTNEEKVRKAMRARVLNPDWLDSMEEHGYKGAGDLSTTVDVALGWDATTGVVSD
                     TLWEHLADAYAFDEDRQEWLRDVNPWALESITATFLEAIDRDLWDADDDVRERLQDIN
                     LSVEGDLEANTTNAMTQTQSND"
     gene            62067..64187
                     /locus_tag="HVO_RS00245"
                     /old_locus_tag="HVO_B0051"
                     /db_xref="GeneID:8919146"
     CDS             62067..64187
                     /locus_tag="HVO_RS00245"
                     /old_locus_tag="HVO_B0051"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034971.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium chelatase"
                     /protein_id="WP_013034971.1"
                     /db_xref="GI:502799995"
                     /db_xref="GeneID:8919146"
                     /translation="MTTQTLPFSAIVGQDELKQALLAVGANDDLDGLLVRGEKGTAKS
                     TAVRALSDLLPEQAVVADCPYGCPPDPDDPARQCDSCRARDDPAVERRSVPLVTLPLG
                     ATRDRVAGTLSVADALDGEASFDPGLLARANRGILYVDEVNLLDDHLVDLLLDAAASG
                     VNRVERDGMSVEHPAEFTLVGTMNPEEGDLRPQLRDRFALQATVVGSRDVDDRVEIID
                     RALAGGDDPETVADAHREGTAALETALREATARLDSVALPTEFKRDIAELCVDAGVEG
                     HRADIAIARAARTLAALDGRTKVLESDVREAAALALPHRLQSRPFDDDPDVDDVLDDH
                     FDEDEDRDDDGGGDANDGDGEGDDAGDADDGGSDDGDASDGEERAEGGDSDADAPGAA
                     PDSDAGGDDRGGEVGGADERGPEDGDSEGGNSEDGDTDGSGDDPDEATPLLPGQNRAA
                     VGDAERPPVEDAALDAETPGDGSRAAVRESRQGRGSRVRTEPATETDDIDVPASVRAA
                     ASAGRSRVTRSDLRTAVSRGSAATLVVFVVDASASMRAAMRQAKGTVLSLLEDAYEQR
                     DEVAFVAVAGDEAEVLLPPTDSVTLAARHLKELPTGDRTPLPSGLDAARRVIDRSDAD
                     AALVVVVTDGRVTVADGSPTGQTRSAARSLATADASVVVVDAGDDGIGVTDILVSETD
                     ARRIPLSDLSAERVAEAERFADGQ"
     gene            complement(64223..65461)
                     /locus_tag="HVO_RS00250"
                     /old_locus_tag="HVO_B0052"
                     /db_xref="GeneID:8919231"
     CDS             complement(64223..65461)
                     /locus_tag="HVO_RS00250"
                     /old_locus_tag="HVO_B0052"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_004041102.1"
                     /db_xref="GI:490140753"
                     /db_xref="GeneID:8919231"
                     /translation="MPSAPLSARRDLGEVDPASSRHNWTRSAVAATDDAVFVGTAAGR
                     VVALEAAADSASDSDDRWEARGDNPVVSMAAADDFLVVGERGGDGLVRVLDAETGDAR
                     WTYATTDDVGTAARDSLFFRPYVVDLAVTGDRVVVAARRYERDGDERVWRSVVLGFGR
                     DGRVAWRRRVHASPIAVAAEGDRVAVAYNRCPNPEQNGLVLLDAHTGGRVASWDPGTD
                     GDRRVGDVAFAGDALAVASHGDKRGYLLDFEGNERWRIDLASERRVGDETVYAYPTHV
                     CVAGETAAFVTGNTFAESTRDPDARHPDEHTAVGVSVDGGERLWTRDTGGFARAAVAA
                     GSRVFVPSAQHFREREADRHGVHTFGATAGHVRTDDLPGIPTAVAAGGGVLAVVEEPV
                     EYHDEGVTRGAYRLRTRPIR"
     gene            complement(65466..65849)
                     /locus_tag="HVO_RS00255"
                     /old_locus_tag="HVO_B0053"
                     /db_xref="GeneID:8919305"
     CDS             complement(65466..65849)
                     /locus_tag="HVO_RS00255"
                     /old_locus_tag="HVO_B0053"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004572756.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041101.1"
                     /db_xref="GI:490140752"
                     /db_xref="GeneID:8919305"
                     /translation="MACAELEALRLALLNITGTTDEHAKRHAEAELEDYLGDADPGPI
                     QALANATTLDEAQRHLDAALVDLESEATRIDDDDPQAGYLRGRLVAVRDAERSLRRLR
                     EGTDALLDDLGEAHHTLHDAFPVED"
     gene            complement(65852..67072)
                     /locus_tag="HVO_RS00260"
                     /old_locus_tag="HVO_B0054"
                     /db_xref="GeneID:8919012"
     CDS             complement(65852..67072)
                     /locus_tag="HVO_RS00260"
                     /old_locus_tag="HVO_B0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097012.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ferredoxin"
                     /protein_id="WP_004041100.1"
                     /db_xref="GI:490140751"
                     /db_xref="GeneID:8919012"
                     /translation="MSLERPDPALDDDAVLLVGHGSRREESNEQVRTLAAKLESRLSV
                     PVDAAYIELAEPSIDDAIETMAPTCRTMTVVPLSLFAASHVKNDVPLAVQRARATHDD
                     TEFRFGSHLGIHPSLVDLLDERARAVESDLGVDREDDDVAVVLCARGSSDPDSNGDVH
                     KLARLLYEGREFTRVESAFIGVTTPRLEETLHTVAKDRPDAVVVLPYMLGDGVLTERI
                     VDTAETFDEEYPYVDAGASGPLGTDARVVETLADRYQEARSGSVEMSCDTCKYKVELA
                     GYEDDEGGARAMLRSLVHQAEHADRSDVDDDPHVHDAPEKHVAVCTNQTCAASGAATV
                     LEQLRQGVRDADDCDVHVSRSSCLGQCGDGPIVAVYPDSVWYGGVTPDDTDRIVSSHL
                     ERDRIVSNLVHQSL"
     gene            complement(67069..67746)
                     /locus_tag="HVO_RS00265"
                     /old_locus_tag="HVO_B0055"
                     /db_xref="GeneID:8919134"
     CDS             complement(67069..67746)
                     /locus_tag="HVO_RS00265"
                     /old_locus_tag="HVO_B0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008606663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041099.1"
                     /db_xref="GI:490140750"
                     /db_xref="GeneID:8919134"
                     /translation="MSDANAGVAPADDLLESAPETAYLWGHVAGGGQIERAQFTVSTG
                     DETCANRLAVIAGGGDIDRRETAREYAHNTAVTRVKDEYRVTVDGDVVRSASAAFGLP
                     VGGDAGGYRFDVFDARRKQLLRGLLESCGTVCFKSSSGTVGISFVHDDRALLETVDRL
                     LDACPVDAPTGEIGETSSGGYWFGIDDDAAAGFGEWVYEGSDETNLFAPTRRRKLVRS
                     LEEAENA"
     gene            complement(67743..67997)
                     /locus_tag="HVO_RS00270"
                     /old_locus_tag="HVO_B0056"
                     /db_xref="GeneID:8919209"
     CDS             complement(67743..67997)
                     /locus_tag="HVO_RS00270"
                     /old_locus_tag="HVO_B0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004572753.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041098.1"
                     /db_xref="GI:490140749"
                     /db_xref="GeneID:8919209"
                     /translation="MFEIEIDRDACDGIFACLARDGRFVEDDDGLATIDPDAAGVVRV
                     EQTGGRVVAVLEGDAESDDDATLATRACPPGAISVREVDA"
     gene            complement(67999..69033)
                     /locus_tag="HVO_RS00275"
                     /old_locus_tag="HVO_B0057"
                     /db_xref="GeneID:8919339"
     CDS             complement(67999..69033)
                     /locus_tag="HVO_RS00275"
                     /old_locus_tag="HVO_B0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041097.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein"
                     /protein_id="WP_004041097.1"
                     /db_xref="GI:490140748"
                     /db_xref="GeneID:8919339"
                     /translation="MSDSDTTTESNCGGATTESTESTDTTNSESNCGGTKTETETDTT
                     SNCGASSSTTDDDSASKCGGSSGGSKKEQTAEKVEATIEDFDGEPGQLVAVGLGPGRA
                     SEMTTLAKDTLREADHIVGYTTYIELLPDDVVEGAEDIYSTPMCGEVSRTEEAVDRAL
                     AGNDVAIVGSGDPNVYALAGLALEILESKGATASMVDFDVVAGVPAAQSCAARLGAPL
                     VNDTVTISLSDHLTSMPTIESRLHAAAKEGFTIAIYNPWSRKRRSNYEKCCEILLEHR
                     APDTPVGIVHGAGRDDEEVEIVDLGDLPDLGETDLVDMTTTLLVGNEETYVWDDRMVT
                     PRGYEQKYEY"
     gene            complement(69037..69921)
                     /locus_tag="HVO_RS00280"
                     /old_locus_tag="HVO_B0058"
                     /db_xref="GeneID:8919008"
     CDS             complement(69037..69921)
                     /locus_tag="HVO_RS00280"
                     /old_locus_tag="HVO_B0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="precorrin-3B C17-methyltransferase"
                     /protein_id="WP_004041096.1"
                     /db_xref="GI:490140747"
                     /db_xref="GeneID:8919008"
                     /translation="MNDGREPTEPATESATEPAADDRDEVPDDYGTLYVVGIGPGLPD
                     HMTKRAKELISTSDCVVASNLYQEFLRDDGTLPPEGSDDGPEVVRSSMGKQVELTREA
                     FERVRDGEDVVHVSGGDPNVYGKSDLVFTMAKGDEATDVPIEIVPGVTAALGGAAMMG
                     APLSNDFCTVSLSDKWRGWDEIEEKLRAAAISGFVIVLYNCWRNYERAIDVVREERAD
                     DVPVGIFNDAGRGEAGRNLDDETFSVTTLGDAKAHDDDVGGMGTSILIGTHETEPWSN
                     DYQTYLVTPRGGRDVDDF"
     gene            complement(69918..70898)
                     /locus_tag="HVO_RS00285"
                     /old_locus_tag="HVO_B0059"
                     /db_xref="GeneID:8919052"
     CDS             complement(69918..70898)
                     /locus_tag="HVO_RS00285"
                     /old_locus_tag="HVO_B0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004572751.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CbiG"
                     /protein_id="WP_004041095.1"
                     /db_xref="GI:490140746"
                     /db_xref="GeneID:8919052"
                     /translation="MSDTDTNSDTDSGSGHCQTPDSDGEVADEIAIVSFERKLDTAEE
                     IKRDLADDYDRIDVLTYHGDVFADHWGEYDCFVGLMASGIAMRKTAGLLDDKWEDPAV
                     VVVDEELTWAIPLTGGHHGANQVAHDLSKLGAVPAMTTASEAAGKQGVESKAKALDSH
                     VVNGDSTVATNLAVLNDELGPVARLDGPKAVLVGDDVTVLKRNGGDGVVLGTGSVSGA
                     KKAQFLTAWEQALDDADCDWDDVDFVATGTRKADEPGMLDAAEEIGAGVVYFEKETLT
                     EFEGPTPSRSKELIGWPGIAEASAIAGGRDHELVVEKRRYDDAVTVAVGR"
     gene            complement(70891..71730)
                     /locus_tag="HVO_RS00290"
                     /old_locus_tag="HVO_B0060"
                     /db_xref="GeneID:8919124"
     CDS             complement(70891..71730)
                     /locus_tag="HVO_RS00290"
                     /old_locus_tag="HVO_B0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041094.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein"
                     /protein_id="WP_004041094.1"
                     /db_xref="GI:490140745"
                     /db_xref="GeneID:8919124"
                     /translation="MSADGEADTGFTDEEGIPFVGAGPGDPDLLTVAGRKLVEDADLV
                     VHAGSLVNSELLDEFCADAERVNSVGKDLEELIPLMADAYESGRTVVRLHSGDPAIYG
                     AALEQMDALAEAGVPSYLVPGVTSAFAASATLRTQLTLNEVSNHVVFTRPRGRTLSAE
                     EDHISDFVGFGDTTVCIYLGTHAVSETMDRLLDEGHDPDTPVAVVYHASWPDEDVIEG
                     TIETIGERVEDAGYRASALVIIGEAVNGSAYERSFLYGDWARGGDAPNDEPDTETQEP
                     DNE"
     gene            complement(71727..72434)
                     /locus_tag="HVO_RS00295"
                     /old_locus_tag="HVO_B0061"
                     /db_xref="GeneID:8919088"
     CDS             complement(71727..72434)
                     /locus_tag="HVO_RS00295"
                     /old_locus_tag="HVO_B0061"
                     /EC_number="2.1.1.151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573123.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt-precorrin-2 C(20)-methyltransferase"
                     /protein_id="WP_004041093.1"
                     /db_xref="GI:490140744"
                     /db_xref="GeneID:8919088"
                     /translation="MTVYGIGLGPGEADLVTVKGKRLLESAAVVYSPGRLSRTVALNH
                     VPEERIGDLDFPMTRDPDELRRAWKEAAAEVAARADSEDVAFVTLGDPNVYSTFGHLR
                     RTLDAFHPEVDLEVVPGVSAMTAFTTALGVEIESGTGLALREAANGAAPTGPDRMVLF
                     KVTDAPATHEKLTEAGYDVRFGRRLFMEQGETVVTDDPDELAERDYYTLAYAEREGVE
                     RDVATAEFDGVESGGSA"
     gene            complement(72431..72985)
                     /locus_tag="HVO_RS00300"
                     /old_locus_tag="HVO_B0062"
                     /db_xref="GeneID:8919299"
     CDS             complement(72431..72985)
                     /locus_tag="HVO_RS00300"
                     /old_locus_tag="HVO_B0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein"
                     /protein_id="WP_004041092.1"
                     /db_xref="GI:490140743"
                     /db_xref="GeneID:8919299"
                     /translation="MSQVTLPHDAKAGPTKPEVRAVTLDKLGLRPTDHFVDVGSCTGS
                     VTIEAARRVERVTAVERKPDRLDVTRKNLAANDYDADVTLREAEAPDGLPTDADAMFV
                     GGSRNFEAVLDHAVETGVDRIVMNVSRVEPAGDAIEAFRERGLLSAVVQLQVSHGYEL
                     AGATSFRSNNPVYVVVGRRDAEGL"
     gene            73155..73340
                     /locus_tag="HVO_RS00305"
                     /old_locus_tag="HVO_B0063"
                     /db_xref="GeneID:8919214"
     CDS             73155..73340
                     /locus_tag="HVO_RS00305"
                     /old_locus_tag="HVO_B0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004972120.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041091.1"
                     /db_xref="GI:490140742"
                     /db_xref="GeneID:8919214"
                     /translation="MATANTVNGRIERARTELTPAQMAAGSLFIVALGFTLLFVQDPL
                     VHDSLHNFRHAAGIACH"
     gene            73343..74179
                     /locus_tag="HVO_RS00310"
                     /old_locus_tag="HVO_B0064"
                     /db_xref="GeneID:8919093"
     CDS             73343..74179
                     /locus_tag="HVO_RS00310"
                     /old_locus_tag="HVO_B0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008606671.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041090.1"
                     /db_xref="GI:490140741"
                     /db_xref="GeneID:8919093"
                     /translation="MFGEYLTRGVKAGVVAGLVFGLFMAVVANPLVGYADDLNHATVE
                     ESGHTHEAESAHSHEAEGAHSHESGDSHAGESGGHHDTAVSMAVTKAVSVAAGGLWGV
                     VLGGAFFGVAFFFLEPAIPGPDAAKSYLMGFAGFVTVSGAPWLVLPPVAPGAEQSLST
                     ATRLPLYAGMMLAGALACLSAGYVYTRLRESRGLGAALVGAAVPFGLLAVLAVVAPEN
                     AVRGALSPALETGLTGLFAFGQVLLWLVLAAAHARFRPSSESESEPGIPTAGRDSAPA
                     AD"
     gene            74179..74520
                     /locus_tag="HVO_RS00315"
                     /old_locus_tag="HVO_B0065"
                     /db_xref="GeneID:8919104"
     CDS             74179..74520
                     /locus_tag="HVO_RS00315"
                     /old_locus_tag="HVO_B0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041089.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin biosynthesis protein CbiX"
                     /protein_id="WP_004041089.1"
                     /db_xref="GI:490140740"
                     /db_xref="GeneID:8919104"
                     /translation="MRDRTDEVREHGFTDHVLVCTNGRESEYADCAEADGPAVYDAVT
                     SWLRDRGVFWSRVHVAETSCLGLCSADGAAVAIHPRNRWYSDVRPDDVPALLAEVFGP
                     DASNLGVRPRD"
     gene            74645..75139
                     /locus_tag="HVO_RS00320"
                     /old_locus_tag="HVO_B0066"
                     /db_xref="GeneID:8919014"
     CDS             74645..75139
                     /locus_tag="HVO_RS00320"
                     /old_locus_tag="HVO_B0066"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008096998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004041088.1"
                     /db_xref="GI:490140739"
                     /db_xref="GeneID:8919014"
                     /translation="MDEKDLRILKAIGTLESGSPDRITEETGIPKSTVHYRLERLQEQ
                     GIIKNDIFDIDFEKAGLNLTLITEVWAEYGSEYHKEVGDKLGEVPGVNEVYFTLGDTD
                     FVLISHLASRSMVEDLISEFEEIDEISRTSSTFVITTIKDEPNPLNDYELEELKAALL
                     PDVS"
     gene            complement(75207..76619)
                     /locus_tag="HVO_RS00325"
                     /old_locus_tag="HVO_B0067"
                     /db_xref="GeneID:8919257"
     CDS             complement(75207..76619)
                     /locus_tag="HVO_RS00325"
                     /old_locus_tag="HVO_B0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573132.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cationic amino acid transporter"
                     /protein_id="WP_004041087.1"
                     /db_xref="GI:490140738"
                     /db_xref="GeneID:8919257"
                     /translation="MSLITMTGELSRVLSKRDVFVLALGAMIGWGWIVQTGYFIDQSG
                     VTGAISAFVLGGFMVTVVSLIYGELASAMPFVGGEHVYSMRALGPAGSFACTWAIIFG
                     YISVVAFEAVALPSALAYIVPGFNVFELWTVAGQPVYGTWVATGVIGSVVITYLNYRG
                     VRPAAQFQAILALVITLSGLTLLLGALFNGTSPSSPPLAGAGIGGVFTIAIMTPFMFV
                     GFDVIPQAAGEADVSPKLLGGLIGLSVACAAAFYIAVIWAAGQVATGTTLVESSLPAA
                     TAMEIAFDSVTIGRIMALAGLAGILTSWNGFVLGASRAIYAMADSHMLPEKLATIHDD
                     HDTPSTAIVLVGGLAALAPLFGEQMLVWVVNAGGLGMVTAWLLVVVSFLVLRYRDPDF
                     DRPFKLPAGYAVGALGLLLTVFFVGLYLPGSPSALAWPYEWAMVGGWCLLGVVLLAVA
                     GGLPTRTEAKAHLSAQQLED"
     gene            complement(76896..78275)
                     /locus_tag="HVO_RS00330"
                     /old_locus_tag="HVO_B0069"
                     /db_xref="GeneID:8919042"
     CDS             complement(76896..78275)
                     /locus_tag="HVO_RS00330"
                     /old_locus_tag="HVO_B0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="succinate-semialdehyde dehydrogenase"
                     /protein_id="WP_004041086.1"
                     /db_xref="GI:490140737"
                     /db_xref="GeneID:8919042"
                     /translation="MKSINPATEEVIETHEEHDEATVDARLDAAWDRFESWRETPISR
                     REKLLAAAADVLREHSEEYATLMTEEMGKPVEQAVSEVEKCAWVCDYYAEHASEFLQD
                     EHIGTVPGSKTYVSYEPIGPVLAVMPWNFPFWQVFRFAAPHITAGNVAVLKHAPNVFG
                     CADAIASVFERAGYPDDVFTSLRIPAERVAGVIEDDRVRGVSLTGSTRAGRAVAETSG
                     RELKPTVLELGGSDPFVVLDDAPLEATAKRAARARTQNNGQSCIAAKRFLVHEAVYDE
                     FVERFTEEMRALTVGDPTDPETDVGPQARADLMETLHEQVTASVEAGATLRLGGEPLD
                     RPGHYYPPTVLTDVPEDAPARTEELFGPVATVIRVEDEAEAVRVANDTPYGLGASVWT
                     ADAERGEALTTKLTAGNVAVNHVVASDPRVPFSGTKDSGYGTELSRHGIREFVNTKTV
                     WVEDAPADE"
     gene            78534..79844
                     /locus_tag="HVO_RS00335"
                     /old_locus_tag="HVO_B0070"
                     /db_xref="GeneID:8919322"
     CDS             78534..79844
                     /locus_tag="HVO_RS00335"
                     /old_locus_tag="HVO_B0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class III"
                     /protein_id="WP_004041085.1"
                     /db_xref="GI:490140736"
                     /db_xref="GeneID:8919322"
                     /translation="MRERTTNSSVEAAYDDYLMPIWKSLNVPVERASGCTLEDFDGNE
                     YLDVFSGISVTNVGHNNEAVVEAATEQLEEFVHGCSYVHPNRPVADLAETIAEVTPGD
                     LQKTFFCNSGTEAVEGAIKLARKYTGSKEVISLEMGFHGRTLGSLALTGNRAYKQDMA
                     PTINDVAHTAPPYAYRCPRCDGDTCGADCADALERVIGSHTSGDLAAVVVEPVMGEAG
                     IVVPSEAWLKRVRDIAHDHGALLIADEVQTGYGRTGELFASKQFGVEPDILTQAKGIA
                     NGLPLGAFTAPADIADAFGSGDHLSTFGGNPVACAAALATIEELQNGIVDNACENGEW
                     LSAELATLESDYDVVGEARGLGLMQGIELVDPETTGPQHVAPAPDKELAAAVGEHLRE
                     ESNVVMGVGGYYKNVMRFQPPLTISQAQLGEAVDALRTALNDLA"
     gene            complement(80012..81061)
                     /locus_tag="HVO_RS00340"
                     /old_locus_tag="HVO_B0071"
                     /db_xref="GeneID:8919183"
     CDS             complement(80012..81061)
                     /locus_tag="HVO_RS00340"
                     /old_locus_tag="HVO_B0071"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061732.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IMP dehydrogenase"
                     /protein_id="WP_004041084.1"
                     /db_xref="GI:490140735"
                     /db_xref="GeneID:8919183"
                     /translation="MKSAVYRGPGDVRIEEKPEPELQQPTDAVIRVTHTAICGSDLWF
                     YRGHEEHEEGSGVGHEPMGIVEEVGEDVTSVQPGDRVLVPFAYSCGECEFCRKGIHTA
                     CVDGGFFGPHGDETGGAQAEKVRVLHADGTVVRVPERYADDEETLKSLLPLTDVMSTG
                     HHAAVLADLEAGDTAVVIGDGAVGLCGVLAAKRIGAERIIAVGHHEDRLEVARELGAT
                     DTVSSRGQEAVEEVLELTHGGANHVLECVGAASALETAAQVARPGGSIGAVGVPHVES
                     ADFLQPIFYKNLSFSAGGAPVRNYIEELMDDVLQGTLDPSPILTKTVDLDGVPEGYQA
                     MDDREAIKVMVKVDE"
     gene            complement(81215..81886)
                     /locus_tag="HVO_RS00345"
                     /old_locus_tag="HVO_B0072"
                     /db_xref="GeneID:8919046"
     CDS             complement(81215..81886)
                     /locus_tag="HVO_RS00345"
                     /old_locus_tag="HVO_B0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041083.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterio-opsin activator"
                     /protein_id="WP_004041083.1"
                     /db_xref="GI:490140734"
                     /db_xref="GeneID:8919046"
                     /translation="MAITTEFVLRSTSLPLVSIPTALRPDEVECVHALCLQPDVQIFT
                     VQFEREDGVTKADLLTRDEVVAADAIGETADKGVYKLTVELAESVSKAFEPDFGGAQV
                     EPTVVTADGWHETKVFKEYEGFNEFRESCEAHGISLDLVSIASEGSASDEPTDSLTDR
                     QREALTLAVSRGYYESPRQTTAEELAAKLGISQPSLSSLLRRGERELITSSLGMQARM
                     QPPTQ"
     gene            complement(81961..82491)
                     /locus_tag="HVO_RS00350"
                     /old_locus_tag="HVO_B0073"
                     /db_xref="GeneID:8919049"
     CDS             complement(81961..82491)
                     /locus_tag="HVO_RS00350"
                     /old_locus_tag="HVO_B0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041082.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="WP_004041082.1"
                     /db_xref="GI:490140733"
                     /db_xref="GeneID:8919049"
                     /translation="MENPDLTSADAPPDPNTPEAVLENYLDEHDYEIFRALNENGRIS
                     DTELAERVGLSRTAVRRRREKLQESDVLEILAVIVLQEADLADAQILVSFDQHVSSEV
                     RTEFITMLIDEGLVYNTSSCLGEYDLVFSAWHTDLNTLKEYVWDLFDGEEIVDDYTII
                     PLLKTWKAWDKELDRP"
     gene            complement(82704..83819)
                     /locus_tag="HVO_RS00355"
                     /old_locus_tag="HVO_B0074"
                     /db_xref="GeneID:8919351"
     CDS             complement(82704..83819)
                     /locus_tag="HVO_RS00355"
                     /old_locus_tag="HVO_B0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968518.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041081.1"
                     /db_xref="GI:490140732"
                     /db_xref="GeneID:8919351"
                     /translation="MSFDIPHLTEITLDDLEALGTGAGILGTGGGGNPRLGRLRLQTL
                     LEDDAYPDSVELVDPRDLPPDATVASVGGMGAPTISVEKFAGGDEEVQSLRAIEELSG
                     ETVDALIPGEIGGANSMAPLCVAAMTDLPVVDADGMGRAFPELQMDTFFIYGTPVNYA
                     ATTDERGNQVVYRDIDSAKRLEDLARAITVQMGGRSGYAFPLMTGAFVSEYAVPHTVS
                     LATELGRAVERARDAGTDPVDAGRELLGGEELFAGKIVDVHRRNRDGFALGSVTLAGL
                     DEDATLEIEFQNEFLVARDDDGDLRTTVPDLICLVDTDTGAPVTTDALRYGQRVRVLG
                     VPAPELLTTPEALDVIGPEAFGYEVPYDPLPRDETGW"
     gene            complement(83816..84904)
                     /locus_tag="HVO_RS00360"
                     /old_locus_tag="HVO_B0075"
                     /db_xref="GeneID:8919158"
     CDS             complement(83816..84904)
                     /locus_tag="HVO_RS00360"
                     /old_locus_tag="HVO_B0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004972100.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041080.1"
                     /db_xref="GI:490140731"
                     /db_xref="GeneID:8919158"
                     /translation="MTVEIGVEEIEDIALGATVLGTGGGGDPHVGKLVAKQAIEEFGP
                     VELLPPDELDADDFVIPTAQMGAPTVSVEKLPSGREAVASMERIERELGKTADATMPI
                     ECGGINSTFPFAVAARRGLPVVDADGMGRAFPELQHETFNIYGVSGTPAAVSDEQGST
                     CLIETEDNDQLEWLARGVTVRMGGVAYVSDYPMTGTQVNETAIPGTMSLAKNLGRALR
                     LAEDDAMSAIREVTRESIYGEARSLFEGKIVDVQRRTERGFVFGHVDIDGLDGDEGST
                     MRIEFQNENLGAAVDGSYVATVPDLITVLDRETGGPIPTESLRYGARVRVLGIRTPEI
                     MRTPAALDVWGPASFGLDATYEPLADHP"
     gene            complement(84904..86448)
                     /locus_tag="HVO_RS00365"
                     /old_locus_tag="HVO_B0076"
                     /db_xref="GeneID:8919057"
     CDS             complement(84904..86448)
                     /locus_tag="HVO_RS00365"
                     /old_locus_tag="HVO_B0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041079.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydantoinase subunit beta"
                     /protein_id="WP_004041079.1"
                     /db_xref="GI:490140730"
                     /db_xref="GeneID:8919057"
                     /translation="MTDYRIGIDVGGTNTDAVVMDGDDNLLAKTKTPTTEDITSGILS
                     ALDVVLDDSGVSEDELDYVMLGTTHATNAITERRGLNEVGVIRIGAPATQSIRPLLEW
                     PDDLAAAIGNNVAILDGGHEFDGRLLNDLDEEQVRAQIREFSDVDAFAVTSVFSPVRD
                     DHETRVAELIREEVGDDVPISVSNEIGSVGLLERENATALNAALTSVASEAANAFVDA
                     MNERGIDANLYFGQNDGTLMSVDYAIRYPIFTVASGPSNSVRGAAYLSAVENGIIVDV
                     GGTTTDVGAVTEGFPRESSVAVEIGEVKTNFRMPDIIAIGIGGGSIVSTDGGVTVGPQ
                     SVGYKLTEEAKCFGGETLTATDLEVAAGTIDIGSETPDVDGEIVEAAREYVRERVERE
                     VDRMKTSAEPVPVVIVGGGSILVPDDIAGASEVHKPDHYEVANAVGVAIAQVSGEVDR
                     IYSLDEMDREEAIQHAKDEATDNALAAGADADTVDIVDVEEVPLSYLPGNAVRIKVKA
                     AGALDH"
     gene            complement(86441..87532)
                     /locus_tag="HVO_RS00370"
                     /old_locus_tag="HVO_B0077"
                     /db_xref="GeneID:8919289"
     CDS             complement(86441..87532)
                     /locus_tag="HVO_RS00370"
                     /old_locus_tag="HVO_B0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600003.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041078.1"
                     /db_xref="GI:490140729"
                     /db_xref="GeneID:8919289"
                     /translation="MKITTDNIDDFATGATVLGTGGGGDPYIGKLMAQQAIEEHGPVD
                     LIDPRDVPDDALVIPSAMLGAPTVMVEKMPKGTEALAAFEALETHLGQEAYATMSIEA
                     GGLNSTVPIAVAAALGLPLVDADGMGRAFPEVQMVTLTMGGVSATPMSIADEKGNSLL
                     VNTVSNEYAEAFARVTSIEMGGACMIGTYALSGAEVREHAILDSMSLAHDIGEAIRTA
                     KHRSQDPVEAVLDLTDGYELFAGKITDVERRTEGGFAVGEATLDGIDDCEGRTFALDF
                     QNENLVARDSERGVVASTPDLITVVDAETGDPVTTERLAYGHRVRVIGMPCSPKWRTE
                     EGLDLVGPAYFDYSIDYEPIETLQQPRHD"
     gene            complement(87529..88599)
                     /locus_tag="HVO_RS00375"
                     /old_locus_tag="HVO_B0078"
                     /db_xref="GeneID:8919004"
     CDS             complement(87529..88599)
                     /locus_tag="HVO_RS00375"
                     /old_locus_tag="HVO_B0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041077.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATP-binding protein"
                     /protein_id="WP_004041077.1"
                     /db_xref="GI:490140728"
                     /db_xref="GeneID:8919004"
                     /translation="MTDVSEPLLDVDDLEKYFPVKSGIIKRTSDYVKAVDGVSFDIER
                     GETLALIGESGSGKSTVARTIIGLTGATGGTVRFDGEDITNAADEQLARLRSRVQMVF
                     QDPTSSLNPRRTIGKSLAVPLKARGVATSDLRERVVDLLERVELNDEYWNKYPHELSG
                     GQKQRVNIARALAVEPELLLLDEPTSALDVSVQAKIIALLEDLQAEFGLTYLFITHDL
                     SLVRNFADETAVMYLGEIQERGPTQEVFQRPRHPYSRALLSAIPVTTDEEEAYKPRHE
                     PLRGEIPSPRDVPTGCRFHTRCPYATDACSADEPAFVAVDAGPSVRCHIYDEAYADAF
                     DDVPEVAVAAVADEGVASNQEP"
     gene            complement(88592..89704)
                     /locus_tag="HVO_RS00380"
                     /old_locus_tag="HVO_B0079"
                     /db_xref="GeneID:8919173"
     CDS             complement(88592..89704)
                     /locus_tag="HVO_RS00380"
                     /old_locus_tag="HVO_B0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008609280.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004041076.1"
                     /db_xref="GI:490140727"
                     /db_xref="GeneID:8919173"
                     /translation="MRLDEPVAENPLLTVENLEVGFESFDGLAEVIDGVNLSIGKGEV
                     VTIAGETGCGKSVTMKSILRLLNQPPARVSGDITFDGTKLLSLSDREFERVKGQRMSL
                     VFQDPMSSLNPTFTIGEQLTDTAQFGGDSDTGVVEFFRRRFSGERDEARERVLEMLRE
                     VQMPDPENIMDSYPSQLSGGMRQRALIAQALLNEPDLLIADEIGTALDVTIHDQILDL
                     LKDLIENHDLSVLMITHNLGVARQVSDRVYVMYGGRIVETAPTDELFENPKHPYTQGL
                     IASIPRLTGDEMATGIDGSIPEYLDPPPGCRFAPRCPYATAECEEARPEMYERGPQTG
                     VECVLYDEVVPASERPTVEETRSHMTRRPGKQTGGD"
     gene            complement(89701..90600)
                     /locus_tag="HVO_RS00385"
                     /old_locus_tag="HVO_B0080"
                     /db_xref="GeneID:8919304"
     CDS             complement(89701..90600)
                     /locus_tag="HVO_RS00385"
                     /old_locus_tag="HVO_B0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968524.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome C550"
                     /protein_id="WP_004041075.1"
                     /db_xref="GI:490140726"
                     /db_xref="GeneID:8919304"
                     /translation="MSAESTSVLDRVVSAERRELWQRSWKRFTSRPMSVVGLGIIIAI
                     VLLAVFAPVVAPYPEHAGKFTDFSNTLQPPSVDHPLGTDHVGRDVLSRILFGYRLSLM
                     LVAVVLGFGVPVGVLLGLVAGYYGGWTETIIMRATDTALALPPLVMALAITSALEPTL
                     TNAMIAIAALWWTWHARLVQSIVASERSEEYVQAAKLAGASTPHILFREILPNTLSPI
                     LVKVTLDAGFVILIGAGLSFIGVGVQPPQPGLGTMVSQGTSYLPDSWWVSVFSGLAIF
                     VLVMGFNMLGDGLRDLFDVEVNR"
     gene            complement(90597..91628)
                     /locus_tag="HVO_RS00390"
                     /old_locus_tag="HVO_B0081"
                     /db_xref="GeneID:8919119"
     CDS             complement(90597..91628)
                     /locus_tag="HVO_RS00390"
                     /old_locus_tag="HVO_B0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968525.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter"
                     /protein_id="WP_004041074.1"
                     /db_xref="GI:490140725"
                     /db_xref="GeneID:8919119"
                     /translation="MKYWQYLVRRLAGILVSLIGLSIIIFTTSRVLPGNPARMALGAL
                     ASEEQVQALAAEMGLNKPIPLQYLDYMRGLLVGDLGTSLETKRAVSTDIVYYLPATLE
                     LITVSMFLTVVIGIPLGVIAAQNKDGLADNATRLVAFFSVSVPGFFVAIMFQLIFGYL
                     LEWLPITGRLGSEFGSGVSRFTGFLLVDTLLSGNLAAHVDAWAHIILPALALSLAGIG
                     QVMRITRSSMIDVKDQDYVEAERGFGLPSWLVTYKYTLKNAFIPTLTILGLLYASLLG
                     NAFLIELVYSWPGLASYGVTAVLNNDFNAVVGVTMTIGVAFVSINFLVDVLLGRVDPR
                     IRLAMEEAT"
     gene            complement(91625..93346)
                     /locus_tag="HVO_RS00395"
                     /old_locus_tag="HVO_B0082"
                     /db_xref="GeneID:8919201"
     CDS             complement(91625..93346)
                     /locus_tag="HVO_RS00395"
                     /old_locus_tag="HVO_B0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041073.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004041073.1"
                     /db_xref="GI:490140724"
                     /db_xref="GeneID:8919201"
                     /translation="MRSQVGSASESVRARFGDAASRRNFLKALGTAGIAGLAGCSGGG
                     ESYDGQEQTTASGGDDEETETESSSGGDSGSSTLRMSATQRFGTVDPAKGTDYTQVLA
                     LVNLYDPLVFPDTEGNLQGHLAEDWTVSDDNQTYTFTLREGATFHSGNPVTAEDVQFS
                     AERFLDINQGYSSLLGNVLSKENVTVEDERTVSFTLDRVHSPFLATLVLLFVVDKQQV
                     LDNAEDGDFGDRGDYAQSFLNDNDAGSGPYELAGFERQAQISFSRYADYWGSFKDGAY
                     DNVTVQIITNDPTVRSLMKTGELDMSSQYQSEETYEALAAEDDIRVESVPTVTTFYFK
                     INTQKAPTDDPAVREAMAYGFDYETARNEIAPGSLPAQGPLPSSFGVHNDDIVQPTYD
                     PERARQILADAGYEEGDITVQNTYVKDYGLEEKMGLLFQQNMDEIGIDVELNPQTWGT
                     MTELATSVEDTPHINQVFYGPVYPSPDTVFYNQYHSEAASTWMSMEHLEDENVDSLID
                     EARSTVDADARAELYAEVQERIANQYPDLFIFVQSKKHAFAADVAGYTFRPSMSFDYW
                     FPDIYQE"
     gene            94093..94962
                     /locus_tag="HVO_RS00400"
                     /old_locus_tag="HVO_B0083"
                     /db_xref="GeneID:8919242"
     CDS             94093..94962
                     /locus_tag="HVO_RS00400"
                     /old_locus_tag="HVO_B0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolactonase"
                     /protein_id="WP_004041072.1"
                     /db_xref="GI:490140723"
                     /db_xref="GeneID:8919242"
                     /translation="MAWEFERVAGPFRATEGPIWTGDAVRFTEIKENQVLEYDPGTGE
                     TCVYIDSTAGAVGLHEGRDGELYACEAEGHRIAALTPGESASVVVDEFEGTPLNGPND
                     LEIDHDGDIWFTDPDDKDRGLLGHTSVFRAERVDADASDGWRLVRLTDEMDRPNGILL
                     SPDESRLYVAECTYGPDQETDLRAYPIRDDGSLGPREILHDFGDHRGIDGMTLTESGD
                     IVACAGWEKGGPGPSIYVFSPEGEVLERHPFPENRPTNCTLGGPDCSTLYVADMTGSL
                     YAAETDRSAYVRF"
     gene            complement(95047..95463)
                     /locus_tag="HVO_RS00405"
                     /old_locus_tag="HVO_B0084"
                     /db_xref="GeneID:8919374"
     CDS             complement(95047..95463)
                     /locus_tag="HVO_RS00405"
                     /old_locus_tag="HVO_B0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041071.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit delta'"
                     /protein_id="WP_004041071.1"
                     /db_xref="GI:490140722"
                     /db_xref="GeneID:8919374"
                     /translation="MVQELTLAEAKTILDAMEEKAEELGVPLNLAVTNSEGNLLGFRR
                     MDGAKLVASNIAQNKAYTAAAVKKPTHELKEGAEPGGDVYGLHTTDNGRVVVFGGGFP
                     VEHDGVVVGAVGASGGAVSEDMEASQAGLDAFEPLR"
     gene            complement(95639..97228)
                     /locus_tag="HVO_RS00410"
                     /old_locus_tag="HVO_B0085"
                     /db_xref="GeneID:8919153"
     CDS             complement(95639..97228)
                     /locus_tag="HVO_RS00410"
                     /old_locus_tag="HVO_B0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="polygalacturonase"
                     /protein_id="WP_004041070.1"
                     /db_xref="GI:490140721"
                     /db_xref="GeneID:8919153"
                     /translation="MTAYADETADLQTEAFQTAIDDCSESGGGTVTVPSGPYTVGTVH
                     LRSDVTLYLEAGAVVSPAKDESEFTDKFIGPDNERIFFLAEDVENVTIAGEGEFDGLG
                     TEFMRMDTPIQGHSNESASHPLISNGPHEARQGDAYLSRTSGTDGWPVAKPDFRPGPM
                     FRFNNCTNVRVRDVTIRDMPAWTLSFHGTEEVDIRGVDILNHLLIPNCDGIALGDTKN
                     VHISDCTIQSCDDSITFGARPDEPTTCEGIVVTNCTLRSSACAIKFGSGTDDTIRDCL
                     FQNIVVQESNRGLGIQHRDSGVVENVLFTDIVVNSNMLPGPWWGKGEPIYVTSVPRDG
                     DTDLGGIRNVRFSNIVARSENGALVYGSADADIETIEFDNVRIDLAGSEHADEVGGNF
                     DLQPSSVVTPIFANDIAGVHVENARDVTMRDVTVEWDDDGDLPDYYRSGLACEDVDGL
                     LVDGFVGRQAHRDDDAAAISVSDTTDITVRNSRATEGTGTFLSLSDTADERLFVNNDL
                     IDAADAGDVASFERSGNALPR"
     gene            97345..98739
                     /locus_tag="HVO_RS00415"
                     /old_locus_tag="HVO_B0086"
                     /db_xref="GeneID:8919199"
     CDS             97345..98739
                     /locus_tag="HVO_RS00415"
                     /old_locus_tag="HVO_B0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041069.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="arylsulfatase"
                     /protein_id="WP_004041069.1"
                     /db_xref="GI:490140720"
                     /db_xref="GeneID:8919199"
                     /translation="MTDQQRSDTIRALGNSRIHTPNIDRLVDRGVSFTNAYSPDPICI
                     PARHTIRTGCEAVSTGYLGNEKRDARHLEDRCGPFLARSMRERGYRTFLVGKYHAHPR
                     DIDLGYDHHLSFEAFREETGHEVKTTARQGAMVHLPQQNRLPPDDNYEAWMTDRAVDL
                     VGRDTDEPFFGLVSYEPPHPPFAPSPPFDRMYDPERLENPVKGDLETDHMDEKIPAQN
                     HHFWTTREGGIDDTTVRVIKEYYYGMISEVDRRIGRLLDAVEARDDADNTLICFFSDH
                     GELLGDHRGWEKSSFFESSCRVPFLVSWPAELPAGERRDDLVSLTDLFGIATTAADDQ
                     ELRDGVDVLGTIRGDAESRERLFGYHRTPRLPPNFTGMVREGRWKYVFMRNGGREQLF
                     DLAADPNELDECAADNPEVVAELRDALAAKLADAGADEFVENGTLRRAPYQEIDMGRL
                     VREPYPEEPADALD"
     gene            98848..99978
                     /locus_tag="HVO_RS00420"
                     /old_locus_tag="HVO_B0087"
                     /db_xref="GeneID:8919256"
     CDS             98848..99978
                     /locus_tag="HVO_RS00420"
                     /old_locus_tag="HVO_B0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_004041068.1"
                     /db_xref="GI:490140719"
                     /db_xref="GeneID:8919256"
                     /translation="MEISDIRTIRFSCASHIDPDEKGHGHPGEPRESTRTITHVVVDG
                     GPDGYCRGGHEAANEFAKKHLVGENPLYREKLWQLLCRAERLNKGTLTDKRVAPIDCA
                     LWDIAGKDAGLPVYQLIGAARDSVPAYGSTMVGDDDPDGLGSPEAYADFAEELVAEGY
                     QAVKLHTWMPPFGDDPEQDIAACRAVRERVGDGIDLMLDAHHFYSRSEAKKIGKALED
                     LDFRWIEEPMDEHSMSSYEWLSNELDIAVVGPETAEGRMHTRAEWIKRDIADIIRVGV
                     YDVGGLTPALKAVGLCESFNIECEIHGRDAPNLQLLGTMAFPGRYYERGLLHPKHDYE
                     TYFPGLEHPPDEIDDNGVVELPKTPGLGYAFDWDYIDANRVA"
     gene            complement(100122..100340)
                     /locus_tag="HVO_RS00425"
                     /old_locus_tag="HVO_B0088"
                     /db_xref="GeneID:8919029"
     CDS             complement(100122..100340)
                     /locus_tag="HVO_RS00425"
                     /old_locus_tag="HVO_B0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041067.1"
                     /db_xref="GI:490140718"
                     /db_xref="GeneID:8919029"
                     /translation="MSVNASRVPSLRKAAASNRNFIMTALAGVCMILLARFVLDGTIA
                     GMFGVWGISLVGVAVGGYLLLRLWGAYN"
     gene            complement(100521..101582)
                     /locus_tag="HVO_RS00430"
                     /old_locus_tag="HVO_B0089"
                     /db_xref="GeneID:8919191"
     CDS             complement(100521..101582)
                     /locus_tag="HVO_RS00430"
                     /old_locus_tag="HVO_B0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004041066.1"
                     /db_xref="GI:490140717"
                     /db_xref="GeneID:8919191"
                     /translation="MSVDNSILSVDDVSVHFTDSSGFLGLFGERQTVRAVDGISLDIG
                     ENDVVTLIGESGCGKSTLGKAIIGAQEPTHGSITYRGQDIWEAKNSRDPDIPFSEIRR
                     SLQIIHQDPGSALNPNQRILTSLMLPLKKWNPSLGEEERRKRIYALFERVGLTPAEDF
                     VERFPHQLSGGEKQRVVLVRSLLLNPDVILADEAISALDVSLRVEMMDLMLELQDLFN
                     TSYVFISHDLSNARYIAEKSGGRIAVMYLGRIVEVGPIEQVIGDPQHPYTQALKWATP
                     NLYEGDEDDDLPIRKIDIPDPTNRPSGCHFHPRCPKAREVCETNDPGAFEDETGHAAR
                     CFRADEDHEYWDSPSIVDD"
     gene            complement(101579..102649)
                     /locus_tag="HVO_RS00435"
                     /old_locus_tag="HVO_B0090"
                     /db_xref="GeneID:8919061"
     CDS             complement(101579..102649)
                     /locus_tag="HVO_RS00435"
                     /old_locus_tag="HVO_B0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041065.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004041065.1"
                     /db_xref="GI:490140716"
                     /db_xref="GeneID:8919061"
                     /translation="MRTSNQNDSDPDQDVVFEVRDLEVTFGTNRGESRVVRNVDFDIY
                     RNETLGMVGESGSGKSMTSSALMNAVVSPGETSGEVTYYPPDGGEPISVLDLDEEELR
                     KFRWGEVAMVFQGAMSSFNPVKKVRGHFRETLEDHNRDVEAGLDRARKILGDLYLDPD
                     RVLDSYPYELSGGMKQRALVALALILEPEVLVMDEPTAALDLLMQRSIVSLLKELKAE
                     YDLTIIFITHDLPLLTKLADRLVVMYAFDIVEIGSTEEILYDAAHPYTRSLLNATPDL
                     NAPIEEMQSISGSKPDPVTNIPGCSYRPRCPMADESCAEAEPPMADRGGGHRTACFYH
                     DDVSDEIPIPAMEAAEEGGEAE"
     gene            complement(102695..103717)
                     /locus_tag="HVO_RS00440"
                     /old_locus_tag="HVO_B0091"
                     /db_xref="GeneID:8919001"
     CDS             complement(102695..103717)
                     /locus_tag="HVO_RS00440"
                     /old_locus_tag="HVO_B0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599994.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004041064.1"
                     /db_xref="GI:490140715"
                     /db_xref="GeneID:8919001"
                     /translation="MSEAHSDTFDLKDLYEEDIDPDPESGADRAKRFLEMNVIAPARI
                     AADDWRALVGGAILAFFVLMGTVGVWLVERPTSGDAPVLAAPFESLAYPLGTDVFGQP
                     IHAQLIHATPGMFKMIFAGAVVSVGFAALVGVVAGFEHGTRIDSFLMTVTDVVITIPG
                     LPLIIVITAIFQPENPYIVGVFLGIDNWPGLARTVRSQVLSIREESYVEASEIMGIPL
                     SSILRRDILSQLMPYVMINGALTSRRIIFESVGLYFLGILPFTTFNWGVMMNLAYEGN
                     ALTRPDMLPWMVAPMVCIFLLSFGLVLLSQGLDSLFNVRLRARHANTSKKGTSKNNQS
                     QATGGD"
     gene            complement(103720..104664)
                     /locus_tag="HVO_RS00445"
                     /old_locus_tag="HVO_B0092"
                     /db_xref="GeneID:8919288"
     CDS             complement(103720..104664)
                     /locus_tag="HVO_RS00445"
                     /old_locus_tag="HVO_B0092"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_004041063.1"
                     /db_xref="GI:490140714"
                     /db_xref="GeneID:8919288"
                     /translation="MTVSFLLYQAMPGGPTEAMRSVILSQSGGSVDIDRLNRMIQLYT
                     NVNPDQPMHVQYFNYASDVILRQDLGTSFFKNEEVTTLIMQRIPWSMFISVYALALGY
                     SLSIFLGVMTAYREKSRFDSTVSSLIIGLNSIPYYIVGVVLIYFLAIQNNYFPTGGRI
                     GSGIAAGYNPEFMLSLVQHAALPAISMGALATSGALAMRGNAVRVLGEDYIRVAQLRG
                     LRETRIATQYLGHNSILPMYTQFMIGIAGVFSSAVIVEEVFAYPGMGLLMFEAVKTQD
                     YPLLMGTLLVFTAISLTAIFIADLTYTLIDPRISVGEE"
     gene            complement(104798..106597)
                     /locus_tag="HVO_RS00450"
                     /old_locus_tag="HVO_B0093"
                     /db_xref="GeneID:8919170"
     CDS             complement(104798..106597)
                     /locus_tag="HVO_RS00450"
                     /old_locus_tag="HVO_B0093"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968542.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004041062.1"
                     /db_xref="GI:490140713"
                     /db_xref="GeneID:8919170"
                     /translation="MAGTAGLAGCFDSSGQTTEDGSTGDGTDGGTTTEGGASIADDTL
                     DYPAGRPATDVQFNRYSLGNYAHTLQDQLFEEVARGYADGTVRPDLLEDMTVDGRTLT
                     LTFPEGFKWWNGDDLTAEDYYIGLEIDRLQSPEQSPIESNTLVDDYTIERTFKTAVSP
                     NLMKANVAETFVNTPRSIYREYLTRYEEASNESERESVTSDLLDMSITTQQLIDEGLG
                     NALYRVTGFNSSETVLEKFEDHPYASRTDVPNVRIIPETTSDVESLSVNDQLDMNPDV
                     LMSESQQSRYPDNIENVYRLNWFRTQKFTFNFKNEHIARLPVRRAIVNAVDFESMVAA
                     MRQAGTVGAPAENQTALRSTIHEEYLGSDFVDQLIDYPVGKDLETATQLLEDAGYTKE
                     NGTWVDPDGESFTFTVLTQNNNTQVQATKVFNDHLNAFGIQTEISTVSSTDYYQRLQT
                     YEADIFWIWHVAKALWHPTAYFSNNFYGIEVGDPSSGNETGPTGKPFTTTIPSEVGAT
                     EISGSGKEIQPAQLMNDLPNSESAEQVRERTRDLVQWFNYALPDFVFVEEDSGYWGDT
                     QDFSMPTGDDYELNTNRPGEFSFKNGWISSNSQ"
     gene            complement(106769..106990)
                     /locus_tag="HVO_RS00455"
                     /old_locus_tag="HVO_B0094"
                     /db_xref="GeneID:8919066"
     CDS             complement(106769..106990)
                     /locus_tag="HVO_RS00455"
                     /old_locus_tag="HVO_B0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968543.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041061.1"
                     /db_xref="GI:490140712"
                     /db_xref="GeneID:8919066"
                     /translation="MPETSLADVLRDYETRMKFVLVISLASIVLLLISLPSIEPGTTT
                     HALVYLQLTTFGGLAVLMLGLLLWTARSA"
     gene            107105..107566
                     /locus_tag="HVO_RS00460"
                     /old_locus_tag="HVO_B0095"
                     /db_xref="GeneID:8919006"
     CDS             107105..107566
                     /locus_tag="HVO_RS00460"
                     /old_locus_tag="HVO_B0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uspA domain protein"
                     /protein_id="WP_004041060.1"
                     /db_xref="GI:490140711"
                     /db_xref="GeneID:8919006"
                     /translation="MDRGLVLIENTDLHADLLREAREHALGADADLVLLVTLTEDEFE
                     ETQEVLDTIGDVEHTSYTEQDAFKGAMNDAEEVARKVFATDDEVSYEIVPRIAAEKER
                     AETVIEVADEEGADHVFILGRKRSPTGKALFGDLAQFVILNFDGYVTLHTE"
     gene            complement(107648..108487)
                     /locus_tag="HVO_RS00465"
                     /old_locus_tag="HVO_B0096"
                     /db_xref="GeneID:8919293"
     CDS             complement(107648..108487)
                     /locus_tag="HVO_RS00465"
                     /old_locus_tag="HVO_B0096"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041059.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="WP_004041059.1"
                     /db_xref="GI:490140710"
                     /db_xref="GeneID:8919293"
                     /translation="MDVLMTGVYGRCGTAVIDHLHDDDAYDFTYFNRSDRPDDHPYGG
                     YDTVVGDVSDYDALDGAAAGQDAMVHMAAYPYTDGTWEDIFEPNIIGMYNALEVAREN
                     EIESFVFLSTNHVMGGYEDEFSPEIYEPGHGLVIGHEDPVRPDSFYGASKAYGEDMGR
                     YYVENYEYPKQFYALRVCSVRMPEYDHPYGDAEAAVENGEFERGSAEYEETVGRMKSM
                     WQSRRDFAHEIDCCLQDDNVEFGIFSGVSDNQRRWYDLEHARSQIGYHPQDDGEEWDS
                     PPE"
     gene            108749..109633
                     /locus_tag="HVO_RS00470"
                     /old_locus_tag="HVO_B0097"
                     /db_xref="GeneID:8919189"
     CDS             108749..109633
                     /locus_tag="HVO_RS00470"
                     /old_locus_tag="HVO_B0097"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_049914723.1"
                     /db_xref="GI:909671369"
                     /db_xref="GeneID:8919189"
                     /translation="MLTPFDDDLEIQHDKLEANAKSLSGDGISSFLAAANISEYHSLS
                     QQERVDVTETAVDALPDSACVLAGVGGSTKAATDLMEAYDRVGVDAMMVMPPDHTYVH
                     ERGLIRYYEKLDAATDTPLVPYVRGFDPSVSFLRDLSRIEGVVGVKYAIEDPVKLGSA
                     VAVADDDVVWVDGLAEPYAVSFWNEGIEGFSAGVSNFRPEIGLALFEALTEENWERAR
                     EIRDLTLPFQALRGETGTDNDLPGAISVPIVKKGLELAGLHGGEVREPIRSLSADDER
                     RAEELYEELDDGIARVID"
     repeat_region   109243..109405
     repeat_region   109493..109610
     gene            110277..111311
                     /locus_tag="HVO_RS00475"
                     /old_locus_tag="HVO_B0098"
                     /db_xref="GeneID:8919275"
     CDS             110277..111311
                     /locus_tag="HVO_RS00475"
                     /old_locus_tag="HVO_B0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041057.1"
                     /db_xref="GI:490140708"
                     /db_xref="GeneID:8919275"
                     /translation="MQHDDIQHDDVQFHNVRALQRVRPHEGLRLLRVPEAVRSGLNTG
                     AQTRMSHPAGTEIRLVPDETVRITLSSEERDSLVRPFWGDFQATGEEFTLGPEPKTVE
                     LSPPESLSDLDPAATGEMRYAPEVCRLVFPGDHRGGHIYYHGVEGARRPPTADEVPSL
                     RYLAYGTSITEGEDPSAEMLTYVNQTARRLGADPINLGSCGTAYCDPAMAEHIAARDD
                     WDVATLSLSVNMVGRFSPDEFRERAADMVETVAAANPTKPVACITLFPHVREYKRDHE
                     EATLSETFRQHLRDVVDECGYDNVHLVEGPDLLPTASGMTTDLVHPGDDAMVRIGERL
                     ARELESLMDD"
     gene            111410..112318
                     /locus_tag="HVO_RS00480"
                     /old_locus_tag="HVO_B0099"
                     /db_xref="GeneID:8919319"
     CDS             111410..112318
                     /locus_tag="HVO_RS00480"
                     /old_locus_tag="HVO_B0099"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malonate transporter"
                     /protein_id="WP_004041056.1"
                     /db_xref="GI:490140707"
                     /db_xref="GeneID:8919319"
                     /translation="MTVAANLGYMLGVLCLGALAKRLGLLDSGRRDKLTFFAFAFALP
                     ALVFTSTYDQPIREVIEPTLVLGFWLVLFTMLAVGWVVHRRVSPDSVRSVAIVQSYYS
                     NLGFLGLPLVDSTFGSLASAKAAVILGIGALTHVPLTITVLVLVNGADVSFKEEFIGV
                     LKTPVIPALVLGLAFSGLGLGVPGVLLTGLDALSSLALPVALLSIGASLTISTESFDF
                     RTVGAVVGSKVVLMPLLAFAVFSTFASSWSTVQAGVTMLATPTAVSSFIYANELGGDA
                     DLASMNVFATTAVSVATLFVVLQFLL"
     gene            112459..113910
                     /locus_tag="HVO_RS00485"
                     /old_locus_tag="HVO_B0100"
                     /db_xref="GeneID:8919148"
     CDS             112459..113910
                     /locus_tag="HVO_RS00485"
                     /old_locus_tag="HVO_B0100"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008006250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_004041055.1"
                     /db_xref="GI:490140706"
                     /db_xref="GeneID:8919148"
                     /translation="MSRTYGNFIDGEWTDSQSGETFEVTNPAAAGEVVSVPPASSEAD
                     VEAALDAAVAAQDEWASTPGPSRGAVLREAGNNLEARKEEATEVLVREEGKTRSEAGG
                     EVQRAIDIFHYYGAKARDFGGTVKSASAPGKDLYTKHEPLGTVALITPWNYPIAIPVW
                     KLAPALAAGNTAVLKPASEAPGVVSIVLECLDDAGLPAGVANTITGSGSEVGGPLIES
                     ERIDGVSFTGSTAVGTMVAETAAVDLKRVQCEMGGKNPTVVMPSADIEAAAETVGVGA
                     FGTTGQSCTATSRAIVHEDVYDEFVAAVSDYAESLVVGDGLDDPDMGPHVSENELSST
                     LEYIDIGSSEGATLEAGGSRLSGDDYDDGYFVEPTVFSGVENDARIAQEEIFGPVLAV
                     VKTDSFEDALDLANDVDYGLSASIVTQDLSEGKRFVNEVEAGVAKINEKTTGLELHVP
                     FGGYKDSSTNTYREQGDAGLDFFSSVKTIYENY"
     gene            complement(113930..114703)
                     /locus_tag="HVO_RS00490"
                     /old_locus_tag="HVO_B0101"
                     /db_xref="GeneID:8919038"
     CDS             complement(113930..114703)
                     /locus_tag="HVO_RS00490"
                     /old_locus_tag="HVO_B0101"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041054.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_004041054.1"
                     /db_xref="GI:490140705"
                     /db_xref="GeneID:8919038"
                     /translation="MSSPPNKRPGRTIRSVQIAFNIIDHLQEEAGIGVTRIADELGHS
                     KSTVHSHLRTLEERRVIVREGDGYRLGLRFLDVASHVRDQIGNFDIVQKEVDSLAEET
                     GEIVQFGVEEYGKVSYLHKAQGEHAVETLSRVGTQQPMYSTSLGKTILAYLPPERIEE
                     IAAAMEYEPKTANTITSPEELFEELETIREQGYGIDDEENINGLRCVSAPVKNDETIL
                     GAISITGPSSRFTEDRLHGELADYVRSAANVIELNTKFS"
     gene            114891..115958
                     /locus_tag="HVO_RS00495"
                     /old_locus_tag="HVO_B0102"
                     /db_xref="GeneID:8919330"
     CDS             114891..115958
                     /locus_tag="HVO_RS00495"
                     /old_locus_tag="HVO_B0102"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061669.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase family 88"
                     /protein_id="WP_013034983.1"
                     /db_xref="GI:502800007"
                     /db_xref="GeneID:8919330"
                     /translation="MPADELTPVQRAASYLRSLDIDGQSWITGVAINGLLAEGGDESV
                     ERAKHFVDTAVATQNDAGQLSYGPSYPIEVFSHGREYEASWELTVKKCMNTNNSTAIG
                     HSVLDFYDRTGEDRYLDAAERAYESLLSFERTEDGGIPHHDPELAGIKSLWIDSVYMM
                     CPFLARYGAAAGDADAFDEAVEQILIHAAHLRDGHTGLFRHIWVEQPNHYPQGAFWAR
                     GNGWAAAASADVLERLPEDHPKRDDLLDLFRSHCEALLPLQDGSGFWHNLVDDPHTPL
                     ESSGTLMFAYAFARGIDLGILDAETYRRPAEDGLAAVSRVVGEEGAVNRVAGPPGGPE
                     APLTDTPYGQGWFLMAAAALD"
     gene            116059..117156
                     /locus_tag="HVO_RS00500"
                     /old_locus_tag="HVO_B0103"
                     /db_xref="GeneID:8919269"
     CDS             116059..117156
                     /locus_tag="HVO_RS00500"
                     /old_locus_tag="HVO_B0103"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274249.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004041052.1"
                     /db_xref="GI:490140703"
                     /db_xref="GeneID:8919269"
                     /translation="MTYHAGIIGTGGIAGMGILGMHDEEAIGREKIDASHAGGYAATD
                     DIELVAVADVDESKLDTFGEAWDIPADRRYVGHEAMLEAEDLDAVSVCTPSFLHRDHV
                     VYAARSAADPSVVWCEKPIASAVSDAEEMVAVCDDTDTELVVNHSFRFTDKLRRLRDL
                     VRDEGILGDVKSVSAQYRMELMRNSTHVLDTLVYLLDARASRVSGHITGENEALDALD
                     ATESVVDAGGGGHVVMDDGTFVTVDCTIPRDVSSMTLSFIGTEGKLYMNNDDGEWRYW
                     SLEDGEHVERSLPGIEGAWTWESDYKGSFANAAAHVQELLGGDAENYSPGVAATRSLE
                     IIVGFYLSHYTDSTVDIPLPGPLREVPITSW"
     gene            complement(117697..117999)
                     /locus_tag="HVO_RS00505"
                     /old_locus_tag="HVO_B0104"
                     /db_xref="GeneID:8919167"
     CDS             complement(117697..117999)
                     /locus_tag="HVO_RS00505"
                     /old_locus_tag="HVO_B0104"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041051.1"
                     /db_xref="GI:490140702"
                     /db_xref="GeneID:8919167"
                     /translation="MARIAFHLEIKDGKREEYRTKHENVPEALESAYLDSDAGLQTYS
                     VFEKDGHVFGFMEVDDPEAIQEVMDNSEAQADWAEVMSGITVETDDSWMDEVYRMI"
     gene            118079..118948
                     /locus_tag="HVO_RS00510"
                     /old_locus_tag="HVO_B0105"
                     /db_xref="GeneID:8919071"
     CDS             118079..118948
                     /locus_tag="HVO_RS00510"
                     /old_locus_tag="HVO_B0105"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061663.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_004041050.1"
                     /db_xref="GI:490140701"
                     /db_xref="GeneID:8919071"
                     /translation="MIDTHTHAWGAASPEHPWTNGPILDLVDSFDVHTVYTAERLLAD
                     MDRNGVDEAVVVGYPICDWTDNWYTRRVAAEYDRLHGIVMLDPFADDAVERLDRCMET
                     DGVLGFRLGAACPYDRMWETFDPSVTWLRESVEETAFWEAAVDHDATVQILCDHGQLD
                     QALELVEAYPELTYLFDHFAHAGPETPTDEGTFGRFADLAEHDSVAVKVSEIVHMSDS
                     AFPYADMHDHVRWLLDTFGRERVVWGSDYPNVSDVASYAEACNWLKQVDSLSKADRSW
                     LTEKSFRRHVDLG"
     gene            119163..120539
                     /locus_tag="HVO_RS00515"
                     /old_locus_tag="HVO_B0106"
                     /db_xref="GeneID:8919316"
     CDS             119163..120539
                     /locus_tag="HVO_RS00515"
                     /old_locus_tag="HVO_B0106"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968558.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter substrate-binding protein"
                     /protein_id="WP_004041049.1"
                     /db_xref="GI:490140700"
                     /db_xref="GeneID:8919316"
                     /translation="MGGGNGGGSGSDGGSDGGGSGGGGGDSGSQSLDFWLFGGIPAER
                     EYISNHYSSYSDHDVTYQHQEWGQKYQIIASAAANNNLPDVMAGQTQQIPDYVGASAI
                     QPLDQEQFADQLEEINSRFIQANVDTQIYDSLGDTEGERQWGLPGGYADLGPFVDIRT
                     DYLEQTSFDSPPRNWEELIQLGEEMQELDEVSAAITAPGTDFGLTTGYFIGFVYANGG
                     RYFDPETLEATVDQPGFVDAVRLYQDIAEAGLFPDSMAENDHIGAGRLLREGESGIFI
                     TYSHANAVYQTTGAPQAWLDGEGHTVTRAPLPDSPSGSFEPRDLLLQNAQGFMLGNGT
                     DSEAELQAAFDFTEWWNSEEQLAPWTYDAENDVGIRGRVPTLESAFEDPSDLFRSQFG
                     DLVTLYENDDLFTRTSRFPSFSGIASVQSIINTEVIQPVVLGNATAEEACSAANESVQ
                     EVIDEELA"
     gene            120598..121524
                     /locus_tag="HVO_RS00520"
                     /old_locus_tag="HVO_B0107"
                     /db_xref="GeneID:8919110"
     CDS             120598..121524
                     /locus_tag="HVO_RS00520"
                     /old_locus_tag="HVO_B0107"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968559.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_004041048.1"
                     /db_xref="GI:490140699"
                     /db_xref="GeneID:8919110"
                     /translation="MSYSKQARGSFESVSKRIPEGVKVYLPVLPVTALVGLFILYPIA
                     QAIYSSFFNKDLLAPSEAEFIGLANYAEIWSNPTIHQVLWNTLIWVVVGSSAAIVLGF
                     LMGWLLHEKLPYTSVASAIVLIPWVLPRVVGASIWQFMFGGSQGIINELLVQLGVIDE
                     YIVMLGSTELSLWPPIIGMIWRLAPLFALLTLTSLQGIDEHLYEAARMDGATPWEQFR
                     FITIPMMRYNLAIGFLLMLIYNIRNFSMIWVMTKGGPGVSSSTLPVMIYRTAFVDFDV
                     GLASALSLILFVVLLVFSYYYIQVYDQVRGDV"
     gene            121524..122489
                     /locus_tag="HVO_RS00525"
                     /old_locus_tag="HVO_B0108"
                     /db_xref="GeneID:8919219"
     CDS             121524..122489
                     /locus_tag="HVO_RS00525"
                     /old_locus_tag="HVO_B0108"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_004041047.1"
                     /db_xref="GI:490140698"
                     /db_xref="GeneID:8919219"
                     /translation="MAAKDPDTAAEFRRNESWLFDTTAGAYVRKTAVSLLTLVVFAFV
                     LFPLYWMVVTAFKTTAEIQQIPPTVFPNDFSLEGFRLVVESSIQAGGYTSLFANLFGW
                     QASSAIDIDILSLVLNSLKVAIGAGAIALVFGTAASYVLSRRDFAGKNALMSIFLASL
                     MFPGTAIMVPEWELVSALGLFNTHLVLIFIYGAMTAPFVVWLMKGFFDDFPDSIIEAS
                     RIDQCSSIETFWYVIVPMARNSLIASFIFAFLLAWNELVFALTLLDNSRYTVPPGLLT
                     FVQGFNTQWNVVAAASIIISLPVLLGLAYIQRYFVQGLTGGAIKG"
     gene            122585..123766
                     /locus_tag="HVO_RS00530"
                     /old_locus_tag="HVO_B0109"
                     /db_xref="GeneID:8919333"
     CDS             122585..123766
                     /locus_tag="HVO_RS00530"
                     /old_locus_tag="HVO_B0109"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968561.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_004041046.1"
                     /db_xref="GI:490140697"
                     /db_xref="GeneID:8919333"
                     /translation="MTHLTVDGVTKIFGDPDKDGVVAVDDLDIDVEDGEFLVLLGPSG
                     CGKTTTLRMIGGLETPTSGEIRFDDVVVNDIKARNRDVAMVFQDFALYPHMTVRENLG
                     FGLKREDNGMSTADVNERVEEVATMLEIEQLLNNKPAQLSGGQKQRVALGRAIIREPR
                     LFLFDEPLANLDAKLRKTMRTEIDELQSEVGITSAYVTHNQEEAMTIADKIAVLNDGA
                     LQQLGRPEEVFNEPANLFVAQFVGSPDMNIYDGVVEEAADGVRVELDGVSFELPSDAL
                     DAEVPPGGVNVGFRPQDFYQTGKRRADGLTFDVDIRVIEPVGTKAIVHGDGPMGDVTA
                     EIGEFHGLSAGDTLSLSIAPEHVYLFEAETEALRKGRRIENRASVQSQSQSSESDGVE
                     I"
     gene            123935..124969
                     /locus_tag="HVO_RS00535"
                     /old_locus_tag="HVO_B0110"
                     /db_xref="GeneID:8919215"
     CDS             123935..124969
                     /locus_tag="HVO_RS00535"
                     /old_locus_tag="HVO_B0110"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="WP_004041045.1"
                     /db_xref="GI:490140696"
                     /db_xref="GeneID:8919215"
                     /translation="MKAIIQTGPRSVETQEREVPTPGADELLIKVHTAGLCGSDAHAY
                     KYDGGYEWIPIPRIMGHEYSGTVTEVGANVETFEVGDKVVEEPIHDCGHCFQCRNGQP
                     NVCQNFSITGMHRDGAYTEYVTVTPEHVHAVPEGVPLRHAAITEPTSIATRAVLDQSV
                     TTPGDNVLVEGPGPIGVLVAAVTDSLGANVVVSGLSQDAAYRLPLLEDLGIDTVNLEE
                     EGGLDGRVESQTDGIGFDVVFDATGHHSGVVSGNDVVRKGGQIVVVGIPNSASELSLT
                     STVRGEVDINTSYGSTWTNFEQALRLMERGEIAVEKILDTSYSVDDPAAAFEAFLGSE
                     TCKPVFQFDG"
     gene            125057..126262
                     /locus_tag="HVO_RS00540"
                     /old_locus_tag="HVO_B0111"
                     /db_xref="GeneID:8919346"
     CDS             125057..126262
                     /locus_tag="HVO_RS00540"
                     /old_locus_tag="HVO_B0111"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061651.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_004041044.1"
                     /db_xref="GI:490140695"
                     /db_xref="GeneID:8919346"
                     /translation="MEITDISATKISNESWGEFIEFPLVTIMSKYDEYRNVDGENPQA
                     RRKWMGPVGDVVVEVETDAGITGVGVGNWGTGAIATVVEETLSKIVVGEDPMQRELLW
                     EQMYRATLPFGRKGVAVMAISAVDQALWDIAGKDAGKPVYELLGGPTKDEIPAYASNL
                     HPVDMEKLEREAVQYVEEGFDAMKLRFLHGPEDGRAGMKKNEEIVATVRDAVGDDIEI
                     AGDAYMGWSVKYAKEMTQRLGKYDMAWVEEPVIADDISGYAEVREAAPMPISGGEHEF
                     TRWGHEDLLEEGAVDILQPDVGRVGGITELQKVADMAEVHDVPVIPHAGTNPTLHAIA
                     GHTNMPMAEYFPTPEWFEERQEKRESTYADAIFQNPPSPENGSIPLPDEPGVSTQLNR
                     EALEHFAIE"
     gene            126265..127293
                     /locus_tag="HVO_RS00545"
                     /old_locus_tag="HVO_B0113"
                     /db_xref="GeneID:8919034"
     CDS             126265..127293
                     /locus_tag="HVO_RS00545"
                     /old_locus_tag="HVO_B0113"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041043.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="F420-dependent oxidoreductase"
                     /protein_id="WP_004041043.1"
                     /db_xref="GI:490140694"
                     /db_xref="GeneID:8919034"
                     /translation="MSDISFEYNVPVFAGAPDEGTEPTHRDTPQYEALDWVTTKMGVQ
                     KAEELGFDAVWAPDHLLLGRDHAEYECWTLLSAIAGFTEDINLGSLVLCNDYRNPALV
                     AKMAATLDVISDGRLELGLGAGWHEPEYDAYGWEYRDGFERLMRLDESIRLMKRMWAA
                     GTDGASFDGKHYQIEDAYCVPGPVQDPHPPILVGGQGEEVTLKLVAKHADVWNTDVFN
                     GDVETLEHKIGVIEDHCDTVGRDPDDIEYSWDGHVICTRDEEKFDRLLDLMTPIQFEA
                     EYQDQAPIVTEEDAREYFIMGTPEECAEAIERRIDAGVTKFQGWFIDFPDTGGMELFA
                     DEVIPQFS"
     gene            127509..128267
                     /locus_tag="HVO_RS00550"
                     /old_locus_tag="HVO_B0114"
                     /db_xref="GeneID:8919139"
     CDS             127509..128267
                     /locus_tag="HVO_RS00550"
                     /old_locus_tag="HVO_B0114"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599981.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_004041042.1"
                     /db_xref="GI:490140693"
                     /db_xref="GeneID:8919139"
                     /translation="MAKDVPVNAVKISLELVDLLRELDGAGVSEVAKRLDKPTSTIHD
                     HLRTLEQQEYLVKEGDTYYVSTRFLQLGAHARSRQKVFNIARPEINELAQVTGEHANL
                     MIEEHGIGVFLYRSRGPDAVRLDTHAGMRVPLQTTALGKSIMANRPREEVEGILDRHG
                     LEAVTDRSITDREELFDVLEQVRERGYSYDDEERVKGMRCVAAPILNEDDYAIAAVSV
                     SGPKSRMREERFTEELPNQILKSANVIEVNLTYS"
     gene            128367..129218
                     /locus_tag="HVO_RS00555"
                     /old_locus_tag="HVO_B0115"
                     /db_xref="GeneID:8919266"
     CDS             128367..129218
                     /locus_tag="HVO_RS00555"
                     /old_locus_tag="HVO_B0115"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274258.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-oxopent-3-ene-1,2,5-tricarboxylate
                     decarboxylase"
                     /protein_id="WP_004041041.1"
                     /db_xref="GI:490140692"
                     /db_xref="GeneID:8919266"
                     /translation="MQLVRYTAGGAPEWGVRRDDDVVPLSGLREDVTVQNLNSPGFLT
                     VVEDAADAAEDQSVPVEDVKLLAPVPRPGKIVCVGLNYHDHAEEQDEEVPERPLLFGK
                     AGTSVTNPGDPIVHPAAIDEVDYEVELGVVIGQTAKNVDAEDAFDYVAGYTAINDVSG
                     RDAQFDDGQFFRGKSYDTFAPMGPTFVPEGDVDPHDLDVACRVNGETKQESNTSEFIF
                     GVDEVVEYISGITTLRPGDVISTGTPGGVGIFRDPPELLEPGDSVDVEIEGIGTLTNP
                     VVSERDE"
     gene            129270..130067
                     /locus_tag="HVO_RS00560"
                     /old_locus_tag="HVO_B0116"
                     /db_xref="GeneID:8919118"
     CDS             129270..130067
                     /locus_tag="HVO_RS00560"
                     /old_locus_tag="HVO_B0116"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968568.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain family oxidoreductase"
                     /protein_id="WP_013034945.1"
                     /db_xref="GI:502799969"
                     /db_xref="GeneID:8919118"
                     /translation="MSTHTDTRLRDRHIVVTGGARGIGRGIAVRCARAGADVSIFDTK
                     PEVAAETADLVREEGGEAEVYEVDVTDAEGVETAVDAAIDSLGDIHGLVNNAGVQQAV
                     PLLETTEDDWDLHFEVNAKGTFLVSKAVASRMVDGDIEGSIVNISSVGAERPFSGQGA
                     YGASKAAVLAFTTVLAKELSDHGITVNALKPGTVETPMVEEWLDEHAEQSGKSPDEIL
                     AETLDVHILDRIGQPEEVGHVAVLLLSEEGDWITGESIAVDGGYLKH"
     gene            130859..131485
                     /locus_tag="HVO_RS00565"
                     /old_locus_tag="HVO_B0117"
                     /db_xref="GeneID:8919086"
     CDS             130859..131485
                     /locus_tag="HVO_RS00565"
                     /old_locus_tag="HVO_B0117"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041039.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041039.1"
                     /db_xref="GI:490140690"
                     /db_xref="GeneID:8919086"
                     /translation="MGTDQSTNRRLSKVERVIETYDLDGFGEQLADRWTAPEDSDSLR
                     DLADLMNEKVLDAALRKAGEDVLEGEVENLYTLLTGDETTEGMRVQAKNTLQSRGVDV
                     DQLLSDFVSHQAVYTYLTDIRGVSKDSSSGNRIDNVIESIQRLRGRLVAVIEQSLSSL
                     RNTSKLRLGDFDVLVDTQVYCRDCGTQYEVVELLQRGGCDCDESESNY"
     gene            131561..133510
                     /locus_tag="HVO_RS00570"
                     /old_locus_tag="HVO_B0118"
                     /db_xref="GeneID:8919024"
     CDS             131561..133510
                     /locus_tag="HVO_RS00570"
                     /old_locus_tag="HVO_B0118"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMC-like protein Sph2"
                     /protein_id="WP_004041038.1"
                     /db_xref="GI:490140689"
                     /db_xref="GeneID:8919024"
                     /translation="MSSEQVSKSKVHLSVENIGGIDDLSTSFEPGVTVLAGRNATNRT
                     SLLRSIMAAHGSDDVALKGDADEGSVELTIGDEAYTRTFERQGDTVISGGNPVLDDPD
                     LADLFAFLLETNDARQAVARGDDLRDLIMRPVDVESINEQIESLQQEKRDIADELSTL
                     SNLSDRLPQLERRRTKLEDQIEEKEDELAEKEQEVEEYDASVSERQEVESELESKLGD
                     LRSKRRDINDVDRRIETEKQSLDALESEEAELEDDAEDLPEVAGGKIDEIESEISRLR
                     TRRQEIQSTVNELQSVIQFNEEMLSGTSSDVVDALRDADDAGGSVTDQLLGDDQVVCW
                     TCGSEVDKSEIEGTLERLRTLREEKLEDNRDHREQLSELEDEKSTYERRQRERDRIER
                     RLSEIESERETRQERIEELKSDRSDLEAEIDSLEQTVDELESEEHGDLLDLHREANQL
                     EYDLGRLRSDLEDVEDEIADIERKLDERDELEAAREDIEDELEELRTRIKRLESEAVE
                     EFNTHMDDVLDVLEYDNLERIWIERTEKRVREGRRKVTKSVFDLHVIRTNEDGVSYED
                     SVAHLSESEREVTGLVFALAGYLIHDVYETVPFMVLDSLEAIDSNRISRLVDYFADYA
                     DYLTVALLEEDAQAVDSSYPRYSPA"
     gene            complement(133644..134408)
                     /locus_tag="HVO_RS00575"
                     /old_locus_tag="HVO_B0119"
                     /db_xref="GeneID:8919298"
     CDS             complement(133644..134408)
                     /locus_tag="HVO_RS00575"
                     /old_locus_tag="HVO_B0119"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061638.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArcR family transcriptional regulator"
                     /protein_id="WP_004041037.1"
                     /db_xref="GI:490140688"
                     /db_xref="GeneID:8919298"
                     /translation="MTETANDRSLKTTVTTLRIVELLRERDGAGVTEIARELDIAPST
                     AHTHVTTLEAQEYVVKEGDTYHLGLRFLGLGNFVRTRKRKFGKAEHYTNVLSEESERR
                     SIFTVEEHGRGVYVHTAPGKHGVWTQSTVGKRVYLHSTASGKAILANMPRERVREIVD
                     RIGLPKETEQTIHDEEALFDELAEIRERGYALNVEEQISGVRAVGAPVMGPDGDVFGA
                     LSVAGPSNRMKGEQFDRLTEVLLGIAEELELSIALS"
     gene            134773..135720
                     /locus_tag="HVO_RS00580"
                     /old_locus_tag="HVO_B0120"
                     /db_xref="GeneID:8919371"
     CDS             134773..135720
                     /locus_tag="HVO_RS00580"
                     /old_locus_tag="HVO_B0120"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041036.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041036.1"
                     /db_xref="GI:490140687"
                     /db_xref="GeneID:8919371"
                     /translation="MNHNETFETVESLEAELVSLTESLWEQPELGLHETESAELLSSV
                     LRDGAFDDLDAVELLNTGSEFMREHVSDDARIHYTIPDGGGAPNVVPAEATAWFYVRA
                     PTRDEVDRITDWLDDVAEGAALMTQTTVSRRFHTGCYDYVANHALSDALLENMRLAGP
                     IPYTDEDREFAAELQETLSAETIEARTAQLPEERREAARSSVLYPDAQPSYDVGTVLN
                     GSTDVGDVSWITPTAQFWAASWPVGTPSHTWQAVATNGSFGSKAAVYAAKVLAATTLD
                     LFSDEALVAAAREEFEASVPGDYECALPEGTEPPFHLTL"
     gene            complement(135821..136525)
                     /locus_tag="HVO_RS00585"
                     /old_locus_tag="HVO_B0121"
                     /db_xref="GeneID:8919318"
     CDS             complement(135821..136525)
                     /locus_tag="HVO_RS00585"
                     /old_locus_tag="HVO_B0121"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_004041035.1"
                     /db_xref="GI:490140686"
                     /db_xref="GeneID:8919318"
                     /translation="MTWQEAETAFDEADFVVLPCGATEQHSTHLPTSVDSIRAENLTA
                     ELAAAAPEHDLNLLVLPVLPYGYSEHHINYAGTISLGADTYQEIIIDVGRSVQRHGGT
                     RFLVANFHGGNTEPHKLALDRLQRDHGLDSYYAHWTDFARDQLEARFGTEWGHAGEYE
                     TSVIEHCHPDLVRGDRKTPQTKKNRYEVRQYAHFDDLTVEGGLGDPTQSDPEFLEEVI
                     ESTTDRILTHLRSELE"
     gene            136582..138201
                     /locus_tag="HVO_RS00590"
                     /old_locus_tag="HVO_B0122"
                     /db_xref="GeneID:8919224"
     CDS             136582..138201
                     /locus_tag="HVO_RS00590"
                     /old_locus_tag="HVO_B0122"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008608336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_049914698.1"
                     /db_xref="GI:909671344"
                     /db_xref="GeneID:8919224"
                     /translation="MLKTTGASIPVLLAGCTSDSGSETTSEGDGGGGETTAGGATETA
                     AGGSDATINIGQALNPVRFDPITQLSNPDALVANRVFSQLYTYGEGTDVVPNLATSMP
                     TIERDNTRYIVEIVDNAMFHNGDPVTAEDVAYSFRTPIEEETPLLGIFSVIDTVEAIG
                     ETTVQFDLSNPYAMFQHVLTHQVVPEAVREEDKEAFSTQRPIGSGPFKFVEWEESNYV
                     TLERWDDYWGDELPDVAGVEFTPITESTTRVTNLRTGDVDVVETIPPRLWETVESTED
                     TSISEIESVGYFYVAFNCNEGPTADKRVREAIDYSFSMDDAVDRYIDPAGLRQYGPLP
                     GQMVEEWDMPLEEWMEIPNDKDVEQATALFEEAGVPADWDAKIIVPPDDNRENIGLSI
                     ANGIKEAGYEAHVERLDWGAMLSRAYTGNASDYNIYVLGWVRYPEPDDFIYNLFHEDS
                     EGVNQGVYYKNDEVMEQIQGARESTDRDERQQLYQSAISTLLEEKVHLPAFNYKNSYG
                     VKSTVSDFQVHPVSPQNPRLLTGYNNVSVDR"
     gene            138313..139269
                     /locus_tag="HVO_RS00595"
                     /old_locus_tag="HVO_B0123"
                     /db_xref="GeneID:8919136"
     CDS             138313..139269
                     /locus_tag="HVO_RS00595"
                     /old_locus_tag="HVO_B0123"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599975.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004041033.1"
                     /db_xref="GI:490140684"
                     /db_xref="GeneID:8919136"
                     /translation="MLFVVTVTFVLINSIPGDPVRILVGPSADAAAIEAARARYGLDQ
                     PLYIRYVRYVAAVATGDFGTSIHYGGVAVTVKIFERLPVTPLLLASSFTLAIGSAIPL
                     GIFAAKNRNNGYDHLARITSLIGVSTPSFWVGLLLIIVFAYYGDLLPPSGLVMPWADP
                     ASVEGAASRLDVLATAASHLILPSITLGTLQMAAITRIERSSMLEVLNKDYVQLARAY
                     GVSERTILRKQAFRNAQLPVLTVIGIQMTTALGGAVLTETVFNINGMGNLIITAVRAQ
                     DYQLIMGTTIFFAIVFVLGVLVVDVLYAVIDPRISYGGGAGE"
     gene            139253..140242
                     /locus_tag="HVO_RS00600"
                     /old_locus_tag="HVO_B0124"
                     /db_xref="GeneID:8919060"
     CDS             139253..140242
                     /locus_tag="HVO_RS00600"
                     /old_locus_tag="HVO_B0124"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061628.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_004041032.1"
                     /db_xref="GI:490140683"
                     /db_xref="GeneID:8919060"
                     /translation="MVPVSDSTAAAGDSARTGGVADADERSAVSRTSQVLRQLKRNSA
                     SRVGLYVIGLVTLVALVTTIDADLFDYQFAATFWYHPENDPSGSTILLPPVGIENSFG
                     TGTWAHPLGTDHRGRDVLVRLVYGTRIAVQVGLIATGIGMTIGTVVGAVSGYYGGWVD
                     DVLQRFVESLYAIPFLILVIAIMSAFGRELGIAIIGVSITTIPVFTRLIRSQVLSVRE
                     MEYVEAAKAAGVRDRHIIFRHIIPNSFAPVLVQSTLQVGVNILIVASLSFLGFGVQPP
                     TPSWGQMLAHSRQYMIVNSWSSLWPGLEVLATVVGFNLLGDGLRDAIDPRSND"
     gene            140423..141673
                     /locus_tag="HVO_RS00605"
                     /old_locus_tag="HVO_B0125"
                     /db_xref="GeneID:8919320"
     CDS             140423..141673
                     /locus_tag="HVO_RS00605"
                     /old_locus_tag="HVO_B0125"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041031.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004041031.1"
                     /db_xref="GI:490140682"
                     /db_xref="GeneID:8919320"
                     /translation="MSDTLLTVRDLHTHFRTDAGTVRAVDGISFEVQRGEVLGIVGES
                     GAGKSVAARSIMRLIDSPGVIVNGEVRFEDDLLVGVERGDDPDGEPRQDPEMLSSREI
                     RERIRGREIAMIFQDPTESLNPVFTVSEQLSEIIGLNRDVSAAEAEAIAVERLREVGI
                     PEAERRMDDYPHEFSGGMRQRVLIAMAFACEPSLVIADEPTTALDVTVEAQILDLVKD
                     LAARYDTSFVWVTHDMGVVAEICDRVAVMYLGELVELADKDDLFESPKHPYTRALLSS
                     IPVPDPRVSRETVPLSGDVPSPIHPPSGCRFHTRCPSLVAPAELDLSDDEWDRVRRFV
                     RAVQRESPDAAADDARATYFPDDLPAGEAVERALSLAAEGAWRDAASLLTETFVEPSV
                     CTSEVPALESPDELDRIVSCHHYS"
     gene            complement(141701..142243)
                     /locus_tag="HVO_RS00610"
                     /old_locus_tag="HVO_B0126"
                     /db_xref="GeneID:8919070"
     CDS             complement(141701..142243)
                     /locus_tag="HVO_RS00610"
                     /old_locus_tag="HVO_B0126"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041030.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041030.1"
                     /db_xref="GI:490140681"
                     /db_xref="GeneID:8919070"
                     /translation="MGAPRVLDRLDEFGVESIVDLTERRPTGYRSPSWDFSTHTLGIL
                     DELGFEWDSSQMATDFEPYRVREGWAAPADAPFERGTETDIVEVPVSWQRDDFPAFAF
                     NRKRGYANEKSVFRQWREQFDWMVDNVDDGVFVLTMHPQVIGQSHRLVRLESFVEHVA
                     DTPGVVFETVAEVADRFRSA"
     gene            complement(142343..143296)
                     /locus_tag="HVO_RS00615"
                     /old_locus_tag="HVO_B0127"
                     /db_xref="GeneID:8919177"
     CDS             complement(142343..143296)
                     /locus_tag="HVO_RS00615"
                     /old_locus_tag="HVO_B0127"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase"
                     /protein_id="WP_004041029.1"
                     /db_xref="GI:490140680"
                     /db_xref="GeneID:8919177"
                     /translation="MQFAVNVPTSAGDSVHSQLAFCDEISWDAQVEFAVAMEGLGFDG
                     VAVPDHVMTGSGPTTECFVTLAAIARETEDVYLYPKTVNNHFRNPALLAKQAATLDAV
                     SDGRLKLGMGAGWKESEARAYGYDWPDAPTRLRMLEESIRLLKRLWTEETVSFDGDYY
                     TLDEAMCRPHPVRDPHPPIMVGGGGESFTLRITAQYADSWNFWGPPEVMQHKLDVLER
                     HCEGYGRPFEEIERSWFARCLLREDEAELDALLDEHFPRFKPENVAEGEFPLVGTPEQ
                     VRERLATFVEMGFDEVVVEFVDFPETTSAELFAEEVAPAFR"
     gene            143445..143975
                     /locus_tag="HVO_RS00620"
                     /old_locus_tag="HVO_B0128"
                     /db_xref="GeneID:8919314"
     CDS             143445..143975
                     /locus_tag="HVO_RS00620"
                     /old_locus_tag="HVO_B0128"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041028.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose 1-dehydrogenase related protein"
                     /protein_id="WP_004041028.1"
                     /db_xref="GI:490140679"
                     /db_xref="GeneID:8919314"
                     /translation="MTDHQHAAIVTGASSGIGRAVVERLQADYDYVACFDIETGETDW
                     DDEGVHEFAVDVRDPDAVADAVAAVESVADVAALVNNAGISRAVSLADLDPDEWDRVL
                     DVNLKGQYVVARAVAPGMVERGEGAIVNVSSVADLPLERIGTPEEVADVVAFLCDGAS
                     YVTGTVLTVDGGSMLR"
     gene            complement(144202..144381)
                     /locus_tag="HVO_RS00625"
                     /old_locus_tag="HVO_B0129"
                     /db_xref="GeneID:8919181"
     CDS             complement(144202..144381)
                     /locus_tag="HVO_RS00625"
                     /old_locus_tag="HVO_B0129"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041027.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041027.1"
                     /db_xref="GI:490140678"
                     /db_xref="GeneID:8919181"
                     /translation="MTPTTRPRTEAVQETTVKLQAVSRTGTYRNAPARTETRRRAPTR
                     ANSVTQLGAEFVIEL"
     gene            144548..144955
                     /locus_tag="HVO_RS00630"
                     /old_locus_tag="HVO_B0130"
                     /db_xref="GeneID:8919135"
     CDS             144548..144955
                     /locus_tag="HVO_RS00630"
                     /old_locus_tag="HVO_B0130"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573223.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041026.1"
                     /db_xref="GI:490140677"
                     /db_xref="GeneID:8919135"
                     /translation="MDYVNEGDTVVVRLDPGEQVLDSLAAVRDELDIEHGFLTGIGAV
                     DAVTLGHYDVDDQEYLEEEFTGQFEVTSFLGNIGPDKIHTHIQVGTRDFETLGGHCSG
                     ARVSGTFEVVIHLGETPLTHHLDERTGLDVFDI"
     gene            145516..146379
                     /locus_tag="HVO_RS00635"
                     /old_locus_tag="HVO_B0131"
                     /db_xref="GeneID:8919172"
     CDS             145516..146379
                     /locus_tag="HVO_RS00635"
                     /old_locus_tag="HVO_B0131"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008610322.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041025.1"
                     /db_xref="GI:490140676"
                     /db_xref="GeneID:8919172"
                     /translation="MKRHLRVHIVPLWREHDRIVGPIEDDRPDKVYLLEHEDSAVERP
                     TYHEAVVDRIADVVGSPPDVEYLDLFDMYEVMGAVTTIADWHPDDFVRVNVTAGTKRA
                     AVGATMACMDEHTDAEPYVVDPEVRPHGLDAPVTEGFAQASLLTTYQIDSPSPDQVAA
                     LAIIEAHDTDAKHAKKKTLITEAARYGLEFMRGRVDGEADDYDPVTGDYNVLDNRVTA
                     TLEHQGYVTVTQRGTRRYLELTEEGRQTLRAFRHRAESVVSDLEARTDDPSESVDFAL
                     DNPVDALVENR"
     gene            146478..147707
                     /locus_tag="HVO_RS00640"
                     /old_locus_tag="HVO_B0132"
                     /db_xref="GeneID:8919268"
     CDS             146478..147707
                     /locus_tag="HVO_RS00640"
                     /old_locus_tag="HVO_B0132"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ repeat protein"
                     /protein_id="WP_004041024.1"
                     /db_xref="GI:490140675"
                     /db_xref="GeneID:8919268"
                     /translation="MPSNMHTRRAVLAAGGATALASLSGCVGRALGALDLERDYRRDA
                     PVGDVTGAWPTAQHDFANTGYTTDSGPSADASVERIASGDAALATSVALADGRGVLGH
                     SDGDGEDGVYRALDLDSETAPAESDDAWTIDYAHGKSTPTLAGDAMFVSTAEFVAAYD
                     ARTGERCWRTTEGGYGTPENAPVLAAETLVDGGSAPVFGRDPETGAEQWCYDAGEAYP
                     GLVARDGVVYTPIGADHEQTGVAALDAATGEERWRREDLPQSGVPLAVGGSHLYYNAH
                     RGNVFALALEDGSTQWQASIPLPENGSPRTAVAGDTVHAQTSRGSLAAFDAADGATKW
                     TLSLDADTFARPPVVAGDTRFVGSDDRLYAVSAASGENLWSTALDARPSGGLSVRGSE
                     LYFAGMGRNPGVFRVAD"
     gene            complement(147763..149388)
                     /locus_tag="HVO_RS00645"
                     /old_locus_tag="HVO_B0133"
                     /db_xref="GeneID:8919342"
     CDS             complement(147763..149388)
                     /locus_tag="HVO_RS00645"
                     /old_locus_tag="HVO_B0133"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968585.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041023.1"
                     /db_xref="GI:490140674"
                     /db_xref="GeneID:8919342"
                     /translation="MSLRRDVRRGLRIGRAEFVRSIRGYTSETRRVVGLLLLLLFFGG
                     SLLFSLPAVYVAGRSAQSVTEIPLFGLVATAVPVVLTLLATFRTLERIGRVEHESLVL
                     TTVHPRAVVIGLITAEIARIALWFGLPIAVVAATFTAGLGAPSLLLTTTVVVVPLACC
                     TTVWGYAAGVAVLRGFKRLPGVRRVLKVVGFVAMAAFVLVSQAFGRLLGDGSLPVDTL
                     AATLTFGPLTDYLALAFVGTPLARPFSAAAVATFAAIAALTPLGLVVATRQASALWFT
                     DRAPGGDRGSAASAKADESAGGFSTPKPLAGTNGGNVAWGLLVRGVRHPQQFTHLVML
                     VFFLGPLGTTIVQSSADGLGPILAASGAGLGTYLAGATFGLNPVGDDRPQFPMLLLTA
                     TAPRTLVRGRVLAGVLLGAPVAAALPLVTVALGTSPLSAVGFALVGVCMCLAAATFSV
                     GIGAAYPIYEEREFWGATTVVPSTLVLMAFMFVVGPGTVIGLVATWFGVTGHLAPTPL
                     LAAGVGLYLLVTVGVSYGSYRYAIRRYRTYTFD"
     gene            complement(149385..150161)
                     /locus_tag="HVO_RS00650"
                     /old_locus_tag="HVO_B0134"
                     /db_xref="GeneID:8919121"
     CDS             complement(149385..150161)
                     /locus_tag="HVO_RS00650"
                     /old_locus_tag="HVO_B0134"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599969.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="daunorubicin ABC transporter ATPase"
                     /protein_id="WP_004041022.1"
                     /db_xref="GI:490140673"
                     /db_xref="GeneID:8919121"
                     /translation="MPSTNADAAVEATDLRKAYGSEVALDGVSLSIPSGTVYGFLGPN
                     GAGKTTTMRILTGLSQPTSGSVRICGLDASDRGKLAPHVGYLPETPPLYDEFSAREQL
                     DYVADLRDISSETAEARIDDLLDQFDLVGDANKRIGTYSKGMKQKTAFIQSVLHDPDV
                     LFLDEPTSGLDPRAARQIRTSIGDVADSGATVFLSTHILPVVEAVADEVGVLFDGRVV
                     AEGTPDEVKSRAQTGGEGSLEDAFLAVTSDEPQLSGATDE"
     gene            complement(150248..151114)
                     /locus_tag="HVO_RS00655"
                     /old_locus_tag="HVO_B0135"
                     /db_xref="GeneID:8919051"
     CDS             complement(150248..151114)
                     /locus_tag="HVO_RS00655"
                     /old_locus_tag="HVO_B0135"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034997.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_013034997.1"
                     /db_xref="GI:502800021"
                     /db_xref="GeneID:8919051"
                     /translation="MAALQSIGTAAGSLRRNPILFVVAMAFSLVQLPSLFAQAVGPLV
                     GGIVSLVFSGVTVFVIPFFLGGVLGMANEAIDGRTSLGTLVSEGKSHYVSLLVVYFSL
                     LVVNLVLSFVGGFAAVFVGLAVLGSGIELGTVGLAILAIVVLAVVLTYLAVAFVVQFF
                     GHAIVIDDLGAVDGVKRSVACVRNNLVSVFGYSVIVGLGGLVAGVFGGVASLLLTPSL
                     RHQGTAVAGPGSGAPAASAFSSLPAIGVVGMVAVAVGLVLVSGLIGGFFAAYSTAFYR
                     SIRPTNPETTTP"
     gene            complement(151269..152087)
                     /locus_tag="HVO_RS00660"
                     /old_locus_tag="HVO_B0136"
                     /db_xref="GeneID:8919352"
     CDS             complement(151269..152087)
                     /locus_tag="HVO_RS00660"
                     /old_locus_tag="HVO_B0136"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041020.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_004041020.1"
                     /db_xref="GI:490140671"
                     /db_xref="GeneID:8919352"
                     /translation="MQPIRFEPGAEPSDERFGDDTPLLCCHGGMAPPAFWDPVVPHLG
                     DYEVVVPERPGFGTCLDDAETTPAEAVLEREVECVRELVDGIRAATGRDPVLFGHSYG
                     ALTALEAATDARVAAVAAYEPAVLPEANRTEANLSERMAALVEAGQRREAVKRYVEQV
                     LHPDGIDDLDAWLDEWPVWPDCVALAEEVVRMNRAVEQYRLPARLDVDAPAVVLAGTD
                     GPDFLRESARNVHDALPTSRFVEFDALGHGGPGDDPERVAAAVDAFLRDRAGLP"
     gene            152220..152906
                     /locus_tag="HVO_RS00665"
                     /old_locus_tag="HVO_B0137"
                     /db_xref="GeneID:8919238"
     CDS             152220..152906
                     /locus_tag="HVO_RS00665"
                     /old_locus_tag="HVO_B0137"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274277.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_049914722.1"
                     /db_xref="GI:909671368"
                     /db_xref="GeneID:8919238"
                     /translation="MGLIAEFDIDCDALPLTGVAAAVPEATLALELQYNHGERPMFIV
                     TATGGETRALEGAMDDAFDVADWTRIGESGETRRYQAAPARSFEEQLGDSLDDLAGLE
                     ALATADAIIERIEVRPAGWRQTGWFADRDEFGRFASFWRRSAGFELRRLARDGDPEPP
                     GEGLTDRQNEALRTAYELGYFDIPRGATLREVADELGITASSASERLRRAQTRLIAET
                     VATTWPPLPN"
     gene            complement(152981..154204)
                     /locus_tag="HVO_RS00670"
                     /old_locus_tag="HVO_B0138"
                     /db_xref="GeneID:8919372"
     CDS             complement(152981..154204)
                     /locus_tag="HVO_RS00670"
                     /old_locus_tag="HVO_B0138"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599966.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ repeat protein"
                     /protein_id="WP_013034980.1"
                     /db_xref="GI:502800004"
                     /db_xref="GeneID:8919372"
                     /translation="MTDAGKRPTRRRLLASLGATAAIGATGCLGTRSEHNPTNGECPE
                     YDPVEPATTDWRGVLGPATNTGAVAAEAVPEGDLAIDWTVPVETYVGHHVPVVADGTV
                     YVHDMDDELSAVDAETGERMWTRPLTDPEPAPAVGGGTLVVVTNAATHAFDAATGDRR
                     WKREDLDGGIFGASPIVAGDTVYVQSGVATHALALSTGETRWRAATGFPSDSTPAVDG
                     DTVYAAGDDTYVRALDTADGTERWRAKTSARIDCNVSVVEGTVLVGTGAGTVLGFDAE
                     TGEERWRYRLEPRRAGGERRPRQPETIATDGSRVYVAADDRLVTLALADGTRCWDNRN
                     YAGGYASGIAVGAGTVFVRTRDDSGGAMTVLDAATGNTRQELAGDERQRFDIGPSVAG
                     GGVYFAGRSAVVRLS"
     gene            complement(154201..155490)
                     /locus_tag="HVO_RS00675"
                     /old_locus_tag="HVO_B0139"
                     /db_xref="GeneID:8919261"
     CDS             complement(154201..155490)
                     /locus_tag="HVO_RS00675"
                     /old_locus_tag="HVO_B0139"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061605.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ repeat protein"
                     /protein_id="WP_004041017.1"
                     /db_xref="GI:490140668"
                     /db_xref="GeneID:8919261"
                     /translation="MLSRREVLAAGGAALVSGVAGCGGSSPAPDATFDAPTTAWPTAG
                     YDPQATGRAPDGPTEGTVSWSVSRSSADPPLYGALSPPVVADGTVYVTGVATHYYRPD
                     DFVSPLAAIDAASGSVRWVEGFADGLGGGPAVVDDDSGTVVIGGYDGALHAVGSDGGN
                     EWTADLGGRLGTPTAYGDRLYVESGSGRLHAVGSDGSRLWTADRPGPAERLLGPDEPV
                     ETTMPVADDRGVYAAFTPFDREREAVVVLGYDHGGGRRWRTVLDGRYGRSPNGLAVTD
                     DALYATVGGTVYALDPDTGEQRWQFVTGSAAAGPPTVDDERVYVGAKNLYALSRSEGV
                     ERWRVVNEAPPSHGRDPTALPYLARPPVADGRVYIRTGAVSAADGTRQWGGDADEWLR
                     SGNYFAEPYYGRPVASPVVTGDAMYLTHAHRGVVKVA"
     gene            155618..156538
                     /locus_tag="HVO_RS00680"
                     /old_locus_tag="HVO_B0140"
                     /db_xref="GeneID:8919144"
     CDS             155618..156538
                     /locus_tag="HVO_RS00680"
                     /old_locus_tag="HVO_B0140"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041016.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ repeat protein"
                     /protein_id="WP_004041016.1"
                     /db_xref="GI:490140667"
                     /db_xref="GeneID:8919144"
                     /translation="MPSYSRRDALKTIPALAAGLAGCASLTGRDDSLPMPTAWTADVR
                     TPTRAVRPPSGPLLVGTESQFRDDPMVSALDPATGEERWAVTGGKGRRSPLGFDDRHA
                     YLFSRAERATAVDYEAGERAWSTELTGVDRADPGVVQYPPAVAGDTVFVGSATEELLA
                     LDAATGEVRWRAPLQNTVFSRPLVADGRVYVGGADYFLYAFDAASGTRLWRDELAAPV
                     TRGPTRVDDRLVTVVGSDILVRGHSGTVPFDPTALYVHATDGTLVDEQLFERTPDGGR
                     VNWAVAVGGGVYVGQEWQLARLAPEVLDAE"
     gene            156528..157784
                     /locus_tag="HVO_RS00685"
                     /old_locus_tag="HVO_B0141"
                     /db_xref="GeneID:8919246"
     CDS             156528..157784
                     /locus_tag="HVO_RS00685"
                     /old_locus_tag="HVO_B0141"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041015.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ repeat protein"
                     /protein_id="WP_004041015.1"
                     /db_xref="GI:490140666"
                     /db_xref="GeneID:8919246"
                     /translation="MPSEPPERSGSAGNRNRHVSRRAVLGGLAAVGSLAVAGCGSIPG
                     LGGRRPVWRRDIDGAYMAGPPATTDELVLVGMQDKALYGLRREDGSTAVRFETGGPIE
                     TRPVTPSSGGPYHVHSTDGDLYAVDAAGDELWRDEGTARRARLVRTDSLVAELDFAPP
                     ENTLTGYDPQTGDRRFDRAVSSHSLNGVTDDSLVVPVPVGGSDSRVVSLSPADGSVRW
                     RTEPRRWYSNVVADSRLVVAARDGTLAAYEPSDGSARWRVPIGDVGRTMVLGSQAYLA
                     RDREDGRQELLAFDRETGEKRWANPTGYQIRAVEATDDAVFVGTRVDDPDGGVLGQID
                     CFGLDGTRRWQTVTGLPSVDSLGVTDSRVVAVWDRGFEVLARDTGASRWSYEPESASR
                     LSFRVESASVFVSYVDDGEAARFPLD"
     gene            157878..158912
                     /locus_tag="HVO_RS00690"
                     /old_locus_tag="HVO_B0142"
                     /db_xref="GeneID:8919169"
     CDS             157878..158912
                     /locus_tag="HVO_RS00690"
                     /old_locus_tag="HVO_B0142"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041014.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041014.1"
                     /db_xref="GI:490140665"
                     /db_xref="GeneID:8919169"
                     /translation="MDDTRRASPLERLVEAAETRTDDEVSDSLGELLTASPEDRKRAL
                     RELRDLANDRPTAFESFMPAVTPFLTDDERAVRLLTAKALVAVAEADSDAVAPAVSAL
                     AERLADEDEFYYVRARSAEALGYVALDHPDAVASPAVLADLRVGLSFDEPEVKQKLAK
                     ALECVALGDPGRLRHRVSALAEHLDDGDELVRYHLCTAIAGVGCDSPDSLAAVRGALS
                     ARLVDENAFVRGRAAEALGLLAGERGDRRDHGESVAVPDSALGAESDEAAAFVAERVG
                     FLRASMEGDTAAAASTVEGVGTLAGVRRTTADAVTEITSPDAEGVCPHCGIDLAEGAP
                     PMCPSCGAPY"
     gene            complement(159005..160810)
                     /locus_tag="HVO_RS00695"
                     /old_locus_tag="HVO_B0143"
                     /db_xref="GeneID:8919072"
     CDS             complement(159005..160810)
                     /locus_tag="HVO_RS00695"
                     /old_locus_tag="HVO_B0143"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599962.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HTR-like protein"
                     /protein_id="WP_049914695.1"
                     /db_xref="GI:909671341"
                     /db_xref="GeneID:8919072"
                     /translation="MSELVDEVVVLYVDDDEDFTELTAAFLERECDRFRVETATSVAE
                     GLNRAGDSTFDCVVSDYDMPERDGLDFLEALREDAPDLPFILFTGEGSEEVASDAISA
                     GVTDYLQKEQGTSQYTVLANRIENAVERHRSQRALEASEQRLSLFIEQSPLGVLEYDS
                     DFQIIGLNERGEEILGYTEEELRGHSWEVIVADDSYDNVDAVTDQLAVAEGGYHSIDE
                     NVRKDGEHIRCEWHNRVITDDDGEVVGIISLFQDVTERVRRENELERTNALLSTLIRS
                     LPVGVLAENSDRTVLAINDRLLELFGISEPSTELIGADCRELARKTSELVVDSEGFVE
                     RVDELIAGTESVHNESVALTNGRTLNRSYEPIELPDGTGHLWMYRDTTEQREREQQLQ
                     RQNERLSEFASVVSHDLRNPLNVAAGNVELAREDHESDQLATAARALARIDDLIDDLL
                     TLARKGDNVGEREPVSLGTLVTDCWETIETGDAELQTDLTATVVADRSRLQQLIENLV
                     RNSIEHGGDGVVVTVGELPDGFYVEDDGVGIAADRRDSVFQAGQTTSRTGTGFGLAIV
                     KQVAEAHGWTVSVTESDGGGARFEITGVTFAAADR"
     gene            161336..162310
                     /locus_tag="HVO_RS00700"
                     /old_locus_tag="HVO_B0144"
                     /db_xref="GeneID:8919176"
     CDS             161336..162310
                     /locus_tag="HVO_RS00700"
                     /old_locus_tag="HVO_B0144"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006599961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_004041012.1"
                     /db_xref="GI:490140663"
                     /db_xref="GeneID:8919176"
                     /translation="MGEVAFDGPPERWTALLPTFADMAFALGGGQTLGIQNHDRFASE
                     AFEELPGIDFDADDTVELVADGVSKELFYEMNADVHFIDPHILRLWYGWDQSDVDEIA
                     DNVGPFFGNFIRRHSDDWHDYRYYTLYEAFGLMAEVFQAQDRYQAFVELHEEMLALVD
                     EHLPPADQRPTALLVYPADGAGFQFYPFRFDDGGVSTKQWRDLGLTDALAATDVGHYS
                     FSDRGTLDIEALMEIDPEVLLVRNYGGASESTFQKEVVEPLQDQAGSHSLQAVEDDAV
                     YSAGYLDQGPIINFYHTDRAAKDIYTDSFENVTLFDRERVAEIVHGNI"
     gene            complement(162589..163284)
                     /locus_tag="HVO_RS00705"
                     /old_locus_tag="HVO_B0145"
                     /db_xref="GeneID:8919253"
     CDS             complement(162589..163284)
                     /locus_tag="HVO_RS00705"
                     /old_locus_tag="HVO_B0145"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041011.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="creatininase"
                     /protein_id="WP_004041011.1"
                     /db_xref="GI:490140662"
                     /db_xref="GeneID:8919253"
                     /translation="MHLETSSWTDVKDAAPTVALLPVGSTEQHGPHAPVGTDTIIAQE
                     LASEAGRRSDLNSVVLPTIPVGIAPYHSHFPGTLSVSAETLRRYSYEILTSLSNSSVE
                     TVVFVNGHGGNGETLRNLTRTVADDSTVDLEVFLWEWMSAVDDHVNHAGELETSMHLH
                     ICPDEVGSPTDGDAATWDDTVDGGVVNRFTEEFSKNGAVGDATSASAEQGEQLFETAT
                     DALCSFLRRVDDL"
     gene            complement(163495..164628)
                     /locus_tag="HVO_RS00710"
                     /old_locus_tag="HVO_B0146"
                     /db_xref="GeneID:8919041"
     CDS             complement(163495..164628)
                     /locus_tag="HVO_RS00710"
                     /old_locus_tag="HVO_B0146"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041010.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class V"
                     /protein_id="WP_004041010.1"
                     /db_xref="GI:490140661"
                     /db_xref="GeneID:8919041"
                     /translation="MADWNADFGPFDGHTWLNCAHQGPLPKRAVEAVDDAVTLKRAPH
                     RLPEQAFREVPAGVKRALGTLINASPDEIILGNSFSYGLHLLIHGLEWNEGDEVILVE
                     GDFPATILPWHLLESQGVQLRFVDAECSTPLTQQLAETATPRTRAFCTTWVDSFTGRR
                     LDIDEIGTVCHEHDVLFVLNGSQGVGARPIDVSRTPVDVLISCGYKWLCGPYGTGFTW
                     LTPEVLDAIGPVNAYWLSMQAGTTLDEMQNLSLDTELGASGYDVFGTANFNNFMPWTA
                     AVEYLTGIGIEQISAHGERLVGQLIEGAESSSFEVVTPEDPQRHANIVVLSHSSESVA
                     RETHRALADAGIHTALREGNIRVSPHVYNTHAEIDGLVERLPK"
     gene            164917..165570
                     /locus_tag="HVO_RS00715"
                     /old_locus_tag="HVO_B0148"
                     /db_xref="GeneID:8919159"
     CDS             164917..165570
                     /locus_tag="HVO_RS00715"
                     /old_locus_tag="HVO_B0148"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041009.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_004041009.1"
                     /db_xref="GI:490140660"
                     /db_xref="GeneID:8919159"
                     /translation="MTLVVECRLVSERLPLTDVAAAVPDVTLRVENTLTSARSRPVLI
                     FWADGGRLDSVDAALRDASVATHSVLGSTVDRRLYRVELSERPPAIYTEFIRLDTAPI
                     SATITPSGWDVRTRLSDRATLAEFNKDCEENGITFRLDRVVDVAPSDSNEYGLTAKQR
                     ETLLAAHEAGYFSVPRTTSLAELGAELGVTAPSVSERLRRAQDRLVRHTVASDKKTS"
     gene            165739..167340
                     /locus_tag="HVO_RS00720"
                     /old_locus_tag="HVO_B0149"
                     /db_xref="GeneID:8919367"
     CDS             165739..167340
                     /locus_tag="HVO_RS00720"
                     /old_locus_tag="HVO_B0149"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041008.1"
                     /db_xref="GI:490140659"
                     /db_xref="GeneID:8919367"
                     /translation="MTDTVGTEADAAERDAYFVGGGIASLAGAAFLLRDTEIPGENVH
                     VLEKRQVFGGALDGRGTPEEGYVLPGGRMFNFPTYECTWNLFRSIPSLEDPDTTIKGE
                     MDEFNEKHETYAEARLVGADQEILDVSSYGFETQHRLSLLRLLLTPEERLGETRIEEW
                     FDETFFDTTFWYLWATTFAFQPWHSAAEMRRYMQRFTREFPRLHTLSGVSRTKYNQYD
                     SVVRPLRRWLEARGVDFLGGHTVTDLDIVPARAGKTVETIRYEDQDGSAGTIAVEPTD
                     VVFVTNGSMTDALSLGSMTEVPDLHDSGTSFELWKALADDFPEFGRPSVFADHVPESM
                     WESFTLTLREPDFLEHVVEVTREEPGNALVTFTESNWLLSIVTAVQPHFANQPDDVKV
                     IWGYGLFPEERGNHVNKKMEDCTGEEILAELYHHLGYTDRLEELRETATCIPCMMPFI
                     TSQFMPRTPGDRPEVVPAGSNNLAFLGQFAEVPDDVVFTVEYSVRSALMAVHELFDAE
                     GDVPPVSTHQYEPDVLLDTVRAAFR"
     gene            complement(167680..168900)
                     /locus_tag="HVO_RS00725"
                     /old_locus_tag="HVO_B0150"
                     /db_xref="GeneID:8919053"
     CDS             complement(167680..168900)
                     /locus_tag="HVO_RS00725"
                     /old_locus_tag="HVO_B0150"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034999.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_013034999.1"
                     /db_xref="GI:502800023"
                     /db_xref="GeneID:8919053"
                     /translation="MPDGSSDHETPTRRDAIKYGGAVIGGGLLAGCIGQSNSASPLTE
                     TTANDSSTATKTTEPEVESYSVTMAPAGTIELDEVPKSVFTVLVHHADMVVALGHGDA
                     LNAMYSPSNFEGNYDKLLERLNGVSVDWSNLYNSWNPDKETLYELDSDLHLADPAYVS
                     TMDAWDTADVEEVQTEIAPWFGNSLSRNHSEPPADWADQYQYYSLWDIFGKVAQVFRE
                     QERYEALSDVKTTLDSTISSSLPASDNRPQTARIMTTPELDTIWTFHMNGPGFIRSHT
                     RPFGVPDALSDVEESSTIDLETLVETDPEVILVENAFARSDDWRAVKNEFHNDPVAGE
                     ISAVKNDQVYPLSARYGGPIMNLFQLEMVSKQLYPEQFGEWPDYDGGPYPDFSKEEQL
                     FDREQVANIINGDF"
     gene            169317..169745
                     /locus_tag="HVO_RS00730"
                     /old_locus_tag="HVO_B0151"
                     /db_xref="GeneID:8919362"
     CDS             169317..169745
                     /locus_tag="HVO_RS00730"
                     /old_locus_tag="HVO_B0151"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041006.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel-responsive regulator"
                     /protein_id="WP_004041006.1"
                     /db_xref="GI:490140656"
                     /db_xref="GeneID:8919362"
                     /translation="MSVVSVSMPEELLNRIDQFADDHGYTGRSEVIREASRNLLGEFE
                     DKKLEDRELMGVVTVVFDYETTSVEEKMMHLRHEHEDIVASNFHSHVGGHHCMELFVL
                     EGSLEEISTFVGKIRATKDTLTIDYSVLPVDDFGPLADMN"
     repeat_region   169898..171238
     gene            complement(170084..171253)
                     /locus_tag="HVO_RS00735"
                     /old_locus_tag="HVO_B0152"
                     /db_xref="GeneID:8919280"
     CDS             complement(170084..171253)
                     /locus_tag="HVO_RS00735"
                     /old_locus_tag="HVO_B0152"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034963.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013034963.1"
                     /db_xref="GI:502799987"
                     /db_xref="GeneID:8919280"
                     /translation="MSKQPQQADDEIHEDQLLNFLVNSLDEEVALSLAENAELDAEDI
                     YEVLVGACADGTSVSTLCERSEDEPHENSVLYHLRTKFDLETLEQVGNMLLQKDVLDV
                     LPQQVEVCADLHLRPYYGDEDDTDGLYHSQAKRGTTAFHAYATLYARVKNKRYTLAVR
                     RLEDGDTASSVLAEFLGILDGLDLGVKAVYLDREFYDSKCLTLLQAHNHAYVMPIVRW
                     GRTIKRELSEGWSRVIQHSLTAKLDGHSWTVEFPVYIDCTYQNGRYDEHGVARHGYAA
                     DAPFIDSPRDARYHYAKRFGIEASYRLSEQSIATTSTQNPVVRLLYVVVSLLLQNVWR
                     YLHWECVATPRRGGRRLWEWSFKEFINMVRRAAWTALAVRRAVPANRPPDDRFHR"
     gene            complement(<171282..171881)
                     /locus_tag="HVO_RS00740"
                     /old_locus_tag="HVO_B0152A"
                     /pseudo
                     /db_xref="GeneID:8919165"
     misc_feature    complement(<171282..171881)
                     /locus_tag="HVO_RS00740"
                     /old_locus_tag="HVO_B0152A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008368186.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(171961..173271)
                     /locus_tag="HVO_RS00745"
                     /old_locus_tag="HVO_B0153"
                     /db_xref="GeneID:8919028"
     CDS             complement(171961..173271)
                     /locus_tag="HVO_RS00745"
                     /old_locus_tag="HVO_B0153"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041385.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Mur ligase family CapB protein"
                     /protein_id="WP_004041385.1"
                     /db_xref="GI:490141037"
                     /db_xref="GeneID:8919028"
                     /translation="MAAQSAADQFLDYAAGALPMFLVGAEYEWKTGPKPIEVGSSSLT
                     GLVSEATRGIRHRKVLDQIDTQIVVSGTRGKSSTTQRLDDVFNRRGYDTLTKITGNHP
                     LLIHNGEVHPIERRGPRTTLYENISLIAEFVPELDAYEPDDIAIFENQGITEYTTRLF
                     NQRLTNPDIIVLTNVRQDHTDTLGKTRTDLARSFARSVPAGTHVVSGEQHPVLHEYMQ
                     KEIERRGGTIEQVDIPDEHEGLIGSETIHAVNAVLDVVGEPSLPAEEIESFLSAIQPT
                     WIELEDGLIFNAAEVNDVESTEMVRRVLVDDECITPFVYLRRDRRGRTASFAQYIELL
                     FERELIDEAHIGGANTRAFAENVDVPTKCHSQNADPEQVLTELFTDGRPVILMGNTVD
                     GFMREMQASIEQRVKEKRQAASASEAVDISEQGSAEATKPKDHE"
     gene            complement(173598..174764)
                     /locus_tag="HVO_RS00750"
                     /old_locus_tag="HVO_B0153A"
                     /db_xref="GeneID:8919325"
     CDS             complement(173598..174764)
                     /locus_tag="HVO_RS00750"
                     /old_locus_tag="HVO_B0153A"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008368193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041384.1"
                     /db_xref="GI:490141036"
                     /db_xref="GeneID:8919325"
                     /translation="MWVATLVAVIGLLSVGAITQFTGYRMGGSITIPVLAVYSLKNFV
                     MLPVFVLSAAAAYVGLWILRRRTLIFGRDELIAAIVIGTAVPVVTLYFVLQLGLEVGV
                     VAFLGSILPGLAAYNYHRIKPEYRRNDLLASVGLFVTLTALGWVLVSNGFAREFGTLT
                     PPVLFSSTADVAIYKGVAVPIDPESVILSREIVAGLFAGGLVLSERLRGRFGVRVGII
                     GAVLLAIFALASYWLVLLYVLLLALSFGFIQLSNYLTLRYGRVLLGVTVAVAIFAAVS
                     LTFVVPIERGLSAFFTAILAGIGAYNAHASAPFERRLVVPLQIVVFVPALIVARLFSA
                     PQPRGFPQELTVPVLGIAAVLWVAALGVAYWYTVSPPGEDEVLSASVLSEGGET"
     gene            complement(174818..175231)
                     /locus_tag="HVO_RS00755"
                     /db_xref="GeneID:25143363"
     CDS             complement(174818..175231)
                     /locus_tag="HVO_RS00755"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004977673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="WP_004041383.1"
                     /db_xref="GI:490141035"
                     /db_xref="GeneID:25143363"
                     /translation="MSVNIRIRDGYAASMPAEILAADDDEDIREMMDVSLSEEFDVET
                     VKDGREAWEYLEESPDSLPKAVILDVMMPEMDGFSVLDRIRENDGMQDMPVIMLTSRS
                     REEDIVRALEAGADDFLAKPFNKSELYGRVQQTLQ"
     gene            175418..179248
                     /locus_tag="HVO_RS00760"
                     /old_locus_tag="HVO_B0154"
                     /db_xref="GeneID:8919315"
     CDS             175418..179248
                     /locus_tag="HVO_RS00760"
                     /old_locus_tag="HVO_B0154"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041382.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_049914749.1"
                     /db_xref="GI:909671395"
                     /db_xref="GeneID:8919315"
                     /translation="MVQTKLQQTSPEIDCVSADGIDEALHRLASDRVDCIVTAYSLGD
                     SDGIGLTESIRQENDEIPILLFTGKGSEYIASEATRAGVSDYIPVRSERDNFTLLAAR
                     IRTLTTAARKRTEAEQTKRRFRRTLERATDAIYAVDSDWRIEYMNEKMAERVDRDPDS
                     VVGETIWEEFPSVVGTELEDTYRTAMETGEPVSFEQYLEEPLDYWVEVRAFPDDDGLT
                     VFSREITTERERELKLERSNAVLENIHDIVFVLNEQGDIDSANTAAKRLLAGDPSAQL
                     TGQQLETVVGDRVSDSDMTRFSQAVESTLDEIESDGGSMGLYDADLQLDVVVGTSERT
                     FDVRVTPFQSRASKQVVVVARDVTEESEVKRQLERERDALQDLQAVMAESDVSIESRL
                     ENLLEVGCQTLGLEIGIISRIQDSDYTVEAVHAPEADIEADDQFDLESTYCAEVVGTD
                     SVCSFADAVSAGKETHPAYRDFELESYIGVPLIVDDTRYGTVNFSSPTTRVAPFGTLE
                     RTFVELVAQLVSTELSRRRDRAELERQGFLFDRVQDVANIGIWELVPSSGELTWSDGV
                     RQIHGVDEDYEPSLDGAIEFYHPDDRETITEAVDQTIEDGEPYDLDLRIVRPDGEVRD
                     VRAWGKYVEDTPRGDPVLRGVFQDITEREAERRKHRELAEEYEALLETSGDAIFLLDV
                     DTAGENPSFEFARLSPGYELQTGITTEEVRGKSPREVFGDEQGAELETKYTRCVDQGA
                     PVSYREELDIGDGAQFWDTSLAPVLVDNEIVRVVGIARNVTEQVERERELEATNERLE
                     SLIGATPLTVMEIDTDGNVIRWNDEAENMFGWSRDEVLGEFNPIVPDEQQEEFASHKQ
                     RALSGERIRAKEIQRETKDGDELDLLLSVAPITGSDGEVTSVLAVLEDITEQKRLEAR
                     LRSLQDTAQQLSGAESSDEIGAIAVDAAAEILDLGVTGIWEYNERENALVPITETPAA
                     RDLLGESPRFTPGDSLAWDAFESGETQVYDDVQAEGQPHNSNTEIRSEILVPLGESGL
                     MSTGSVSTKVFSDTDVDLFRILGATVEAALARANREEELRRQNERLDQFASVVAHDLR
                     NPLSVAMGFLEIAEETGNAEHFEKVESAHDRIERLIEDLLTLARGETKIENAGEIDLE
                     SITTEAWGYVDTEEATLTVADGVPEVTGDAGRLTQFFENLFRNAVEHGGADVTVTVGG
                     LDGDDGFYVEDTGSGIPQEQQDDVFKHGVTSSEGGTGFGLSIVADIAKAHGWTVSVTD
                     GSNGGARFEFKRSK"
     gene            complement(179511..181244)
                     /locus_tag="HVO_RS00765"
                     /old_locus_tag="HVO_B0155"
                     /db_xref="GeneID:8919260"
     CDS             complement(179511..181244)
                     /locus_tag="HVO_RS00765"
                     /old_locus_tag="HVO_B0155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041381.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_004041381.1"
                     /db_xref="GI:490141033"
                     /db_xref="GeneID:8919260"
                     /translation="MLTDPSAVADSIIVHAETLCEREDHLWDVIRQLSIPVDNLEDAR
                     DQNRVTFGTDEMFRTLLFKGIRGISQNELAQRLGREPSLVKSFHLDTTDLSNTPTQQQ
                     LSYTHAQFSENTQEVLNRTVAGVRQAALNHGVLTEGLVPTIPTEPENSTSKSESEYKK
                     EKAQKTLTLARKHVLPEFDTHRAAHKTYSDEVILDMFARICANKGSAHSESEYGWLTD
                     DDLICDDSTFLRAMKKIATPEDSDSQLTFEDFEDDDSMPETDRIRDAIMTAFDAATDN
                     IINSIRGQNPFESRETIAAIDITHEQFHVWPWEDKEAGIAKPDYPKMVSGYKKDGEYK
                     RGYKYATITLVGDHAPIVLGIEPVKENSAWEPDDSPSYSKADLVSRLLDSAERFVDLD
                     TVMFDRGFYVNRVYADVHDREITYLSPVPKYEDELTAVQDIQEHPTADAAVKHDVPLG
                     IDGEVHHEAEFLYAPSTSDDAEGKYAVFVTNQDRVEPEKIRSVVNGYSRRWDIENQYK
                     SIKSFMPKTSSTDYRLRFCNFALSTLIYNLWRLTDYLIKVALDEPIRSPPVITAKTFV
                     RALGDFLREFG"
     gene            181542..182090
                     /locus_tag="HVO_RS00770"
                     /db_xref="GeneID:25143364"
     CDS             181542..182090
                     /locus_tag="HVO_RS00770"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041380.1"
                     /db_xref="GI:490141032"
                     /db_xref="GeneID:25143364"
                     /translation="MGLDELEGFLRKKGAAELITEIGTGTATFNALVDAVAVSGSTVS
                     SRLSEGVEREVLTVSHKPTEHGTEKRYALTILGRRIYDWAAQTEFERKVRKLRRVQHE
                     RETAFERMVGKLNRDMEIRKMVTDSEPVEDQEIDLPEGASLVPKMASEEKLREAKHER
                     MEANLKPIEELEDAGGTGEDSD"
     gene            complement(182603..183952)
                     /locus_tag="HVO_RS00775"
                     /old_locus_tag="HVO_B0157"
                     /db_xref="GeneID:8919079"
     CDS             complement(182603..183952)
                     /locus_tag="HVO_RS00775"
                     /old_locus_tag="HVO_B0157"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013035101.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013034936.1"
                     /db_xref="GI:502799960"
                     /db_xref="GeneID:8919079"
                     /translation="MDDVYSPPDSVVVDRIQRAFPSDELRERARATNLIERERKFDIV
                     ALFYTLSFGFAAGSDRSLQAFLDRYVEMADCDELSYAAFHDWFEPGFVALLREILDDA
                     IENLDTGRADLNGRLERFRDVLIADATIVSLYQDAADVYAATGEDQAELKLHLTESLS
                     TGLPTRFRTTDGTTHERSQLPTGEWVADALILLDLGFYDFWLFDRIDQNGGWFVSRVK
                     DNANFEIVEELRTWRGNSIPLEGESLQAVLEDLQRQEIDVRITLSFERKRGSGASATR
                     TFRLVGLRNEETDEYHLYLTNLAREDYSAPDIAQLYRARWEVELLFKELKSRFGLDEI
                     KTTDGYIIEALIIMAAISLMMSRVIVDELRSLEARQREGEAAADADSSASRLPRRRCS
                     LAVERHGHLIQLYLMIELGYELPDLDELLLWASRNPNPHRDRLREQVERGEFGFDRY"
     gene            complement(185436..186071)
                     /locus_tag="HVO_RS00780"
                     /old_locus_tag="HVO_B0159"
                     /db_xref="GeneID:8919217"
     CDS             complement(185436..186071)
                     /locus_tag="HVO_RS00780"
                     /old_locus_tag="HVO_B0159"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605320.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterio-opsin activator-like protein"
                     /protein_id="WP_004041376.1"
                     /db_xref="GI:490141028"
                     /db_xref="GeneID:8919217"
                     /translation="MNEGVHGEIHVADPSICRVSEASKETAVESVSRSVGATGDTAAV
                     EFTAPSSAAIDDADEIFHHEQKTIYRVTHSFTEESRCACELIEGHGCPVRHLEADCGA
                     VVLSFVAADLESFRDIVVNLKSAFDGVSLRRLTQSEPDSATGSLVFVDRDELTARQRE
                     VLETAHEMGYFEHPREANATEVAAALDINRSTFTEHLSAAQSKLLDTILDV"
     gene            186336..186911
                     /locus_tag="HVO_RS00785"
                     /old_locus_tag="HVO_B0160"
                     /db_xref="GeneID:8919254"
     CDS             186336..186911
                     /locus_tag="HVO_RS00785"
                     /old_locus_tag="HVO_B0160"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004056324.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041375.1"
                     /db_xref="GI:490141027"
                     /db_xref="GeneID:8919254"
                     /translation="MRRGTVVVLLLVVAVLLPTWYVALHGEPPSEQIEIDQSVTEMRP
                     LQEIVDTPEKLAPSQVGVIVWVALFALVGVLAAVHRFMDTAVRAGPSDEPTVADGGRV
                     GLPWFWTADRWVVEYDDASDAIEGIVAMGGLTILAIVFAALFTGEYLTLARTQYFGVY
                     AAGMFTALALLTVSYYAWFLPHVEVAERRGH"
     gene            186911..187564
                     /locus_tag="HVO_RS00790"
                     /old_locus_tag="HVO_B0161"
                     /db_xref="GeneID:8919164"
     CDS             186911..187564
                     /locus_tag="HVO_RS00790"
                     /old_locus_tag="HVO_B0161"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572694.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="(2Fe-2S)-binding protein"
                     /protein_id="WP_004041374.1"
                     /db_xref="GI:490141026"
                     /db_xref="GeneID:8919164"
                     /translation="MRLDNQHASDDCDEHCADCGDDSNHQPSIFSDDRASLARRDYAK
                     LLASVGGLTAVASLAAPLAGLTRVFERSYTGPVYSDGIYLVDGDGERIGENALSEGEK
                     MTVFPEPRPGIEKAPTLLVRHAEDAYGGATNLEYTVSGYAAYSKVCTHAGCMVSNEDG
                     ATLVCPCHFGKFDPTAGAKVVGGPPSRALPQLPITLSSEGNLIATGDFNGPVGPGGE"
     gene            187564..189012
                     /locus_tag="HVO_RS00795"
                     /old_locus_tag="HVO_B0162"
                     /db_xref="GeneID:8919185"
     CDS             187564..189012
                     /locus_tag="HVO_RS00795"
                     /old_locus_tag="HVO_B0162"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041373.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome B6"
                     /protein_id="WP_004041373.1"
                     /db_xref="GI:490141025"
                     /db_xref="GeneID:8919185"
                     /translation="MSRLDRLADRANDAGDEAYDWVDERFDLDTGRAFLGKAFPAEDS
                     FLLGEVALFCFLLLVLTGIFLGMFFEPSTSGVEYEGSVAKFQGQEVPEAFASVLHITY
                     DIPFGMFIRRMHHWAAHLFVASIGLHMLRVFFTGAYRNPREPNWVVGTGLAGLSMGAA
                     YTGYALPFDEFAATATGIGYNLATSIPLVGGVVGKAFFGGEFPSSATIPRLYFLHVLV
                     IPVAIGGLLAVHMAILVRQKHTEAPRDDDVRGLESRDRRPVEGSPSSDGGTEQTVSRD
                     DDSVVVGLPAFPNQAAVSAVVFFLTLATLAMLAGFLPVHNIAEYGPNNPAGTPELIMP
                     DWFLMWVYGLLKLLPSWMGFTVPLTDIHVSTEFVGGVLLPTLVFGAVAVWPFVDYHDE
                     SVHFTADPLDRPWQTAVGVAAIQFIMIASIAGMNNLLGRALGVGTGVVNPILTVALFV
                     VPIGSAALVYRMLGDDADESRTGRVPGEAGDD"
     gene            189005..189217
                     /locus_tag="HVO_RS00800"
                     /old_locus_tag="HVO_B0163"
                     /db_xref="GeneID:8919068"
     CDS             189005..189217
                     /locus_tag="HVO_RS00800"
                     /old_locus_tag="HVO_B0163"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004967657.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041372.1"
                     /db_xref="GI:490141024"
                     /db_xref="GeneID:8919068"
                     /translation="MTDANTGGAPRRRIELSPRTYRHLDRASKLLGVALVAVGLDAGG
                     DTLVGISLGVLGAGLALTTVFLQIDS"
     gene            189214..192165
                     /locus_tag="HVO_RS00805"
                     /old_locus_tag="HVO_B0164"
                     /db_xref="GeneID:8919365"
     CDS             189214..192165
                     /locus_tag="HVO_RS00805"
                     /old_locus_tag="HVO_B0164"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004062055.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate reductase"
                     /protein_id="WP_004041371.1"
                     /db_xref="GI:490141023"
                     /db_xref="GeneID:8919365"
                     /translation="MNRTNTSTPDDESGTDESQAEQTDDPPAVGDPPGEPATEGTSVS
                     RRRFLEGVGIASLLGIGRSAADDDPLFQMGGLNPVDDPIGNYPYRDWEDLYREQWDWD
                     SVSRSTHSVNCTGSCSWDVYVKNGQVWREEQAGDYPRFDESLPDPNPRGCQKGACYTD
                     YVNADERIKHPLKRVGDRGEGKWRRISWDEALTEIAEHVVDEVQAGRYDAISGFTPIP
                     AMSPVSFASGSRLINLLGGVSHSFYDWYSDLPPGQPITWGTQTDNAESADWYNADYII
                     AWGSNINVTRIPDAKYFLESGYNGTKRVGVFTDYSQTAIHTDEWLSPDSGTDTALALG
                     MARTIVDEGLYDEAHLKEQTDMPLLVRQDTGKFLRASEVPSVSTDADRPEWMLLMLDS
                     DGRLREAPGSLGERDGQKDYSKSIELDFDPQLDGETTVRTEDGRVRVRTVWAELRDEL
                     DDWGPETVHDETGVGEETYQRVAREFAEADKAKIIQGKGVNDWYHNDLGNRALQLLVT
                     LTGNLGEQGTGLDHYVGQEKIWTFHGWKSLSFPTGNVRGVPTTLWTYYHAGILDNTDA
                     DTAAKIRESIDEGWMPVYPEERDDGSRPDPTTMFVWRGNYFNQAKGNVAVEEELWPKL
                     DLVVDINFRMDSTALYSDIVLPTASHYEKHDLSMTDMHSYVHPFTPAVEPLGESKTDW
                     QIFRELAAKIQEVATERGVGPISDRKFDRDIDLQSVYDDYVRDWETGEADALDEDRAA
                     CEYILEHSEESNPSESDDQITFADTVEQPQRLLAAGDHWTSDIEDGAAYTPWKDFVQD
                     KNPWPTVTGRQQYYIDHDWFLELGEQLPTHKEGPTRTGGDYPMEYNTPHGRWSIHSTW
                     RDNEKLLRLQRGEPVVYLHPEDAAERGIEDGDTVEVFNDLAEVELQAKLYPSSQRGTA
                     RMYFAWERFQFDGDTNFNSLVPMYMKPTQLVQYPEDSGEHLYFFPNYWGPTGVNSDVR
                     VDVRKGGGDAE"
     gene            192162..193232
                     /locus_tag="HVO_RS00810"
                     /old_locus_tag="HVO_B0165"
                     /db_xref="GeneID:8919108"
     CDS             192162..193232
                     /locus_tag="HVO_RS00810"
                     /old_locus_tag="HVO_B0165"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600144.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chemotaxis protein CheY"
                     /protein_id="WP_004041370.1"
                     /db_xref="GI:490141022"
                     /db_xref="GeneID:8919108"
                     /translation="MSTDDGPAAQTDGDGVDLADGVDHQVAMVMDLNKCIGCQTCTVA
                     CKSLWTEGGGRDYMYWNNVETKPGKGYPRDWEDSGGGWTDAEHTERSPGDIPDQADYG
                     DAWSFNHEEVMYNGGDWPLRPDSDPEWGPNWDEDQGAGEYPNSYYFYLPRICNHCTHP
                     SCVEACPRKAIYKREEDGIVLIDQERCRGYRYCVEGCPYKKVYYNATQKTSEKCIFCY
                     PRIEGEGPDGETFAPACAEDCPPQLRLVGFLDDEQGPIHKLVEEYEVALPLHPEYQTQ
                     PNVYYIPPFAPPQHSEDGETVDVDRIPRNYLEELFGDRVHDALDTIEKERDKVDRGGE
                     SELLDMLTDTNPARKYRLEVFD"
     gene            193290..194105
                     /locus_tag="HVO_RS00815"
                     /old_locus_tag="HVO_B0166"
                     /db_xref="GeneID:8919300"
     CDS             193290..194105
                     /locus_tag="HVO_RS00815"
                     /old_locus_tag="HVO_B0166"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004062051.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041369.1"
                     /db_xref="GI:490141021"
                     /db_xref="GeneID:8919300"
                     /translation="MSERRTAAVAAVAVVVLLLLVAVAGPAAVSARPANEIPVQSVAA
                     DDRPQRPTSEAWNTVPSVNVPLTSAPSGVPNASDTSVESVRVQSAQTDERLYLRLSWA
                     DGTADRNATSPRSFLDAAAVQVPVNTSVRPPISMGSTRNLVNVWYWSADGETEELLAG
                     GPGSTTEFERTAVETTASHDDGRWTVVMSRPLDSDAANRTSFAVDNDVDVAFAVWNGS
                     EMERSGRKSVSEWYHFPFGPGPQGPPYESILWTVAGLAIVGVALVTIEAVRKN"
     gene            194116..194862
                     /locus_tag="HVO_RS00820"
                     /old_locus_tag="HVO_B0167"
                     /db_xref="GeneID:8919207"
     CDS             194116..194862
                     /locus_tag="HVO_RS00820"
                     /old_locus_tag="HVO_B0167"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041368.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_004041368.1"
                     /db_xref="GI:490141020"
                     /db_xref="GeneID:8919207"
                     /translation="MDTNTNAETRTDDTNRDTDRVDSSGVDRPAAAQAAIYTALATLL
                     DEPDERLHERLAAGEVDETVRGLLDATGLSVAPPELTVDDDYETACARFNDLFTVGYA
                     EYADRTDGSLDSEGPRISLYESSYRPDAAWNDVNLDLARAYDYFGLEIDREARDNHDY
                     LPYELEFASYLARLEAAADPGDGRADDAARARLDFHDRHLHVVAGGLAERAADTPGTG
                     LYGEVASFLDRFVAADQRALAARFEGGDGP"
     gene            194859..195758
                     /locus_tag="HVO_RS00825"
                     /old_locus_tag="HVO_B0168"
                     /db_xref="GeneID:8919109"
     CDS             194859..195758
                     /locus_tag="HVO_RS00825"
                     /old_locus_tag="HVO_B0168"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004062047.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041367.1"
                     /db_xref="GI:490141019"
                     /db_xref="GeneID:8919109"
                     /translation="MTGRGVEDAVGSNPRPSGVAALRSRTPDGVLRTLAGVLAVVPLA
                     AVTAYRVGHNVPGGLPAGVTTLAADWSALAVVGPAFAGLLLAATADSKVERVGLAFAG
                     GFGVLALGTAAAAWQPAAIGVSVGVAVVAADRFVAPGRKREWNGARRAAPVGFAAVGV
                     ATSLAAAAGVWPATLRPLGSGVALAAVGVVPLAVGWDRISALAGITAGLATFGIVASA
                     PYVAGAVLLVGGGVVGVPTSLVAFAAAGGTAGAVSALRDGRPAVALGAALFCVAGVPA
                     TVLRATGVVVAAALVAYDGGERA"
     gene            195755..196585
                     /locus_tag="HVO_RS00830"
                     /old_locus_tag="HVO_B0169"
                     /db_xref="GeneID:8919239"
     CDS             195755..196585
                     /locus_tag="HVO_RS00830"
                     /old_locus_tag="HVO_B0169"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572706.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein phosphatase"
                     /protein_id="WP_004041366.1"
                     /db_xref="GI:490141018"
                     /db_xref="GeneID:8919239"
                     /translation="MRDEEEATDGPPDPQLHPEQSPGFGVDPVGLEDIEVDRDVTIGE
                     ATLADLGASDTEPVEDHPVSDLLASLAGDGAVERRRAALALAEREGDRVVVEALSRAA
                     TTDEDAEVRQFAVEALAKHGGDLAAETARALTDDPDPWVRAEAVVALDRLDRGEHEAV
                     IEAALDDEHHAARRNALVSLFKLRGEGACDALVAAADDPSERVREWAAHLLGGVETDR
                     AAEALSRLADDEQSVVRETAVRAQEVDSGSFRRQFTGVLDETDRTLPGEDDLNRTPNL
                     "
     gene            196588..197886
                     /locus_tag="HVO_RS00835"
                     /old_locus_tag="HVO_B0170"
                     /db_xref="GeneID:8919000"
     CDS             196588..197886
                     /locus_tag="HVO_RS00835"
                     /old_locus_tag="HVO_B0170"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004062045.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-binding protein Mrp"
                     /protein_id="WP_004041365.1"
                     /db_xref="GI:490141017"
                     /db_xref="GeneID:8919000"
                     /translation="MSEHEPTNHEPANDEPDTEPELRDRAESALRAVRDPDADLDVFE
                     AGLVESITVDGASVTVRAAVTEFDDANATQVMRAMAQAVRDVPAVESAHVEPVSPSSG
                     GGATGVDAFDTVIAVASAKGGVGKSTVSTGLACALAGEHSAGLFDADIHGPNVPSLLD
                     VEGPVHSDDEGHPLPVSVAGPDASLDVMSVGLMESGAPLAWRGAMAHDALTELFADTA
                     WSADDTLVLDLPPGTGDVVLTTLQEISVDGVVVVTTPFESSLEDTARSIELFRDNEVP
                     VLGAVVNMREFACPSCGDTHRLFPGEAASERLDATVLAELPFSPQFQETPAPGDAAPA
                     FETLAESVSEAAATAWDVDAPDGALDIRGDPPERRKERVAERFTALASGETFALVSDR
                     DPTPVRRFLGGLTDRAPAEIDGFSVERRTPNDWLLTATKP"
     gene            198163..198486
                     /locus_tag="HVO_RS00840"
                     /old_locus_tag="HVO_B0171"
                     /db_xref="GeneID:8919102"
     CDS             198163..198486
                     /locus_tag="HVO_RS00840"
                     /old_locus_tag="HVO_B0171"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041364.1"
                     /db_xref="GI:490141016"
                     /db_xref="GeneID:8919102"
                     /translation="MELQITELEDLEERVGNAPTRIGELQAGTRVQSDTFFSQSFMRD
                     HTEFDSFAGFCEQSPWEFDDIDDARDISRDRLNEYIVATTDFETWEGMKTQAAEEEII
                     DQLVS"
     gene            complement(198487..199176)
                     /locus_tag="HVO_RS00845"
                     /old_locus_tag="HVO_B0172"
                     /db_xref="GeneID:8919247"
     CDS             complement(198487..199176)
                     /locus_tag="HVO_RS00845"
                     /old_locus_tag="HVO_B0172"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041363.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-dependent phosphate transporter"
                     /protein_id="WP_004041363.1"
                     /db_xref="GI:490141015"
                     /db_xref="GeneID:8919247"
                     /translation="MANIQLTVIPTAAGTQGSVARYLATTYQFLPTVVGGSYTLGMVV
                     VRVVGGLVALVGTRALLHRDETAGINQFLVALGLVVVFTSGGTQVGLATGPLEAVFET
                     DLQLSSIYLLALGGGGILLGAWIRGPRLVQAVSNEYASLGPRRSIAALIPAFLIAQLA
                     IVLGIPISFNKVMIASIVGSGLAASSSGGSGVSPRKVGITIGSWVGSMLGAGVISYGL
                     YLLLNAAPVVG"
     gene            complement(200301..202289)
                     /locus_tag="HVO_RS00850"
                     /old_locus_tag="HVO_B0173"
                     /db_xref="GeneID:8919140"
     CDS             complement(200301..202289)
                     /locus_tag="HVO_RS00850"
                     /old_locus_tag="HVO_B0173"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600135.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="SMC-like protein Sph4"
                     /protein_id="WP_004041362.1"
                     /db_xref="GI:490141014"
                     /db_xref="GeneID:8919140"
                     /translation="MATTNRPARLTVAGIGGFDETTVAFERGVTVLTAGDAADRTSLL
                     RGLVTALGSDEHSPDCDADTDDSWVELAVEGERYVRTFAGEGDRVVASGDPYLDDPAA
                     ADLFAFLLGSNEARQAVTAERDLRKLVVHSVDIDAVNEEIADLRAERAELDDRIEALA
                     ALESERPGLRDRRDELDATIERLEAELADRQATLDGIESAAVDGDTDAEANPEPDANG
                     SDAEARQGRRRELYAALDDIEFELEAERESLDALDAEIDDIESELDSRPADPAAELDD
                     LTAELAESRARKRRLDADITDVQRTLQFNEQFLTSETSPVAAASEVERESESENDESD
                     GESDDGDSVVCWTCGTSVPEASIESTLDQLRALRDDRREERAELADRIERLQERRSEL
                     EALRERRRDLETRREELRRERAERRSRVEDLQARRDDVESDIVDLQRDAEDAEAGEGD
                     RAALLDAHREVNRVEFELERRREERDAVVDELEALDAELDRRTDFETRKDEIDDRIDG
                     LRDRIERLERATVSAFNDRMADVLDALEHDRLARVWVEHRNDGDGGDDALSTGRFVLH
                     IERRTDDGKTYEDVIDHLSESERELVGLVFAVAGYLVHEVSDDVPFLVFDSLEAVDAE
                     RVRRLLDYVRPHTDYLVVDVSGESARALSESYRRLRAL"
     gene            complement(202650..203291)
                     /locus_tag="HVO_RS00855"
                     /old_locus_tag="HVO_B0174"
                     /db_xref="GeneID:8919011"
     CDS             complement(202650..203291)
                     /locus_tag="HVO_RS00855"
                     /old_locus_tag="HVO_B0174"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004062021.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041361.1"
                     /db_xref="GI:490141013"
                     /db_xref="GeneID:8919011"
                     /translation="MSDSHDSPGGKRGPESKVSRLLRERGFDGFGAELERRWTAEAGA
                     RSSLRDLADAFNRRLLRAALDGRNERALDGEIETLYRVLTDDDVSSGARTKAVHRLER
                     TGVDVERLEADFVSHRAMRTYLTSYRGVTPPSETDRDDGDLREHRTETIRRLLGRVER
                     VTEKSLSDLAAADELDVDPETAEVYVDVRVHCPDCNAHYTVESLIDRGGCDCD"
     gene            complement(203412..204668)
                     /locus_tag="HVO_RS00860"
                     /old_locus_tag="HVO_B0175"
                     /db_xref="GeneID:8919311"
     CDS             complement(203412..204668)
                     /locus_tag="HVO_RS00860"
                     /old_locus_tag="HVO_B0175"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600134.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041360.1"
                     /db_xref="GI:490141012"
                     /db_xref="GeneID:8919311"
                     /translation="MDDESAEASEEPAGATHRYLPWAVAAGSAIPVVAQLAALPPDPT
                     TAALDLVGEGVVVAVLFACLFVVRRIRDPSVFYPLAGGVAASYLFALTDFLDEFVEQP
                     VWFSYLFEDGAQAVGAVLLVFGLYRWTVARQRRETELRQQREQLAVLNRVLQHDIRND
                     ALVIRGWASVVRKEAGSGADERLENIVAASNGIIDLTESTAQFTDVLTSDRAADLEPK
                     PLVETVETELQKVRAGYDADVVVAGDLPEVNVLAHSMLSAVFRNLLVTAVERADAERP
                     QVRLRADCGAETVTVRISDDGASFPEDALLDAGETVAETPDSRTGLSLVAALVEQFGG
                     SIAVENDPDGGTTVAVTLRTAEDSTESPTDRVAENAGDAESTPAGSPATSVGGDARDD
                     FAAVHSDRESSAGRGPSAGRGDAANY"
     gene            complement(204905..205864)
                     /locus_tag="HVO_RS00865"
                     /old_locus_tag="HVO_B0176"
                     /db_xref="GeneID:8919357"
     CDS             complement(204905..205864)
                     /locus_tag="HVO_RS00865"
                     /old_locus_tag="HVO_B0176"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008096793.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter permease"
                     /protein_id="WP_004041359.1"
                     /db_xref="GI:490141011"
                     /db_xref="GeneID:8919357"
                     /translation="MKYVDALTDISVTDIKVDLMRTAYDNEDALLNSFDPRVVLVWTV
                     LFMIIPWLFYDTLPLAILLAAAFVLAALSQVSKYLLALLLFGQVTNVGFFVVLVPLIG
                     GAMRAVGHLGDNAGRVVEGVTTGDVSVFAETGTIVAAAVGRGIHTATTSQEVGIDAVG
                     ALVPFFLKLTIISVISLAVFSAMSPQKLSKGMLRLGVPRQLTFAIAYGYRMMPLLVEE
                     YHALINSFRLRSKVPEKQGLFRWRYFSYLLTLSVKAFYPLIFNVAKRSRVNVEAMETK
                     GFSRSLGDEQSQALRTEGMMVRTRDVTFVFGSLLFVAAVWVFT"
     gene            complement(205861..207702)
                     /locus_tag="HVO_RS00870"
                     /old_locus_tag="HVO_B0177"
                     /db_xref="GeneID:8919062"
     CDS             complement(205861..207702)
                     /locus_tag="HVO_RS00870"
                     /old_locus_tag="HVO_B0177"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004062018.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalt ABC transporter ATP-binding protein"
                     /protein_id="WP_004041358.1"
                     /db_xref="GI:490141010"
                     /db_xref="GeneID:8919062"
                     /translation="MSSNNIVVEDLTFQYPGGDEAVLRDASVTIEPGEFTAVVGGNGS
                     GKTTLCKTFNGLIPHFFEGTFDGRVSVAGTDTRESDVAELSKTVGYVFQDFENQLVQE
                     TVRDDVEFAPLNHGLDDYAERATRALETLGLDHLEDRFIWELSGGQQHLVALAGVLAM
                     DPEFIFVDEPAAQLDPRNARETYEQLRRLNEERDKTVIVIEHHSEFIADYCDEMVLVS
                     DGGVAWKEPVEVGLNRLDDLLAHDIHPPQVTQIADGLPSEAGTLPSGRYPVTVDEAAT
                     AFQPATARGSRAAVDGGAVATAGADTGGAPTDGEQDRDALVTMRGVGHGYPTLREGYN
                     HVLDGLDLELHAGDRVALVGANGSGKSTLLRLLTGVESPDRGTVTVLGRDTSETLPEQ
                     LADDTVYIHQNPEEMFVEDTVRKDIAYYLENRDTPNVDDRVDEILAYLDLEHLADRDG
                     RLMSLGQQRRASLGIGLATDPTVVLLDEPTGSLDLQSRREVTGMLRKAESRVETVVVA
                     SHDLQLVAAWANRVLVMGEGEVLADAPPAAVFSDPDLLAETDLRQPQVVELSRRLGLE
                     SPALSTDAMCETLARSLGDDVVEAGGGGGIGEAGDSDDEAESDGGAR"
     gene            complement(207722..208528)
                     /locus_tag="HVO_RS00875"
                     /old_locus_tag="HVO_B0178"
                     /db_xref="GeneID:8919117"
     CDS             complement(207722..208528)
                     /locus_tag="HVO_RS00875"
                     /old_locus_tag="HVO_B0178"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041357.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049914748.1"
                     /db_xref="GI:909671394"
                     /db_xref="GeneID:8919117"
                     /translation="MAFILVMSLHGLQSMITELLPEFSIGGLGVSIGPFWFVAMSVVL
                     LFRSFWGCLAIPVGGIVFGEILIGDFSALGAVEGLIVITLSWFFAMSLITDPKNVKQI
                     AAVGFLAKAMEETAAWFIDVGKFYVGVEELEAISWLPETVWATEGIGALLQIIIAGVV
                     FGAIPTLFLYPRLRGKIEPLLGMSPVEGRDGPMFTRTSLKRLIAWVALIPVAFAFETL
                     SETSGGLVTFTPEFVETYGQAFLFVPIAIAAVISFGLVAYRQRKVDGLQD"
     gene            complement(208868..209665)
                     /locus_tag="HVO_RS00880"
                     /old_locus_tag="HVO_B0179"
                     /db_xref="GeneID:8919308"
     CDS             complement(208868..209665)
                     /locus_tag="HVO_RS00880"
                     /old_locus_tag="HVO_B0179"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600133.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="AP endonuclease"
                     /protein_id="WP_004041356.1"
                     /db_xref="GI:490141008"
                     /db_xref="GeneID:8919308"
                     /translation="MSEATPVQRPRFGASMDIRYADEVASFAGFLRRFDLNHVELRAG
                     YLDVQPGERDAERLRAVAEEFDVSYTVHGPHLDVAPGNVNERLRNAAVAATKEAIELA
                     AAIDAGGVIVHGGSVRTRYPDHVREHTREQAVRTLRECAEFAAEVGVPVCLENQRDKP
                     GTRRHTATPDRLAAFLDDVGVGDEFLKLTLDVGHAKATGVDYERFVERFGDRIQVAHL
                     HDNDGTEDAHEPLPSFRSVAADIDAPYNVLEMKSRADVERCVSGTDA"
     gene            complement(209658..210395)
                     /locus_tag="HVO_RS00885"
                     /old_locus_tag="HVO_B0180"
                     /db_xref="GeneID:8919220"
     CDS             complement(209658..210395)
                     /locus_tag="HVO_RS00885"
                     /old_locus_tag="HVO_B0180"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041355.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-phosphosulfolactate phosphatase"
                     /protein_id="WP_004041355.1"
                     /db_xref="GI:490141007"
                     /db_xref="GeneID:8919220"
                     /translation="MSADGRQTEPFVETLIEGCENIPAEPTPGDYVVVDVTHFSATVA
                     ELLALGAEYVHVTDERGDEPAYQEDHPDSLIGGGKTDDYEPNPGYDFFNSPSYVQQLD
                     LDGRPTAMTSTNGGRAVSTLRERGGSDVEVFVGGYTNAAAVADLLEARGRPVTIVASG
                     SSGQPTPDDTLGAALIDECLHGDGLTDRDRERYARLLVTAKGPRYEQKHEIRRRDLHE
                     FETAIDSRSVVPVLRGDRLVPASRVDV"
     gene            211074..211517
                     /locus_tag="HVO_RS00890"
                     /old_locus_tag="HVO_B0181"
                     /db_xref="GeneID:8919015"
     CDS             211074..211517
                     /locus_tag="HVO_RS00890"
                     /old_locus_tag="HVO_B0181"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600131.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Fjo21"
                     /protein_id="WP_004041354.1"
                     /db_xref="GI:490141006"
                     /db_xref="GeneID:8919015"
                     /translation="MTLATERLRRFKTPLRYAMGCLYVLAGVMHFVVPNAYAQVVPPV
                     FPAALALVYVSGVVEIALGVGVGVRRTQRVAAWGLIALLIAVFPANVYMATSDIVLDG
                     VPAAFREPSDAALWLRLPLQGVLVAWAWWYTRPESVEADESRSVR"
     gene            211615..212589
                     /locus_tag="HVO_RS00895"
                     /old_locus_tag="HVO_B0182"
                     /db_xref="GeneID:8919290"
     CDS             211615..212589
                     /locus_tag="HVO_RS00895"
                     /old_locus_tag="HVO_B0182"
                     /EC_number="2.5.1.46"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572731.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyhypusine synthase"
                     /protein_id="WP_004041353.1"
                     /db_xref="GI:490141005"
                     /db_xref="GeneID:8919290"
                     /translation="MTEDDTHDRVVPGSDEAIDSADVRGYDFDGAFDFDEFLDAYATT
                     GFQATQLAEAIDIAEEMQEADATVYLTFTSNIVSSGLREAVAYLVREGFVDVLITTSG
                     SLTEDVIKTAKPFKMGSWDADEGELRERGINRLGNIYVPSDRYVWLEQYLYDFFEDFF
                     AEEKVRTPTAFARELGATLDDEHSVLKQAADNDVPVYCPALTDAEVGNFLYYYRQGYD
                     KEVGIEILDDYDSLIQDGLLADETGLIAVGGGVPKHHAIMTNLFRGGADYVVYISTGM
                     EGDGSLSGAPPNEAVSWGKVKDHDTNYTQVEAEATLVFPLLVAGAFKN"
     gene            212651..213388
                     /locus_tag="HVO_RS00900"
                     /old_locus_tag="HVO_B0183"
                     /db_xref="GeneID:8919355"
     CDS             212651..213388
                     /locus_tag="HVO_RS00900"
                     /old_locus_tag="HVO_B0183"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041352.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="racemase"
                     /protein_id="WP_004041352.1"
                     /db_xref="GI:490141004"
                     /db_xref="GeneID:8919355"
                     /translation="MNEDDAVGGELRTVGILGGMSSQSTVEYYRLIDEGINDVHGGHH
                     AAELLIRSVDFGTVERYIRTERWDDAADYLAAAATDLEAGGADFVVMATNTMHRVAPR
                     IEAALSIPFLHIVDAAADAILADGLETVGVLGTRATMDGAFYRERFEEHGIDVIVPEE
                     SRRDEIDRIVFEELTKGEIREASRDYYLKAVDQLVERGADGIVLGCTEIELLVEQADR
                     PDVPLFDTTALHVERAVERSLAGRVDG"
     gene            213673..215244
                     /locus_tag="HVO_RS00905"
                     /old_locus_tag="HVO_B0184"
                     /db_xref="GeneID:8919111"
     CDS             213673..215244
                     /locus_tag="HVO_RS00905"
                     /old_locus_tag="HVO_B0184"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034939.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013034939.1"
                     /db_xref="GI:502799963"
                     /db_xref="GeneID:8919111"
                     /translation="MNEARPLRRRTVLSVLTAASLGGLAGCLGGADDSAPDASENEST
                     TFRVGTQWNPDSLDPLVKGWVFRKLSVIEPLVITDYDASVAPGLATDWSATDESRQWE
                     FTLRDDVTFHDGTPLSAALAVESLRRSFASTSLAGLPVESVSAADDRTVRIRTERPFA
                     PLPAHLTRAETSIVSSESYDDDGAVTELIGTGPFRFDSWEPGERITAVAFESYHGTVP
                     SIDELVYERVADEQTRLLKLENGELDMARQLSTETTPGLEAHDHLTAYEYEVPRTRYL
                     VFDTTSTPFGDREVRRAAMYALDRAGIVESVLNGGGPAAVGPYPPELTEWANEDLEPY
                     AYDPEKARELLEAAGWKATESGRVRDGEPLEIELWTYDAWSLPIVAQVVQEQLSAVGF
                     DVSLRQLAYSTIRERANRDSFDAVLWSNSLLWYPDPDRLADFVHSTEATMFSGYENER
                     VDRLLEAARTTTHRAERKRRYDEVQAIAQRDVPIGWVTHVTNVVGTSADVEGYRPLPT
                     ETCYHLEDVTHQSRA"
     gene            215327..216271
                     /locus_tag="HVO_RS00910"
                     /old_locus_tag="HVO_B0185"
                     /db_xref="GeneID:8919059"
     CDS             215327..216271
                     /locus_tag="HVO_RS00910"
                     /old_locus_tag="HVO_B0185"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034969.1"
                     /note="with GsiABD is involved in the transport of
                     glutathione into the cell; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione ABC transporter permease"
                     /protein_id="WP_013034969.1"
                     /db_xref="GI:502799993"
                     /db_xref="GeneID:8919059"
                     /translation="MSRHLLRRVGGAVLVLFGVSALTYGFVFLTPGDPAVAALSQQLG
                     HQPSAAAVEQFRATHGLNRPLPVRYADWLSEVARGDFGTSYQSGRPVRSMLVQRLPNT
                     VELAVASTVVAVAVAVPAGVTSAVRAGGYVDDLTRVASLVGVSMPNFWLGYLLIIGGA
                     LQLGLFPVSGAGDISHLVLPAVTLGSGMAGVIARLVRTSILDTLGTEYVRTARSKGLH
                     ERVVVYKHAFRNALVPVVTVIGLQFGYVLNGAVVVEAVFQRPGLGTLLVDAVFARDYP
                     VVQGVTLLVGVAFVSVNLLVDLTYRYLDPRIDIGGTRP"
     gene            216268..217164
                     /locus_tag="HVO_RS00915"
                     /old_locus_tag="HVO_B0186"
                     /db_xref="GeneID:8919221"
     CDS             216268..217164
                     /locus_tag="HVO_RS00915"
                     /old_locus_tag="HVO_B0186"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nickel ABC transporter permease"
                     /protein_id="WP_004041349.1"
                     /db_xref="GI:490141001"
                     /db_xref="GeneID:8919221"
                     /translation="MNGTDESVASEAERGWRRWYAALATNRAARVGGLIVVALVVFTA
                     FGPLLWPRDPVEQHLVHRLEPPSLAHPLGTDRLGRDVLARLLHGARLSLGVAVVVTGV
                     RLALGTAVGLVAGYVGGWVDAALMRLLDTLLSFPGIVLAIVVAGIRGPSLLNAMVALA
                     VVGWASYARLVRSTVLSVREREFVAASRLLGSSRLHVIRRHVLPSVVGPVVVLATLDV
                     GGVILGAAGLSFLGLGVQPPTPEWGAMLAGGRNHLRDAWWLVNAPGGMILLTALGFNL
                     LGDGLRAALSATESDRVERERA"
     gene            217538..218686
                     /locus_tag="HVO_RS00920"
                     /old_locus_tag="HVO_B0187"
                     /db_xref="GeneID:8919278"
     CDS             217538..218686
                     /locus_tag="HVO_RS00920"
                     /old_locus_tag="HVO_B0187"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_013034961.1"
                     /db_xref="GI:502799985"
                     /db_xref="GeneID:8919278"
                     /translation="MVSTRRSFIGGSAAAVAGLAGCLTTSSSEGDADATGSGGGDAET
                     YEVGYRDFQTNIEATAFPDMLYFYCVQSGWMNWPSLMQSFEDSYGVAVHDDDRSSGEA
                     LQHMRSHSNNVTHSGYNGGYTYGIVARNEGFTQAYKPQGWDKVPDSLKTDDGHVTATR
                     RVTTAVTYRKDIYEERGLDEPTTWEDLLQPELMQDLALQTPQAAVGLAAALSINNARG
                     GSMNDLQPVIDYYERIQEGGAEFTDNFLAQFSRGEYATFIRYDYSGLDLKYNNDEVAE
                     ENVGVALLGGENGNKGALNMPYGYALLEGAPNPAAGKLFMDYVLSLEGQQQFLDAYVR
                     PIRSSELELPEEFIDPAEYDRTEFQVDYGQLVDQQEDIIQEITRGANI"
     gene            218689..219627
                     /locus_tag="HVO_RS00925"
                     /old_locus_tag="HVO_B0188"
                     /db_xref="GeneID:8919154"
     CDS             218689..219627
                     /locus_tag="HVO_RS00925"
                     /old_locus_tag="HVO_B0188"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041347.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease"
                     /protein_id="WP_004041347.1"
                     /db_xref="GI:490140999"
                     /db_xref="GeneID:8919154"
                     /translation="MSDRHAENSSLSTVRALTARVVGAVETVANPVTEREREYRRIVA
                     LCAPFAALVLVAGLYPLSEVVRISVSTAQYRSVGFSLDAYATLFGDPYYRRVAFDSLW
                     LTTGTTLVSVGLAVPIAHALEKYDLPGEDLLVTLVSFPISLPGIVAAFMILVLFGNNG
                     VVTAVAAALTGSRPTDLAFAVSVPGLFVAFVYSMVPRATLILRGTYAEVDSAAEEAAQ
                     ALGATPFETFRYVTLPQIRPGITGALILTFRTGLAIFGTLVVIQTLVVWTLQLSRELG
                     VGYDVQVAGAMATVYFAFTFLFTVLGLRYTSAEVGI"
     gene            219624..220517
                     /locus_tag="HVO_RS00930"
                     /old_locus_tag="HVO_B0189"
                     /db_xref="GeneID:8919240"
     CDS             219624..220517
                     /locus_tag="HVO_RS00930"
                     /old_locus_tag="HVO_B0189"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572738.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease"
                     /protein_id="WP_049914740.1"
                     /db_xref="GI:909671386"
                     /db_xref="GeneID:8919240"
                     /translation="MRPSPSPSLSRRLGRSVVALTLFATVAFLIAPIVLTVVASFAAS
                     WTGVLPSGFVTFENWRAVLGLADTIGSQRSMGWSPLFRLPLGGETLTVLVPAELAFSI
                     GLALGGVLINLVVGVPIAYAVARYEFPGREWVNAVSVLPLVPGVILGVAFLRAYPDLS
                     ATSFGLIVGYSLLKAPFMVMAVQSEFESMPLRQLEESARSLGASWPRTFLTVIVPNAR
                     SGIVSGAIICWALAAAEFNFSYIVWANGTQPLALFLQRHISNSSFTKAAAAVSMFFFI
                     IVAVTLLLQRVGRRGFDIRGS"
     gene            220517..>221218
                     /locus_tag="HVO_RS00935"
                     /old_locus_tag="HVO_B0190"
                     /pseudo
                     /db_xref="GeneID:8919347"
     misc_feature    220517..>221218
                     /locus_tag="HVO_RS00935"
                     /old_locus_tag="HVO_B0190"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_015764182.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
     gene            221606..223030
                     /locus_tag="HVO_RS00940"
                     /old_locus_tag="HVO_B0191"
                     /db_xref="GeneID:8919067"
     CDS             221606..223030
                     /locus_tag="HVO_RS00940"
                     /old_locus_tag="HVO_B0191"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041343.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041343.1"
                     /db_xref="GI:490140995"
                     /db_xref="GeneID:8919067"
                     /translation="MASPRYDDASPSSLPAGIGFLPVLSANLLPLVGVLWFGWNPETL
                     LAVYALELLLLFPLSGVKALFAGRPPTSSREGGVLNRSESDLVDKRGSVTIHDRLPPV
                     YPRNVPFATAVVGGGAWVGVFLLAPLSEVVSVLDVLARPEAVVSVAALVVGQVGETAA
                     AFLRGDRYAERSPYALVEIPARQAMFLACFLFVVVLGGATVALAAFVLVKLLFEWSGF
                     RADRGGGRLTSWLAGPDSEATREALDVPDGRPAAEIDVDRRAVVAAAVWRAVTTTGPF
                     YVTMAAMVWIGGTAFVAEEASLAVWVGFGLFGLALLGFMLAGDVVEDTLASGWLTYRR
                     FGGRLVAHDRLTGEPQWAAAVGDFRDAEVVAARPTDRYLGTRTIAATVGRGDDETERA
                     FGPVADAERVVEAFDLPVESTTLPPLDRRFVWAAVASVVLTAVGVVTVVVTPLGPSTS
                     WLLALFLFPAFAIVPKGFWKLAHS"
     gene            complement(223140..223451)
                     /locus_tag="HVO_RS00945"
                     /old_locus_tag="HVO_B0192"
                     /db_xref="GeneID:8919151"
     CDS             complement(223140..223451)
                     /locus_tag="HVO_RS00945"
                     /old_locus_tag="HVO_B0192"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041342.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041342.1"
                     /db_xref="GI:490140994"
                     /db_xref="GeneID:8919151"
                     /translation="MATLSAVLDWLIVSLALGSTLVGSYVGYQAYRGYRRHDSRTMRA
                     LSAGLFLLTAVAFGVAFVGSVLLRQGYIGLQYQQPLTLVTRLFQFCGVVLIAYSLHSR
                     G"
     gene            complement(223453..223824)
                     /locus_tag="HVO_RS00950"
                     /old_locus_tag="HVO_B0193"
                     /db_xref="GeneID:8919133"
     CDS             complement(223453..223824)
                     /locus_tag="HVO_RS00950"
                     /old_locus_tag="HVO_B0193"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041341.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041341.1"
                     /db_xref="GI:490140993"
                     /db_xref="GeneID:8919133"
                     /translation="MSEDPALGDILDLLSDEYARDILAATSTKPMSAQELADECEMSK
                     PTVYRRVERLQAYGLLDEQTEIRTSNNHYSVYTATLSEFSVALDDGSFEASLTRTDDE
                     SFPGEGESDTADRFKRMWEDL"
     gene            complement(224177..225361)
                     /locus_tag="HVO_RS00955"
                     /old_locus_tag="HVO_B0194"
                     /db_xref="GeneID:8919226"
     CDS             complement(224177..225361)
                     /locus_tag="HVO_RS00955"
                     /old_locus_tag="HVO_B0194"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041340.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041340.1"
                     /db_xref="GI:490140992"
                     /db_xref="GeneID:8919226"
                     /translation="MTRPPLRLNRRTLAAFVLVAVALSAVLWTTGGAIGDASPAVDAN
                     VTERYRGIDALTGTQTVEVRADDTVTSRTVADVTLVPETERKRVNFRNAANRQYDRQV
                     SNGSTLWLHETDRDAVTVIELTGPPTESRTAERLQLLVAAAGLTDDAGRPQSIGVSPL
                     PVVPRHAGVAPGADANRSYTVEFVETDTVGGREAYVLDIVPETNRSEAGYRQRLWLDT
                     ERFYPLRKQTAWTADGTRRSVTTTYTNVTFDAAVSADTFRPDIDAGTTVERQETPNTS
                     WFRSRADLVARSSISVPEPTVPSAYELVYATRTTGRIDGVGLRYAAGGRELTVAKFNY
                     TLDIDADERDATVGGRPATIDYGPTTSVSWNCDGYGYTVRGTGVETDRLVEVGRSVGC
                     PA"
     gene            complement(225456..225641)
                     /locus_tag="HVO_RS00960"
                     /old_locus_tag="HVO_B0195"
                     /db_xref="GeneID:8919350"
     CDS             complement(225456..225641)
                     /locus_tag="HVO_RS00960"
                     /old_locus_tag="HVO_B0195"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041339.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041339.1"
                     /db_xref="GI:490140991"
                     /db_xref="GeneID:8919350"
                     /translation="MYGRKRRRPVVESPVSESSNERRLGDERLHQTHWRAQTNARVRV
                     EGVVEGDISDPSRALRV"
     gene            225692..226651
                     /locus_tag="HVO_RS00965"
                     /old_locus_tag="HVO_B0196"
                     /db_xref="GeneID:8919077"
     CDS             225692..226651
                     /locus_tag="HVO_RS00965"
                     /old_locus_tag="HVO_B0196"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="signal transduction histidine kinase"
                     /protein_id="WP_004041338.1"
                     /db_xref="GI:490140990"
                     /db_xref="GeneID:8919077"
                     /translation="MSSERRELFEHIESDLILREFFQEVTEYAIFLLDADGYVATWNE
                     GARRIKANRKEREERLMVLNRMLRHNLRNNLNIVSGYARELRRDLDAVDLPTEKGDYD
                     QLAETVTNLSETTSGIDAELRALDEIVTAASQFSVEAMVSKTDRIIENADDLMSTGEK
                     ARRFENVVEESTDKQPVRVDDVLSDIKRTYERRYPDATIRFRAGEQTVLASAHSLSLA
                     LDELVQNAIVHNDEDDPVVTVASCRISGERVEITVEDNGPGIPQTEREILERGEETPL
                     SHGSGMGLWTVSWFVTQFDGEVSIVDRAGGGSTVEVRLPTPEH"
     gene            complement(226697..227809)
                     /locus_tag="HVO_RS00970"
                     /old_locus_tag="HVO_B0197"
                     /db_xref="GeneID:8919036"
     CDS             complement(226697..227809)
                     /locus_tag="HVO_RS00970"
                     /old_locus_tag="HVO_B0197"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041337.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter permease"
                     /protein_id="WP_004041337.1"
                     /db_xref="GI:490140989"
                     /db_xref="GeneID:8919036"
                     /translation="MSKVTDAVGAVRAEWRDRYADSMLALVIVGSLAVLLGATLLQVS
                     FGAYPLTLSEAWGAVFDSAVVFDADVWRAFLLGGDIPEWFTQRQFVVWNIRLPRVLVG
                     VLVGANLAVSGAIFQVVTRNELASPYVLGISDGAGLVVLVTLTFLSGLLPLMPVLAAV
                     GGAIAFLLVYLIAWKNGTSPVRLVLAGVVVGTVFGSVQRAMFFFINDLGVVMSAQAWL
                     SGSLLGTDWAQVRIALPFTIVALGLALAVTKELDVLLLGEETAQSLGMPVEKVRFAVA
                     GIAILSTAAAIAVAGLVGFVGLIVPHMVRNLVGSNSKRLLIGCAFLGPALLVGADVGA
                     RLALSPIQLPVGIITGLVGGPYFLYLMRKKEDIGSV"
     gene            complement(227816..229012)
                     /locus_tag="HVO_RS00975"
                     /old_locus_tag="HVO_B0198"
                     /db_xref="GeneID:8919112"
     CDS             complement(227816..229012)
                     /locus_tag="HVO_RS00975"
                     /old_locus_tag="HVO_B0198"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041336.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="iron ABC transporter substrate-binding protein"
                     /protein_id="WP_004041336.1"
                     /db_xref="GI:490140988"
                     /db_xref="GeneID:8919112"
                     /translation="MVRRRQILAGSAGLFASALAGCTAGGSADSESTAAAESETEAAT
                     ESTTTEQTTESAGQYTVEIEPNDPYTFEAVPETYGVASGPFLDMGMALGIHPSATTGL
                     ERAPLKFYDLLGLEFDESRITKLASGAESGFDKENFYAADADVWLIARATLGRYVSWD
                     ASDYEEVESQTGPFLGTTLRFAPTAAVSNEPNPYTLYEAFEKVATVFQRRQQFQAWQS
                     FHDDLMSTIEAGLPPEDERPTVAAIWRGVSPDSGQFRVAPLHRLGNNTKSYFRVGMKD
                     AFEGRYPEGPIGYEELINVDPDYIGAVGALTSSTREEFVDTVVEPFENNESGQRLTAV
                     QEGNLIRSAGQYMGPIVDMFSTEAVAKMVYPDQFGEWPGAVGDVPEDEQLFDRERLVD
                     IVNGNF"
     gene            230208..230630
                     /locus_tag="HVO_RS00980"
                     /old_locus_tag="HVO_B0199"
                     /db_xref="GeneID:8919055"
     CDS             230208..230630
                     /locus_tag="HVO_RS00980"
                     /old_locus_tag="HVO_B0199"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041335.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="deoxycytidylate deaminase"
                     /protein_id="WP_004041335.1"
                     /db_xref="GI:490140987"
                     /db_xref="GeneID:8919055"
                     /translation="MRESFELARKAAARGDEPFGSVLVRDDEVIMRDSNRIVTESDIR
                     RHPELQLAYRACREYDADERAAMVMYTSTEPCPMCAGGMATAGFARVVYGVGGDEIGE
                     FTGSNPGVRSAAVLDAVTEVVGPVLNDEARRVHREYEW"
     gene            231494..232804
                     /locus_tag="HVO_RS00985"
                     /old_locus_tag="HVO_B0200"
                     /db_xref="GeneID:8919141"
     CDS             231494..232804
                     /locus_tag="HVO_RS00985"
                     /old_locus_tag="HVO_B0200"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041334.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="WP_004041334.1"
                     /db_xref="GI:490140986"
                     /db_xref="GeneID:8919141"
                     /translation="MSSDRNYEREFVRTFFTSPTAVSGENSAKMLQSAAQLRGMQAPD
                     TWIPDNEDATAPSMRAEGVQNLVEVVSEHGADFPGEIHPRVVWHRDDPSTRYEGFKQM
                     LEITDPENGAVEHIDGFVIPEVGDLDDWKKADEFITIIEHEHGLDEGSLSMSVIIESG
                     EAELAMSDLRAEKGKPSNNLERLFLLVDGQVDYTKDMRAMTPTGELPAWAELRHNTSR
                     GASAAGCIAVDGPYDDIRDVEGYRERMVENRAMGMTGIWALTPGQVVTANEAPLPPKT
                     GSWLLELDDDEIELDAEDGRQVYDGDELSLEQVGDDSYVLRVDGEEQELDAEELHEEL
                     LDLTTYVPSMDDIVDSMEEFEAAKEAGKGAIAMTQATTLVIDGVEVDIAKDRMWDEAT
                     YQAAMTPVALFQDVYEHRPDQHDALEEMYGEGIVERAMAVGTDD"
     gene            complement(232885..233649)
                     /locus_tag="HVO_RS00990"
                     /old_locus_tag="HVO_B0201"
                     /db_xref="GeneID:8919223"
     CDS             complement(232885..233649)
                     /locus_tag="HVO_RS00990"
                     /old_locus_tag="HVO_B0201"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572761.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArcR family transcription regulator"
                     /protein_id="WP_004041333.1"
                     /db_xref="GI:490140985"
                     /db_xref="GeneID:8919223"
                     /translation="MIENVTGRRLKTTQASLEILSLILEHDGLTLAELDTMVDSSKSS
                     ICSHLNTLLESRYLVKRDGVYRVSFRVALLGERARHRYPSDEVVERVVDELADATGQE
                     ANFTIFEHGRLLMCYGSSTDEGRDANGIRYRSEYHLHNTAAGKAILSELDRDEVASIV
                     DHWGLPRESEGTITNADRLFDALDEIATQEYAVVDEEFAPNLIAVGAPVHDGDGRIVG
                     GLSVGGPKYQVDMTRLEREFADELLNAVESLEAALS"
     gene            complement(233832..234713)
                     /locus_tag="HVO_RS00995"
                     /old_locus_tag="HVO_B0202"
                     /db_xref="GeneID:8919243"
     CDS             complement(233832..234713)
                     /locus_tag="HVO_RS00995"
                     /old_locus_tag="HVO_B0202"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PAS domain-containing protein"
                     /protein_id="WP_004041332.1"
                     /db_xref="GI:490140984"
                     /db_xref="GeneID:8919243"
                     /translation="MARAIPTASKTEVDQLLASLQRLTGIGVWSYDVSRDELWWSDEA
                     KRIHGFDAAATPTVSDVVEQYAEGDQDGVLVRLGDAIEHGEPFAIDVRYASERTTERS
                     IRLSCDPLVEDGQTVTLYGVVRDVTDTKRQEQRIEILRRTSQELRNASSKAEVAEILA
                     DAAKNVLGLVNTTVRLVDENRNMLQTIEATEECLERAGDRPNYSVSEDTPAARTYRTG
                     EPVIHANHEHTEDDHSRGALQSGLYVPIGSHGVLSAGDVVVDAFEEHDLEAAGLLGQL
                     GAEAITRIGWVKRSRAI"
     gene            234870..237893
                     /locus_tag="HVO_RS01000"
                     /old_locus_tag="HVO_B0203"
                     /db_xref="GeneID:8919027"
     CDS             234870..237893
                     /locus_tag="HVO_RS01000"
                     /old_locus_tag="HVO_B0203"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_049941484.1"
                     /db_xref="GI:909698247"
                     /db_xref="GeneID:8919027"
                     /translation="MAVEDVLDSPRGGETSATTLDVDRPDATAYTALATELRDRVDGD
                     VKFDEYAQVLYATDGSIYQARPAGVVLPRDADDVRATVETGANHGVPVLPRGTGSSLG
                     GQTVGRGCVVIDFTKYMDDIVDIDPQARRATVQPGCVQDHLDAALADHGLKFAPDPAS
                     SNRSTVGGGIGNNSTGAHSVRYGITGAYTEELEVILADGSLIHTREVVLDSDEYDSIL
                     AQDDLEANIYRTVRALVENHESEIENKYPSLKRSVSGYNLQKVIYENDDGEAVINLSK
                     LFVGAEGTLGVIVEATVSLVTKPDETALALYCFDDLVDAMEAVPEALEFPVSAVELMD
                     DEVFRLARESEGYAEYAEPIPEGAKAALMLEWDDELVDDFEAAVADTNAHFVDSGAAF
                     DVLEAYSEESQGRLWKLRKAAIPLLMSLEGDPKPYPFIEDATVPPEELAEYVQKFEDV
                     LENHGTSAAYFAHAGSGTLHIRPILNLKENEGIEKMHSITDDVTDLVVEHHGAFSGEH
                     GDGMARTEFNPKMYGPELWGAFKELKTAFDPDWLFNPGNVVYRDGPSDPGPDSDRGVG
                     ADMRENLRYGPDYQSVEPQTDLDFDDEGGFSHLVELCNGCGTCRQTDSNTMCPTYRAS
                     KEEVQTTRGRANMLRAAISGELPEDELYSERFQTEVLDLCVGCKGCQSDCPTGVDMAK
                     LKSEVKHQYHQKEGTSLRSRVFANVDTLSKLGSKLAPLSNVAAELPGSRLLLEKVLGI
                     ASERDLPSFSSESLEEWFEARGGSSVPPAEARGKVLLFPDTYTNYNYPEPGKAAVEVL
                     EAANVHVRIPSDLESSGRAAFSMGMLDTARDRARHNVGRLRPYVDDGWSVVFVEPSDA
                     VMFQDEYLDLLDGTAVELVSGSAYGVMEYLDAARADDHLDFDASAETLTYHGHCNQKA
                     TNKDHHAVGVLRRSGYAVDPLDSSCCGMAGSFGYEEEHYELSKGIGEILFGQVDDSPG
                     DVVTAPGASCRSQLGDRPGESRPPHPIEKMAEALD"
     gene            238093..238698
                     /locus_tag="HVO_RS01005"
                     /old_locus_tag="HVO_B0204"
                     /db_xref="GeneID:8919334"
     CDS             238093..238698
                     /locus_tag="HVO_RS01005"
                     /old_locus_tag="HVO_B0204"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971785.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041331.1"
                     /db_xref="GI:490140983"
                     /db_xref="GeneID:8919334"
                     /translation="MLDVLETVELSTAFFASLGAPGLLLVAFLEFFLLPVPPDLVLVP
                     LSATNPEFALPYAVVATVGSVSAGLVGFLMGKKGGRRALDSRFAGERIHKVERYFERS
                     GFVTVAFGAFAPIPEGYELLSIGSGVFDLDLRTYLAASVLGRGSRYTIEALLAVYLGE
                     AARSLTEVDVYSIIGVATAVVLVAYVVRNRWFSDRSAEPVQ"
     gene            complement(238715..240370)
                     /locus_tag="HVO_RS01010"
                     /old_locus_tag="HVO_B0205"
                     /db_xref="GeneID:8919198"
     CDS             complement(238715..240370)
                     /locus_tag="HVO_RS01010"
                     /old_locus_tag="HVO_B0205"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008578718.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="LccA multicopper oxidase (MCO)"
                     /protein_id="WP_004041330.1"
                     /db_xref="GI:490140982"
                     /db_xref="GeneID:8919198"
                     /translation="MSAASPTLEKFVQPLPIPSVREPDGQRDGADAYEIAVTEFTQQL
                     HPDLPETTVWGFDGSYPGPTIEADAGSPVHVRFDNSGLPSEHLFPVDDRLGGTTAENH
                     PGYDGPVPEVRTVTHFHGLELDPANDGQSDMWTSPGGVEGPRFDSAWQELPMEQGRTT
                     STYHDHTLGITRLNAYAGLLGLYSITTDAERELGLPSGDYDIPLLLQDKEFNDDGSLH
                     YPEEFVSAFLGDTAVVNGAVWPYVEVEPRRYRFRILNGANHRSFDLQLESESGSGVPT
                     MYQFAPGHGFLESVVPIGPNGDLDSLLLTPFERGELVVDFSDHAGETLTLANGADMGP
                     ELTDLVEFRVSDPSTPPEDASADPTSLSLPTPASYDESDARVTREMTLGTEVRNGLIT
                     HTLNGHVFGDEDAPVYPQLGATEIWELQNESGGRHPIHLHLVTFRVIGRGPDGTQPPD
                     PNELGPKDTVRVDPGERVRILVTFEGYTGQFPWHCHMLEHEDNKMMIPFVVENPVADY
                     ANEENVVDATGLTDAVGDWRNETLETEVLLEVIDQWRSGDEVA"
     gene            complement(240590..242221)
                     /locus_tag="HVO_RS01015"
                     /old_locus_tag="HVO_B0206"
                     /db_xref="GeneID:8919258"
     CDS             complement(240590..242221)
                     /locus_tag="HVO_RS01015"
                     /old_locus_tag="HVO_B0206"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034958.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049941485.1"
                     /db_xref="GI:909698248"
                     /db_xref="GeneID:8919258"
                     /translation="MVGSLGLGAAIAPVAADAHGGTLTRTVDESSLAPGESTTVTVAI
                     NASERGNFTVVEELSPGFASVEIVDADGADFSGVRDGNDELFATYGDRENVTLVYEVT
                     AADNATATTHDLTGYGDFGLEDIRASTTGDEEISVSSDAGASVVRSVDEATLEPGEST
                     TVRVEVNRDRAANFTLVEAFTPAFDSVAIVDADGADFSGVRDANDELFATYGDRETVS
                     LVYEVTAADDGDAGTAYQFDGFADVNGSEAATGGTDELDVQSGSDDDDNWDLTRSVDD
                     ETLDPGESAVVSVEITGDEATNFTVVEEFNPGFASVEIVDADGADFSGVRDANDELFA
                     TYGDRENVTLQYRVTAGEDVDEDASYRLNGFTQFDADGKEMSVDGVETLAVGSDDDAG
                     GGGGGGGGGSDDDDDDRDDDDNDESDDDDTDDGNSDTPESTDSPDDGDDDDTGDDSDD
                     SNDGDDDSGDSDDSNDGDDDDTGDDSDDSNDGDDAGDGSDGSDGDSGGTPETTTDDNT
                     PATTTTDTPVPGFGVSVALAALVIGSVLLARRRAT"
     repeat_region   241194..241300
     repeat_region   241935..242041
     gene            242151..242483
                     /locus_tag="HVO_RS01020"
                     /db_xref="GeneID:25143365"
     CDS             242151..242483
                     /locus_tag="HVO_RS01020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049921804.1"
                     /db_xref="GI:909678450"
                     /db_xref="GeneID:25143365"
                     /translation="MSVPPWASAATGAIAAPSPSDPTTRRAAITTTGSARRTSDDSLG
                     RELSGLMVSERGSVPTGHSFRERRAKRPSGASIRPGGSRSCDGSRPPAVSVRLVGLET
                     GVSGARYL"
     gene            complement(242688..243539)
                     /locus_tag="HVO_RS01025"
                     /old_locus_tag="HVO_B0208"
                     /db_xref="GeneID:8919076"
     CDS             complement(242688..243539)
                     /locus_tag="HVO_RS01025"
                     /old_locus_tag="HVO_B0208"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="WP_004041327.1"
                     /db_xref="GI:490140979"
                     /db_xref="GeneID:8919076"
                     /translation="MVQLAFSTNAYTRFDLPEAIRRIADHGYDGVEILADVPHAFLAD
                     FDERDRERVLTALDETGLSVSNVNANTTRGYYDDAPPSAFFDPTLISGDEEDRRWRID
                     YTKAALDFAALVGAPAACVASGSALPGTPPDEAYDHLLDSLDELTDYAERVGVDLGIE
                     FEPELLVEDTEEVLTLIDDVGSDALGVNFDVGHAAVCGEDPAESIRQCAGRITGVHLE
                     DIAGGRGGKHYHLVPGEGDIEFDPVFGALDDIGYDGFATFELYTYPDDPDDAARRARD
                     ELADYVR"
     gene            complement(243635..244597)
                     /locus_tag="HVO_RS01030"
                     /old_locus_tag="HVO_B0209"
                     /db_xref="GeneID:8919368"
     CDS             complement(243635..244597)
                     /locus_tag="HVO_RS01030"
                     /old_locus_tag="HVO_B0209"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572776.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041326.1"
                     /db_xref="GI:490140978"
                     /db_xref="GeneID:8919368"
                     /translation="MNRTNATPATGGLRRSLSSLARLVRVPNLFTAPPDVILGAVLVS
                     GGRPAVPLSSLAGTALASVLLYAAGTTLNDYADADEDARLRPERPIPSGDVSRTRARN
                     LGLALLGAGVVVAAAAGGPTAGIVAAVLGSFIALYDGALKGTPLGFAAMGGCRGANVA
                     LGMAVVAGSPSAPTTLTLPAWVFFVPVVVALYIAGVTYMAERETGAGDSRAVLVGMAG
                     VGLAVGSVVAAGAAVGVGPSDTATVVVAGGLLCWFAAWTGRDLLTAYADPRPSTIGPA
                     VGACVLGLVVLNGALSGLLTPVWGVVAAAFVVPAVGLSSAFDVS"
     gene            complement(244643..245518)
                     /locus_tag="HVO_RS01035"
                     /old_locus_tag="HVO_B0210"
                     /db_xref="GeneID:8919301"
     CDS             complement(244643..245518)
                     /locus_tag="HVO_RS01035"
                     /old_locus_tag="HVO_B0210"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600116.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="WP_004041325.1"
                     /db_xref="GI:490140977"
                     /db_xref="GeneID:8919301"
                     /translation="MEFGFSMNAFRQRTLTEGVEAIADAGYDGVEILLDDPHLFPGTA
                     DGDDFERVRTLLDDCGIEVSNCNAFMLSAIEPSAASRAATFNRDTEAFHHPSFVELAA
                     EDRQARVEHTQNALATAAALGADSISVPPGGPVPERMTRADALDAFVRGLREVADTAE
                     KLGVDVLVEPEPHLLIETPEDFLDLVDRVDSPRIGCNFDAGHFYSVGEDPVELVETLE
                     PHTPHYHLEDIPADRTHEHTQLGEGAMDIDGFLDAVEATGYDGHVTVELYPYQETAAE
                     TARTAMEYLEAHGWT"
     gene            complement(245522..246322)
                     /locus_tag="HVO_RS01040"
                     /old_locus_tag="HVO_B0211"
                     /db_xref="GeneID:8919192"
     CDS             complement(245522..246322)
                     /locus_tag="HVO_RS01040"
                     /old_locus_tag="HVO_B0211"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase TatD"
                     /protein_id="WP_049914744.1"
                     /db_xref="GI:909671390"
                     /db_xref="GeneID:8919192"
                     /translation="MPIIDPHMHMVSRSTSDYERARLAGVECCVEPAFWSGTDKQHAA
                     SFFDYFEQIIEFETDRAERAAGIDHYVTVGLEPKEANYPEMAEAVMDGLPEYLDREHV
                     VGLGEIGLDQGTEAEEYAFRRQLRMAEERELPVIIHTPHTQKPEGTERLVEMIQDEDV
                     TEERIVIDHNTENTVDISLQTDCWLGFTLYPGKIDAETTIDILEEYGTDRMLLNSAAD
                     WDPSDPLAVPKARDKMLDRGWDRDEVRKVVCDNPREFFGQSPNFHYEL"
     gene            246483..246692
                     /locus_tag="HVO_RS01045"
                     /old_locus_tag="HVO_B0212"
                     /db_xref="GeneID:8919095"
     CDS             246483..246692
                     /locus_tag="HVO_RS01045"
                     /old_locus_tag="HVO_B0212"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041323.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Zn-finger-containing protein HypA/HybF (possibly
                     regulating hydrogenase expression)"
                     /protein_id="WP_004041323.1"
                     /db_xref="GI:490140975"
                     /db_xref="GeneID:8919095"
                     /translation="MPEHCPFCGEPIESTRVTPEDGRPYEEWRCADCDETWRHPEETV
                     LDRSLDFSKHGDQLDRRDADTDLDW"
     gene            246828..247970
                     /locus_tag="HVO_RS01050"
                     /old_locus_tag="HVO_B0213"
                     /db_xref="GeneID:8919279"
     CDS             246828..247970
                     /locus_tag="HVO_RS01050"
                     /old_locus_tag="HVO_B0213"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572782.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="myo-inositol-1-phosphate synthase"
                     /protein_id="WP_049914735.1"
                     /db_xref="GI:909671381"
                     /db_xref="GeneID:8919279"
                     /translation="MTGARAIARGVADTTGMVTAREPVAALDLPAVDDLVFGGHDIRS
                     QRIEETAEEMAGHGGVVAPDTLDAVREDLREIDERVELGTARRCGEAVEGMSSETTGE
                     DVSVADIVEEIRADYAAFADSQGVDRLVVVNAASTEPPIPTPGDYDTLAAFETAVERD
                     DPNLPASALYAYAALLDGHPYVNFTPSTGSSLGGLRELAERNEVPHMGRDGKTGETLM
                     KSALGPMFAGRNLRVLSWEGHNILGNSDGLVLEDDANKAGKIESKGSLLDDILGYETH
                     NAVRIDYTPSLGDWKTAWDHVHFEGFLGTEMKMQFTWEGADSALAAPLVLDLVRLAAL
                     ADERGEGGTMSHLASFFKSPEGVDRHELSEQFRLLYDYAERHAEGA"
     gene            247967..249367
                     /locus_tag="HVO_RS01055"
                     /old_locus_tag="HVO_B0214"
                     /db_xref="GeneID:8919331"
     CDS             247967..249367
                     /locus_tag="HVO_RS01055"
                     /old_locus_tag="HVO_B0214"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041321.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphodiesterase"
                     /protein_id="WP_004041321.1"
                     /db_xref="GI:490140973"
                     /db_xref="GeneID:8919331"
                     /translation="MTTRDPSAAGASGAGRVVVLDIVGLQQTHLDEGLAPNVADLLAG
                     KPSGPLEPSFPSVTVPAQTTLSTGQSPAAHGDVSSGEFDRERQVAEFWERDRGGRTRL
                     WEVASDEAGLTTGALFFQHLIGTSADVAVTPSPIEDEDNNLIEMDCWTTPDGFYDDLR
                     EEYGHFPLHNYWGPVADERSSEWILAAARESIARSDPDLLWVYVPYLDYDAQRHGPDS
                     PELREAVGVVDDLVGEFLDRLETTPRWAETAVGVVNEYGFNAVDTPVFPNRALREAGL
                     LAVRNDDAGGEKVDIAGSSAFAMVDHQIAHVYTDRPTAARKVLESLPGVDAVLEGEAR
                     GDADHPNAGDLVVVADADAWFQYYWWTDDADAPSYATEIDIHAKPGFDPCELFLGDEG
                     LVTLDPTKVSGSHGRIDPDTRGFYGFGGPAAPDGPSDRIVDARRFAPTVADLLGIAED
                     VSLAFERPSLFAGPQV"
     gene            complement(249488..254698)
                     /locus_tag="HVO_RS01060"
                     /old_locus_tag="HVO_B0215"
                     /db_xref="GeneID:8919152"
     CDS             complement(249488..254698)
                     /locus_tag="HVO_RS01060"
                     /old_locus_tag="HVO_B0215"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600112.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secreted glycosyl hydrolase"
                     /protein_id="WP_004041320.1"
                     /db_xref="GI:490140972"
                     /db_xref="GeneID:8919152"
                     /translation="MTHDDTTRESNPDDDGDRLNINRRDFMKVSGAGAANFLGASGVA
                     QAQQLTATDTIRLVATEGDVLAAYTNEESVIEGSGLADAISDWREGDLTTNSLLTGIN
                     SWRNGTEIETAADSFSWVATEPDEMADTANPTLVVHEGEEYEIELSNAMDEDITFVLA
                     DPTGEVMESFSTMQASGGSETVTFTAESSMAMYYAEEHPEQMRGSVEITPPPAEDTIS
                     VLMMGGPQGGSHNAPARQVQLTGYMLNRGIEVQYTDRLEDLEPDVLHRYDAWVMIDNR
                     GANYGQSLTAEQEQSIVEFVENGGGFIPIHSASACFTGSDAYMNLVGGEFAAHNYGEM
                     TTNFAQPSHPILSTLDPITVEDETYRHTNLNDDIDVLAYAQFPEGDSIPEYDEGRDQG
                     EPWSWTRTQGDGRVFYTAWGHGRAPWATDGFKALIENAIRWVTKNEDTIADDTTVLND
                     LEFIDADIPYYPPPEGSLLTPEVPEEVGSGTSWNRMQRALNPSETVRRTITPEGFDLE
                     PFVTEADLPDDARGNILDAKFDARGRVWLSVTRDYPNELGQNRDKIVVCEDTDGDGEA
                     DEFTVFADGLSIPTSMVVVDDGVVVADLDDPGESGKMVHLADTDGDGEADERTVLFSG
                     FGNGDTHAGPNELAHGIDNWIWGQVGYSGFSGTVAGEERNFSSSVFRFKLEDGSVTDF
                     EIVGTLPGNQAGLGFTEEGLAFGSAATSGRPSNYFAIPHQYYDLIEGTGPNDFGAASD
                     TNRFLPVTDRVRQVDLHGGYTAATGHTIYTAREYPEKYWNNTGFVGGGTGNLLGTFFL
                     SQDGAGYTNHYAHNIAAATDAWFAPSYSSVGPDGMLWFIDWYNYIYQHNPTPDGFENG
                     PGNAYMSEVRDHATARLFRVVYGDDDGYEPTDLSDASVSELVAALSNTNMFWRQTAQR
                     LLVERNETGALSALVDLVATETLDETGLDPAAIHALRTMHGLGALDADTGNATAIQAA
                     LGALTHSSAGVRLTALRVLPSTAETRGAILDNGLLDDEDGRVAMWALVALAQTPADDA
                     SGEAVYQMISDESNYRDTVLVDAASLAGATHADGFIPAYEANEDTSDGGDGGDDLPNL
                     LENPSFETPAGGDTGDADAMPVGWSNTDYSGSPEFSYAETGYEGDRSVQVSSSEGADA
                     SWNTTVAVDPNTEYTLSAYVRTDGLELVDGTAIGEGPLGATINVEQIANTDSGTQWDT
                     IPSGLAGTNDWTELSTTIDSGDLEELQINCLFGGYGEATGTAWFDGVSLTDPDGTDVL
                     SNGSFEESTGSSEPAMPADWSTNTFTGTAEYTYADAGQDGSQSVQISSTEGADAVWLV
                     DGISVQPETEYTLSGWIRTENVQASDSARGALFNVHSTDFETEPLTGTNDWTEVSTTF
                     TTGADTTTVQINCLFGGYGTATGTAWFDNVSLTDPDGNNLLPNASFEEGAGTDSPSDP
                     ETPANWEGTTYGGTAEFTYTSDVSRTGEYSVRVDSTEGADASWTQYRDDLEPNSEYRF
                     RAWVRTSDDFSNSEDGTGEIGSSYGVTINVHSLGQGSVTDYYTEPVEGWQLLETTFST
                     GASPGEFQLNLLFGGWGDATGTVWFDDTELTRIGGSGNGLELVYDRVTAHVEATSGGG
                     DDGGSDDDGSDVIPSGSTIELEAESNEGWTGVAPSGIADATNPTLTLEAGGEYTLTWT
                     NRNGAPHNFEIVNGDDSTVNDISTSYLSTQGESQTVTFTVTDAMAEYVCRAHQLRMRG
                     TIEIASSGGN"
     gene            255149..256360
                     /locus_tag="HVO_RS01065"
                     /old_locus_tag="HVO_B0216"
                     /db_xref="GeneID:8919228"
     CDS             255149..256360
                     /locus_tag="HVO_RS01065"
                     /old_locus_tag="HVO_B0216"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572788.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041319.1"
                     /db_xref="GI:490140971"
                     /db_xref="GeneID:8919228"
                     /translation="MSVVIVGTLDTKGEEIGFARDVLEEQGVEVHLVDVGVLGEPEIE
                     PDTDAAAVAEAGGSTLETLREAGDRGKAIEIMGDGAAVVVSRLHSEGRLDGILGLGGG
                     GNTSVATAAMRALPMGVPKLMLSTMASGDTEPYIGYHDIAMMYSVADIEGLNQLSRTV
                     ISNAALAMVGMVSNEPDVETEEKPTIGITMFGVTTPCVQRARDWLEARGYETIVFHAT
                     GTGGRAMESLIEEGVIDGVLDVTTTEWADELVGGVLAAGPGRLDAAAERGIPQVVSTG
                     ALDMVNFGPKDSISDEFDGRQFHVHNPQVTLMRTTPEENAELGRIIAEKLNAATGPTT
                     LALPLGGVSMLDAEGEAFYDPEADDALFDALREHLDDDVELIQSPANINDDEFALTLA
                     EAIDRRMRAAA"
     gene            256568..257998
                     /locus_tag="HVO_RS01070"
                     /old_locus_tag="HVO_B0217"
                     /db_xref="GeneID:8919340"
     CDS             256568..257998
                     /locus_tag="HVO_RS01070"
                     /old_locus_tag="HVO_B0217"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600110.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_004041318.1"
                     /db_xref="GI:490140970"
                     /db_xref="GeneID:8919340"
                     /translation="MTDQPALTDESRRRYLKAIGTAGLTAGLAGCSGGGGGNGGGGDG
                     GGDSDGENNAGGGGGDDSSGGGEDYEAIGNFPPEGNSVSIGFNGPTSGALGPDGQDQE
                     KGFDLAVKHLNEGGGLVDYWDRLSGDGIMGYQVEPTKADTAGSADTAQDNIERMIQRD
                     NIQFWTGGMSSTVTMAMQNVAQREKVPFMGGNSTSAGISGENCSRYYFHPTFHAEIIG
                     MAMGEAAPSVLGEDRSLFHIYMDYSYGQSNRDAARKYLTEQGPWEDAGGAAIAEGETD
                     HSFQIQALEDSGADTLYFSSFGNFAASGLAQLRDAGLTDDIDVIIPHVSAFTLDPLGA
                     DAEGVLGMEPWNPNADNEASQAFVESYQAEYDETPNQSSLHTYESMMVYAAAVEEAGT
                     FHPPTVVRTLEDFEWSLAWGDSAFRTCDHQVERPWYMVQGVGDDRAEELGIRTEIVET
                     TDPLVYECSEFPASNCAMGDNEYGDE"
     gene            258281..259222
                     /locus_tag="HVO_RS01075"
                     /old_locus_tag="HVO_B0218"
                     /db_xref="GeneID:8919074"
     CDS             258281..259222
                     /locus_tag="HVO_RS01075"
                     /old_locus_tag="HVO_B0218"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041317.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_004041317.1"
                     /db_xref="GI:490140969"
                     /db_xref="GeneID:8919074"
                     /translation="MNVDGVVGFLFIALSVASLYLLVAVGLSIVFGSLKYVNMAHGVL
                     YLSGAYIGLLIASSEQYGGLLSDFGQVGLDWGFVPALVLTPVVIFVVGVAMERWIAKP
                     FYERELLDQLLVTFGILIAAQELVAILFGRTGTIYPRPEWLTGAISLPVIGTPPGMSA
                     ASTIRVLVVALTLLLVAGIFAFFKYTDYGLAVRAGTEDSEMTQMLGIRIGRPFLLIFA
                     VGAAYAGLAGVLGGSLFNVTSEIGMEIIIPSLVIVIMGGVGSLRGTVVGALLAGLTFA
                     VATELEPSMTQASIYLLAIVVLTIRPSGIFPSAEIGQ"
     gene            259219..260373
                     /locus_tag="HVO_RS01080"
                     /old_locus_tag="HVO_B0219"
                     /db_xref="GeneID:8919098"
     CDS             259219..260373
                     /locus_tag="HVO_RS01080"
                     /old_locus_tag="HVO_B0219"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041316.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid ABC transporter
                     permease"
                     /protein_id="WP_004041316.1"
                     /db_xref="GI:490140968"
                     /db_xref="GeneID:8919098"
                     /translation="MSTDNIHKTVAEASSLISWDTWDRIKHTESFVLLSSVLFVLLFS
                     YAFGRAPVVSDVFQGYHGLAITILIWSIFALGFNLLLGQTGLLSFGHAMFFGTASYAA
                     ALFAIHVYNDPLAVIVVGTLAAVALGAVAALILLRLHTVYFSIVALAIGQFLYFLARE
                     PLVEITKGINGLEVPRSDVLGVFELEHQYGGLLGELVVNNLYLFVGVFFVAVVASITR
                     IRKSPYGLIFKAIRENETRTAFVGLDVWRYKFAAFLLSAAIVGLAGGLMAVNTQFAGV
                     ERLYWSVSGDVVVMTVLGGLGTLAGPVIGTFVFFYFKGIVNGFPTLGNYWLLLLSLSF
                     TTVVWVYRDGIWGMITALTGALRDPRELVAAITARVTGGDSTGDAPGGED"
     gene            260373..261131
                     /locus_tag="HVO_RS01085"
                     /old_locus_tag="HVO_B0220"
                     /db_xref="GeneID:8919179"
     CDS             260373..261131
                     /locus_tag="HVO_RS01085"
                     /old_locus_tag="HVO_B0220"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041315.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid ABC transporter ATP-binding protein"
                     /protein_id="WP_004041315.1"
                     /db_xref="GI:490140967"
                     /db_xref="GeneID:8919179"
                     /translation="MALLETRGLTKEFGGLTALDDVDIDVEEGELVSLIGPNGAGKST
                     LINTITGRLPPTEGQVSYAGTELVGMKPFEIAQLGVGRSFQTASILPELTVRENVQVA
                     SFAAEHGSFRVNFFRRRDSFDEVQSRTNDILDTIGLDSKARMEAGSLPYGDKRRLEVA
                     IGLATDPDLLFMDEPTAGMSPTETQMTVNLIHDLLADWGMTIFLVEHDMDIVFDVSDR
                     IFTLHQGRLIAQGTPEEIRENPAVREAYLGGGEQ"
     gene            261128..261871
                     /locus_tag="HVO_RS01090"
                     /old_locus_tag="HVO_B0221"
                     /db_xref="GeneID:8919271"
     CDS             261128..261871
                     /locus_tag="HVO_RS01090"
                     /old_locus_tag="HVO_B0221"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600107.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_004041314.1"
                     /db_xref="GI:490140966"
                     /db_xref="GeneID:8919271"
                     /translation="MSLLELDGVHAYYGPSHILRGVSFDIDEGEVVTLLGRNGAGKTT
                     TVRSIAGTEPPAIRSGSIRFDGDDITDWPADNIAMGGIGVVPEGRRLFTELTVEENLE
                     MSKITRGWWNTIRRGGLGGGESTMSIDELYDLFPRLDERRTQQAGTLSGGEQQMLSIA
                     RTLRLPNLKLLLLDEPTEGLAPQIVKAVGDSITEIADQGLTVLLIEQNVREALRIADR
                     GYVLDQGDIVYGGTVDELESEDLDEYLVV"
     gene            262061..263320
                     /locus_tag="HVO_RS01095"
                     /old_locus_tag="HVO_B0222"
                     /db_xref="GeneID:8919295"
     CDS             262061..263320
                     /locus_tag="HVO_RS01095"
                     /old_locus_tag="HVO_B0222"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600106.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="PQQ enzyme repeat domain protein"
                     /protein_id="WP_004041313.1"
                     /db_xref="GI:490140965"
                     /db_xref="GeneID:8919295"
                     /translation="MKRTNRRRFLAAFSSSAFAFTAGCQRPVASASERHPVSEPVTSW
                     PTFRGGRYNTGYIGDVSPLDSEPSVEWTFEAGDAFWGSPIVADGTVYIGSADSALYAL
                     DAETGEERWSFEAGHRIEGTPAYADGVVYVGSYDKHLYALDAGTGEERWSRGFGGLIR
                     GSPTVWDGTVYTGVGCHNLACAWYAEEANVSETGWVYALDAETGETEWRYEVGDEVVS
                     TPAVTNNRVYVGTSDEALYALSRSTGEVEWTYETRDMIWSSPAVAYGSVYFTDWNGNV
                     HAADAATGEQEWLADTAGRYISGSVAVGEEAVYVGHTPYNTLDDPTINHAKVFRFDRE
                     SGAENWSFETPALEVGSSPVLTEDVLYVGTHRQSDGDGVGVHAITTDGQEEWFMEIDG
                     RGVGSSPALVDGRLYFGGTDAKVYAVE"
     gene            complement(263384..264217)
                     /locus_tag="HVO_RS01100"
                     /old_locus_tag="HVO_B0223"
                     /db_xref="GeneID:8919016"
     CDS             complement(263384..264217)
                     /locus_tag="HVO_RS01100"
                     /old_locus_tag="HVO_B0223"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041312.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041312.1"
                     /db_xref="GI:490140964"
                     /db_xref="GeneID:8919016"
                     /translation="MKYTRAESLDRIEATIEAGDPVIGAGAGTGISAKFAERGGVDLL
                     IIYNSGRYRMNGRGSLAGLLPYGDANEIVVEMGHEVIPVVEDTPVLAGVNGTDPFRDM
                     SVFIEDLRRRGFSGVQNFPTVGLIDEDSSYRKNLEETGMGYDKEVEMIREASEQGMLT
                     CPYVFTEEQAAAMTEAGADVIVSHMGLTTSGDIGAETALDLDDAAERVQAHHDAAKAV
                     RDDVHVICHGGPIAWPDDAAYVLNNTEGVVGFFGASSIERLATEEAIENQAREFKEIE
                     F"
     gene            complement(264338..264748)
                     /locus_tag="HVO_RS01105"
                     /old_locus_tag="HVO_B0224"
                     /db_xref="GeneID:8919026"
     CDS             complement(264338..264748)
                     /locus_tag="HVO_RS01105"
                     /old_locus_tag="HVO_B0224"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cupin"
                     /protein_id="WP_004041311.1"
                     /db_xref="GI:490140963"
                     /db_xref="GeneID:8919026"
                     /translation="MVSEKRFVQPDDVETIRLDWGTLKWMNAPEVTGSEGFSAGVVLL
                     EPGKGHERHTHPDSEEILYFLGGEGEQTIEDETRTVGAGDMVHIPSGVEHSTINTSWE
                     PLRFLAVYCPPGPEAEIRADDDATVFPPGEFPGN"
     gene            complement(265677..266630)
                     /locus_tag="HVO_RS01110"
                     /old_locus_tag="HVO_B0226"
                     /db_xref="GeneID:8919267"
     CDS             complement(265677..266630)
                     /locus_tag="HVO_RS01110"
                     /old_locus_tag="HVO_B0226"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600105.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="permease"
                     /protein_id="WP_049914733.1"
                     /db_xref="GI:909671379"
                     /db_xref="GeneID:8919267"
                     /translation="MSLMGAFTNAILPILGVAVVGYLLARTTDIDVEPINTLGLYVLI
                     PALAFHSIATTTLGGGEVLKLGLGVVGYSLLMIVIAWGVGRLAGESGPLLGALMLAAA
                     FPNSGFVGIPLSGFAFGEVGRTTAVIYLTIQNVVVYTLGVYIASNGSDAGALDAVTEI
                     FRLPLLYAIVAGVVARALGVVPPADAALMETVGLVGDASIPVMLLILGIQLAETDVSA
                     ISRSVAPSALKLVVAPLVGFGLALALGFGDPTVAKVFVLECATPAAVIPLALTIEYAD
                     ETTVDGITAPEYLSTTIFTTTVASVGVLTVLVAVLQAGALF"
     gene            complement(268117..269232)
                     /locus_tag="HVO_RS01115"
                     /old_locus_tag="HVO_B0227"
                     /db_xref="GeneID:8919313"
     CDS             complement(268117..269232)
                     /locus_tag="HVO_RS01115"
                     /old_locus_tag="HVO_B0227"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_004041309.1"
                     /db_xref="GI:490140961"
                     /db_xref="GeneID:8919313"
                     /translation="MRKVYGGDSDIVAVDDISFEIADAEFLTIVGPSGSGKSTLLRMI
                     AGLEDITEGTIRIGDRVVNGVQPQDRDVAMVFQNYALYPHMTARKNMSYGLQLTTDLP
                     EDEINQRVMDAAEMMGVTDQLDKHPGNLSGGQQQRIATGRAIVREPSVFLFDEPLSNL
                     DAKLRLHMRTELQQLQDTLGTTTVYVTHDQEEAMTMSDRIAVVDGGELQQIGTPEEIY
                     NEPRNLFVGDFVGNPPMNQFEVRLSGTSLVADGFSYDLSERVLEHIKQYADGVDEFVL
                     GIRPENISLTDSDEPNAVRAFLDVREPVGSDNYLHFDIEGEECWVRVPGDVKPDTNQE
                     LSLAFDEERLHLFRQSDGINILAQEEPPLEVTAGQNT"
     gene            269467..270846
                     /locus_tag="HVO_RS01120"
                     /old_locus_tag="HVO_B0228"
                     /db_xref="GeneID:8919092"
     CDS             269467..270846
                     /locus_tag="HVO_RS01120"
                     /old_locus_tag="HVO_B0228"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041308.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004041308.1"
                     /db_xref="GI:490140960"
                     /db_xref="GeneID:8919092"
                     /translation="MVREAITSRTRRKFIKSAGVAGTVALAGCAGNSDNSGDSGSGGG
                     DGDSSDGGSSGNTRSESYELTFWELFSGGEGPIMESIVNKFNEEQPLDTDAEVTINRQ
                     RTPWNEYYNKLFTALSGGEAPDMAVMHAAYLRAWDGGIDAIGSYADTASMESDYTESH
                     WDLVTVNDNVNALPMDMHPIGVYYNKDLFEQAGLDPESPPTNWEEFRQAGDAVVENTD
                     AHAFTQSPYNDGFGSFRTWSTWVKQQGGSLYDDEWNPTFDSEAGMNIAQLFSDMTGDM
                     GWAPATSEDTWGNNAFQNGTCAMAMNGTWYVAALSGVDDLNWGFFEPTVGPNKQQDKV
                     WADGHSIVLPKKEGRSDAKSEIAAEVAHWMTTQNPSWGAEAGHLPAANSIYESDTFQN
                     SPYYDKTLNKYVEMAEDGDYFYHPKVPNGDPNAQNWYTWLVDIWAQNSEPQAAIDSGI
                     QTVSNGISE"
     gene            270910..271785
                     /locus_tag="HVO_RS01125"
                     /old_locus_tag="HVO_B0229"
                     /db_xref="GeneID:8919236"
     CDS             270910..271785
                     /locus_tag="HVO_RS01125"
                     /old_locus_tag="HVO_B0229"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097310.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_006600104.1"
                     /db_xref="GI:493648530"
                     /db_xref="GeneID:8919236"
                     /translation="MGLRKETIEGIVWSLPYLAVFTVFLIWPALKGLYMSLHTYPNKF
                     DLTETEWVGLQNYVELFQDPVFYNAMEGTLLFVAISVPALVILGLVMALGVNRDVAGK
                     RTLRAIYFSPYVLTVAVVTLVWGQVYSQSYGLINYYLGFFIDNPPGWLTSPDLVMAAL
                     AFMTVWWLVGFNFVIFLAARQSIPERLYEAARLDGATGWRAFKDITLPQMRNSVVFVV
                     MVQFILQFQVFAQPYVMTQGGPKDTSDTLVYYLYRSAFSQQQFGYGAAMGYVLVAILI
                     VIAIVNFKVIGDSND"
     gene            271778..272653
                     /locus_tag="HVO_RS01130"
                     /old_locus_tag="HVO_B0230"
                     /db_xref="GeneID:8919157"
     CDS             271778..272653
                     /locus_tag="HVO_RS01130"
                     /old_locus_tag="HVO_B0230"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971711.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="WP_004041306.1"
                     /db_xref="GI:490140958"
                     /db_xref="GeneID:8919157"
                     /translation="MTETTSQDSIRARLDGDTVRNVLLHAFLYGLAVLMAVPYLYTLS
                     RSFQPTELLRDPRPYWIPPLAGEPITLEHYQYLLNNTLVVEWTINTFIIAAGATLLIV
                     VIDSMIAFSLTRLDWPGQGLVMGVILASFMVPYYMNIVPLYQIVSDLGLINTYWGVIL
                     PAVASPLGVFLLYQFFKDIPAEYEEAARLDGFTTFQVYTRIILPLAKPILSALALFMF
                     VYNWNAFLWPLLVLSNETAYTLPIGLVNLYQGNIDTPGLHMAVAILGSLPLFIIYLIF
                     QGQIVRAVQMQGATG"
     gene            272650..273369
                     /locus_tag="HVO_RS01135"
                     /old_locus_tag="HVO_B0231"
                     /db_xref="GeneID:8919022"
     CDS             272650..273369
                     /locus_tag="HVO_RS01135"
                     /old_locus_tag="HVO_B0231"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600103.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041305.1"
                     /db_xref="GI:490140957"
                     /db_xref="GeneID:8919022"
                     /translation="MSESADGTVGVHRALVAAVRTVFHHPVRMVAISVAWVLASVPLV
                     TIGPATLGVYGAVASVREHGHVDRDAVRETLSDHWLDALLFSGLLVAFPALAVFYLGR
                     FSASGSAFAGVLGMVGFYLAYHAWVVFALGFVALAQGDDAFDAVTDGYRWSVERPVAT
                     VLVGVVTATLFVVCLVLTVALPLVFPALAAAFHTELAAQTRDREEDATDAADTADATA
                     PTDRPVSGESPKNEFSATFRR"
     gene            complement(273372..274706)
                     /locus_tag="HVO_RS01140"
                     /old_locus_tag="HVO_B0232"
                     /db_xref="GeneID:8919297"
     CDS             complement(273372..274706)
                     /locus_tag="HVO_RS01140"
                     /old_locus_tag="HVO_B0232"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097305.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_004041304.1"
                     /db_xref="GI:490140956"
                     /db_xref="GeneID:8919297"
                     /translation="MSERNSSRQHSRRKYLAALGAAGVAAVGSTGVIAGRGRDDEQTD
                     VEGTLYSPPSGAPAPGSLYPRVTRLKRGSGKGSEKQLLATFEYYPSMSGGSRPYFPVY
                     RSTDGGETWSKFSEIHDTSGKDWGLRYQPTLFELPHAVGPWPAGTVLAAGNSIPILDD
                     PEDVPEGEVGELGETSIDLYASTDRGESWEFVSTVVTGGKAVPYDGNSPVWEPELGLD
                     DDGNLVCYFADERMGSDDDYNQLVAYKASEDGGQSWGDEQFVAAIPDETTRPGMPTVT
                     PLPNGTYVMSYEVIGPDYLYGEVHVKTSPDGREWGDPTDVGTLVSTADGRRFINGPYV
                     TWTRAGGKDGTILVSGKQLVDGNRDLAEGNGEVVLANSNLDGSGDWEAVDAPLSFETE
                     GDLGGRAFVGWTTPLLPSRHGDELLQLTSVADGPNLCEISYGVQSLPLDDGT"
     gene            complement(274785..276320)
                     /locus_tag="HVO_RS01145"
                     /old_locus_tag="HVO_B0233"
                     /db_xref="GeneID:8919106"
     CDS             complement(274785..276320)
                     /locus_tag="HVO_RS01145"
                     /old_locus_tag="HVO_B0233"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-N-arabinofuranosidase"
                     /protein_id="WP_004041303.1"
                     /db_xref="GI:490140955"
                     /db_xref="GeneID:8919106"
                     /translation="MQSEVRVSSHEPIDRISENIYGHFAEHLGRCIYGGLWVGDDDRV
                     ETEDGIRMDTVSLLRGLNMPVLRWPGGCFADDYHWEDGVGPRDERPRRRNLWWTQGRE
                     NLPEESNEFGTDEFLRLCQLLDTDPYIAVNVGSSTPQEALDWIEYCNYGGDTELANRR
                     RENGQEEPYGVKYWGIGNENWGCGGRFAPDEYADEYRRFANYFNGFDKLMNEESTEFI
                     ACGHLTDDWNKVFFDSLNGGMEYGPGSFLGMGSPFNLMDHFSVHRYYQAGGDTDFTDE
                     QYYKIFARAQKVGGDIDRAAETISQYVPEDEIGIIVDEWGVWHPEARSDNGLEQENTV
                     RDALTTAGVLDLIHERADVVSMANIAQLVNVLQCLVQTDEEDAWRTPTYRVFDLYENH
                     VGRTALETSVDTEQRTIEGEENDVPMVSASASEGDGELFVTASNRRHDEPETLTVDVG
                     SSAYSVSSATVLFEGNDIREYSTKENADSFEADVLDVTDEGDGTVTFDAPPASVVGLT
                     LTE"
     gene            276941..278107
                     /locus_tag="HVO_RS01150"
                     /old_locus_tag="HVO_B0234"
                     /db_xref="GeneID:8919264"
     CDS             276941..278107
                     /locus_tag="HVO_RS01150"
                     /old_locus_tag="HVO_B0234"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013035158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_013034990.1"
                     /db_xref="GI:502800014"
                     /db_xref="GeneID:8919264"
                     /translation="MSKTQQADSEIHEDQLLNFLVNSLDEEVALTLGENAELDAEDIY
                     EVLVGACADGTSVSTLCERSEDAPHENSVLYHLRTKFDLETLEQVGNMLLQKDVLDVL
                     PQQVEVCADLHLRPYYGDEDDTDGLYHSQAKRGTTAFHAYATLYARVKNKRYTLAVRR
                     LEYGDTASSVLAEFLGILDGLDLGVKAVYLDREFYDSKCLTLLQAHNHAYVMPIVRWG
                     RTIKRELSEGWSRVIQHSLTAKLDGHSWTVEFPVYIDCTYQNGRYDEHGVARHGYAAD
                     APFINSPRDARYHYAKRFGIEASYRLSEQSIATTSTQNPVVRLLYVVVSLLLQNVWRY
                     LHWEYVATPRRGGRRLWEWSFKEFINMVRRAAWTALAVRRAVPANRPPDDRFHR"
     repeat_region   276953..278293
     gene            complement(279171..279377)
                     /locus_tag="HVO_RS01155"
                     /db_xref="GeneID:25143366"
     CDS             complement(279171..279377)
                     /locus_tag="HVO_RS01155"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041301.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041301.1"
                     /db_xref="GI:490140953"
                     /db_xref="GeneID:25143366"
                     /translation="MELRKLVSDYLPNAVVAATIFTIYNTYTGDTADPVTIGVEFIFS
                     IIAIFIGFIVITPILNKTFDIVRR"
     gene            complement(279990..283325)
                     /locus_tag="HVO_RS01160"
                     /old_locus_tag="HVO_B0235"
                     /db_xref="GeneID:8919327"
     CDS             complement(279990..283325)
                     /locus_tag="HVO_RS01160"
                     /old_locus_tag="HVO_B0235"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061976.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="WP_004041300.1"
                     /db_xref="GI:490140952"
                     /db_xref="GeneID:8919327"
                     /translation="MSTDDPLPGVPEIDDPQHETPVTAEFETGTANDPPVGTDGEDPT
                     TLSVDGTQVTVPPGSTVIDAMQAVDDEVVSVDPGADSLDEDADVPALCYYDRGGDASD
                     EIGPRSECRTCMVETDEHGVVPSCSFPATDGLRVETDTSAAEESRSVNLDLVLSNHNL
                     RCTTCNGNGRCELQETAVSEGVDHPRYGVFDDRSEYEPLDDSSSFIQIDRNKCILCNR
                     CVEGCNDVQVEGVLRIEGSGEDTRIGFQSDAETMADSDCVSCGHCATVCPTGALTEKD
                     IGGAGTLPLPGFTQRNSVGRVIEHEDVETLDDTTAPNRSPDPGSSGTAGGEAESGRAG
                     REKRSGVARYMAQSKRRASDFLETYGRKAMLAGEHTAENLAARTLPEGRLFDVASLVS
                     DYRLGNLDKAETTCGFCAVGCRFEMWGKDGNAIGVQPVDDPDNAPANNFSTCVKGKFG
                     HDFANSENRLTKPLIRNEDGEFEAASWDEALDYVAGRLREIQDEHGVDAVSCLASSKG
                     SNEEAYLVQKFARQVLGTKNIDNCARLCHSSTVAALQQTLGYGAMTNRINEDIGEADA
                     YLISGSNTTESHPVLATRIKQNVRDGADLVVFDPRKIGIAEHADQYTRTTPGYDVAWL
                     NGLIRYLIEHDLHDEEFIERNTKGFAEVKRKVQAFTPEKVERLAGVSPDELKSAAETL
                     ADAENVVFGWAMGMTQSSHGTENLLAMADLALTLGQVGKPGAGLSPFRGQNNVQGGGG
                     DMGTLPGSLPGYQDPADDEVGEKFAEVWGERPPAEPGLKVPEMLSEAHEGNLRGMYIV
                     GENPALSEPDIQHAGEALESLDFLVVQDIFMTETAEHADVILPAATSPEKHGTFTNTE
                     RRVQRVRASAEPPGKARQDWEITQELAARLGYDWGYDHPREVMDEISELTPIYGGVSY
                     ERLDSGDEHGLQWPCWDDDHPGTPYLYDYEGGNFNFDDGLARFVPADGGHPGELPDEE
                     FPLTLTSGRVLYHWHTGQITRRVEGLMSHVGESFIEINPTTAAELDVSDGEYVRVESR
                     RGDIVVKATVTDRVGDGTLFIPMHFAAGAVNKLTQEVFDPQAGIPEFKVSSVRVEPLG
                     PDADPDVLRTPDAGAGSAARGDD"
     gene            complement(283322..284839)
                     /locus_tag="HVO_RS01165"
                     /old_locus_tag="HVO_B0236"
                     /db_xref="GeneID:8919317"
     CDS             complement(283322..284839)
                     /locus_tag="HVO_RS01165"
                     /old_locus_tag="HVO_B0236"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041299.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase"
                     /protein_id="WP_049914719.1"
                     /db_xref="GI:909671365"
                     /db_xref="GeneID:8919317"
                     /translation="MSRTGNAVRSPVLRVSGAGRTERGARVLSAARRTADSVTVLRTG
                     PTGISEYDPLVLATDAGRTAFFPTAETSRVRDLVTAMEDGELPTDGAAAVVDHDAERT
                     TLPVPTDGPLAVGTRRVLGPCGWLDPLDPTAYQFHSLDRDASAVADAGLVGRGRCDAA
                     ADDPVADAWRRARETDGDPVVVVNANDADDRQRADRTLLAGSPMSVLDGVAAVAEYLG
                     TTEAVIHVAETDTELQAHLREAIDAAADELPVVPVVVTGPDEYRAGEPTAALEAIEGV
                     DRTEPRLQPPTPAEYGLYGRPTVIHTPRTFARVRLALADPEGTDRDAASTTRLLTVTG
                     DVAAPATIEVGSDARLSTARNAVELEGSFKMACVGGVFGGLTRTLDVESTAAELTAAG
                     LGTEGVVELLNDERCAVATAGERARFASEANSGRCVPGREGTVQLTELLRAVYRGSFD
                     RAKIRELGRVMSRSSNCLLGAHAPRPVLTAMDEFESSFEAHADGRCPSGTCSDKL"
     gene            285032..285307
                     /locus_tag="HVO_RS01170"
                     /old_locus_tag="HVO_B0237"
                     /db_xref="GeneID:8919023"
     CDS             285032..285307
                     /locus_tag="HVO_RS01170"
                     /old_locus_tag="HVO_B0237"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041298.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041298.1"
                     /db_xref="GI:490140950"
                     /db_xref="GeneID:8919023"
                     /translation="MMTNPRFDDVRAKAADATREDDIQSVYTGLVHDDGRQEYYFAND
                     TEEASELRETAAVQLGMLVRVLADRSESDIEEITDLAAERAENMRLE"
     gene            complement(285425..285805)
                     /locus_tag="HVO_RS01175"
                     /old_locus_tag="HVO_B0238"
                     /db_xref="GeneID:8919245"
     CDS             complement(285425..285805)
                     /locus_tag="HVO_RS01175"
                     /old_locus_tag="HVO_B0238"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061970.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="endoribonuclease L-PSP"
                     /protein_id="WP_004041297.1"
                     /db_xref="GI:490140949"
                     /db_xref="GeneID:8919245"
                     /translation="MKRTISTSDAPAAVGAYSQATTNGELLLTAGQLPLTPDGELLDD
                     ASVGDQTEQCLENVAAILAAEDASLDDVLKTTVFLDDIDDFEEFNEVYGEFFDEDPPA
                     RSAVEVGNVPKGAAIEIEAVAVTE"
     gene            286201..287358
                     /locus_tag="HVO_RS01180"
                     /old_locus_tag="HVO_B0239"
                     /db_xref="GeneID:8919273"
     CDS             286201..287358
                     /locus_tag="HVO_RS01180"
                     /old_locus_tag="HVO_B0239"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041296.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="formaldehyde dehydrogenase"
                     /protein_id="WP_004041296.1"
                     /db_xref="GI:490140948"
                     /db_xref="GeneID:8919273"
                     /translation="MDAVVYKGEREVAVEAVEEPQIQHPNDVVIDITTTCICGSDLHM
                     YEGRTAAEPGIVFGHENMGIVEEVGDAVSSLEVGDRVVAPFNVACGFCENCENGYTGF
                     CTNVNPGFAGGAYGYVAMGPYQGGQAEKLRIPYADFNALKLPDGREHEDSFALLADIF
                     PTGWHGTELANLESGDSVAIYGAGPVGLMTAYSAKLKGAAEIYVVDRVPSRLALAEEH
                     CDATPINFEEGDPVEQIKEIHGGGVDKGVDAVGYQAIDPEKEADSAYDPARENPAVVI
                     NNLIRTVRPTGELGIPGLYVPDDPGAPDEMAAQGRLGIDFGLLFEKGQALGTGQCNVK
                     EYNRQLRDMIIEGRADPSWVVSHRVGLEDAPEMYEKFDNREEGVTKVLLEP"
     gene            complement(287729..288964)
                     /locus_tag="HVO_RS01185"
                     /old_locus_tag="HVO_B0241"
                     /db_xref="GeneID:8919128"
     CDS             complement(287729..288964)
                     /locus_tag="HVO_RS01185"
                     /old_locus_tag="HVO_B0241"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008322172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_004041294.1"
                     /db_xref="GI:490140946"
                     /db_xref="GeneID:8919128"
                     /translation="MTELTETLELKLVEPNTHKHRKLCETEQAYQDALESAFNANCTT
                     QSAANDVVVNYDLSGYAKNALKKYVPQLCGGSYDAKELHDDHPVRFTNEGPKLDHKPQ
                     NAIEWYVKIPHHDDYNLWLPAQPNPEQREWLEALHAGDAQMGECRLFDRDGEWYFHIV
                     ATRDVEERETSSVETPIGVDIGEASLLTVCHRDERGSPTAPNLWNDEGMRVRQLRETY
                     FTATRRLQKRGSERIAESYGDELWRHIDHILHTVTSEVVSYADRFENPVLVLEDLTHI
                     RENMDYGAFMNRRLHGWGFAKMHAQIRYKASEKGIRVETVNPAYTSKTCHCCGEAGYR
                     PKQATFKCSNSACWVSEYQADVNAALNIADRYLSGESHSREHTDGDDSAEEGGRLTVP
                     QDSQADADTQQETLGTYAS"
     gene            complement(288961..289350)
                     /locus_tag="HVO_RS01190"
                     /old_locus_tag="HVO_B0242"
                     /db_xref="GeneID:8919208"
     CDS             complement(288961..289350)
                     /locus_tag="HVO_RS01190"
                     /old_locus_tag="HVO_B0242"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041293.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_004041293.1"
                     /db_xref="GI:490140945"
                     /db_xref="GeneID:8919208"
                     /translation="MKATRHATYNLNYHIVWIPKYRRSVLVGDVATRVRDILHEIADE
                     KGLEIIDLTVQPDHIHLFVSSPPKHAPSLLANWFKGISSRKYNHRHADHDSEKIKWVR
                     GYYAGTAGHVSSETVEKYIQRHEEDEQ"
     gene            complement(289493..290614)
                     /locus_tag="HVO_RS01195"
                     /old_locus_tag="HVO_B0243"
                     /db_xref="GeneID:8919306"
     CDS             complement(289493..290614)
                     /locus_tag="HVO_RS01195"
                     /old_locus_tag="HVO_B0243"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061965.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cobalamin synthesis protein CobW"
                     /protein_id="WP_004041292.1"
                     /db_xref="GI:490140944"
                     /db_xref="GeneID:8919306"
                     /translation="MSTTEIPITVVSGPLGAGKTTLVNRLLNDPGGREIAVVVNDMGE
                     LNVDAELVASESDDGVIDLSNGCICCRLQDDLVTEVTRLAENRSFDYLLIEASGISEP
                     LPIARTLASESNEGGLPDHLRLDTTVSVIDTYGFWKAFDPAESLPDAAPDPERPLTEV
                     LVEQVEFCDVLLLNRCDMVPDDALDAVEAEIRELQPRASIRRTTYSDVDPTRVLDTGR
                     FDFEAAKRHQGWKQALASDGVEADHGHDHDHIHDEGVSAARAHGVESFVYRRDRPFHP
                     QRLDAWLDDWRGNVVRAKGFAWVASRPETVLGVSQAGPSVQAGPIGRWGDDTPQTRLV
                     FIGRDLDEDAVTRELDECLATTDEREAAYPDDPFPRESA"
     gene            290894..292654
                     /locus_tag="HVO_RS01200"
                     /old_locus_tag="HVO_B0244"
                     /db_xref="GeneID:8919033"
     CDS             290894..292654
                     /locus_tag="HVO_RS01200"
                     /old_locus_tag="HVO_B0244"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041291.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde ferredoxin oxidoreductase"
                     /protein_id="WP_004041291.1"
                     /db_xref="GI:490140943"
                     /db_xref="GeneID:8919033"
                     /translation="MAPPIADRLLRVDLSAGSVESTPIPDEWRRRYVGGKGLGARYLY
                     DELDAGVDPLGEENAMLFVLGPLSGYLPGESRYAAITKSPLTGCFLDSYAGGEFPDSL
                     AGALGSHMGLLVTGVASEPVRLVVEDGDATIEPAETWGAGTVDTAQAFPNAAVACIGP
                     AGERRVAYATIASDAGDHHAGRGGAGAVMGSKRLKAVVARGAPPDADGLDDLRDAYAA
                     KYRETDTGRWLRASGTVETIDFANEIGALSTRGWSDGQFEAAEELGITTVEDRAVGRE
                     RADTETPGGYRVATEDGDHVPRGATAMTLGAGLDIDDFDAVAVLGRTCDRLGMDLISA
                     GSAVAWTVKANAAGVLDRSLSFGEPDGARALLQEIAERESELGDALADGVEAAATRFG
                     GRDLVPTVKSMELPAYDPRGAQSMALAYATSDRGACHRRARPIEREVFDGDWGADRTA
                     AEVIREQDRRSTLWSLIADDFFGDALDDLGREWLESVGLDPAGGLATVGERIWNVTRL
                     FNVREGISREDDSLPAALQEPLESGPRAGATVDRDDFDSMLDAYYRRRGWTVDGVPTA
                     QTIDRLGLAALTDDFDTLDD"
     gene            292706..293436
                     /locus_tag="HVO_RS01205"
                     /old_locus_tag="HVO_B0246"
                     /pseudo
                     /db_xref="GeneID:8919241"
     misc_feature    292706..293436
                     /locus_tag="HVO_RS01205"
                     /old_locus_tag="HVO_B0246"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008578724.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(293433..294044)
                     /locus_tag="HVO_RS01210"
                     /old_locus_tag="HVO_B0245"
                     /db_xref="GeneID:8919212"
     CDS             complement(293433..294044)
                     /locus_tag="HVO_RS01210"
                     /old_locus_tag="HVO_B0245"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdenum cofactor guanylyltransferase"
                     /protein_id="WP_013034985.1"
                     /db_xref="GI:502800009"
                     /db_xref="GeneID:8919212"
                     /translation="MRTGVIIAGGYSTRFGEEDKAVASLLGTPLIRRVADRMAGVVDS
                     LVVNCRPEQTAALRTALDGYDHPITIAEDSERDEGPMAGIMTGLRAVETEYAFVAACD
                     MPFLEPALIDRLFERAAGHDAAVPRVGDGWFQPTHAVYRASSMADACEAALAEGSHKI
                     IDPLFTLDYVVLEESEVREYASLDTFENINTPDEFAHAAEQLR"
     gene            295154..295918
                     /locus_tag="HVO_RS01215"
                     /old_locus_tag="HVO_B0248"
                     /db_xref="GeneID:8919287"
     CDS             295154..295918
                     /locus_tag="HVO_RS01215"
                     /old_locus_tag="HVO_B0248"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061954.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004041288.1"
                     /db_xref="GI:490140940"
                     /db_xref="GeneID:8919287"
                     /translation="MSEEFGSELDGKVAIVTGASSGIGSATAKSLASRGASVVVAARR
                     EGELEELAATIEDDGGDALVVPTDVTVDDDIDALVEATLDEHGRIDILVNNAGLMPLA
                     HIGEADRETLQTTIDVNLTGLITLTHAVVPTMMEQESGHIVNLSSVVGRFLQANSSHY
                     NAAKAGVKMFSDSLRLDVAEAGIHVSSIEPGAVDTELLDHIPDEEVQKNVKDYVGTMD
                     ALAPEDIARTITFVVTQPERVDINEVLIRPLDQVQP"
     gene            complement(296165..297144)
                     /locus_tag="HVO_RS01220"
                     /old_locus_tag="HVO_B0249"
                     /pseudo
                     /db_xref="GeneID:8919064"
     misc_feature    complement(296165..297144)
                     /locus_tag="HVO_RS01220"
                     /old_locus_tag="HVO_B0249"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006065536.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
     gene            complement(297498..297734)
                     /locus_tag="HVO_RS01225"
                     /db_xref="GeneID:25143367"
     CDS             complement(297498..297734)
                     /locus_tag="HVO_RS01225"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_049914717.1"
                     /db_xref="GI:909671363"
                     /db_xref="GeneID:25143367"
                     /translation="MVPPRASWPGVPTDSKNLYDLRSGPVARVAEVDGDLEAVTGLAL
                     GHGHVAVLDGRIRQAVTEREQRLRVVSVDRPARR"
     gene            298112..299281
                     /locus_tag="HVO_RS01230"
                     /old_locus_tag="HVO_B0251"
                     /db_xref="GeneID:8919203"
     CDS             298112..299281
                     /locus_tag="HVO_RS01230"
                     /old_locus_tag="HVO_B0251"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041285.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS permease (drug)"
                     /protein_id="WP_004041285.1"
                     /db_xref="GI:490140937"
                     /db_xref="GeneID:8919203"
                     /translation="MVALSGAIVNPVLPAIESAFPSVPNAGTLAQLVSTLTGLIIAIF
                     APIIGVIVDRYGRKAVLVGSLALYGVGPSLAYVADSLYVILGTRVLLGIAVAGIMVSS
                     TTLIADYYSGKRREKVLGWQGAIMPFGAAVAVIAGGVIADLNWRTAFLTYLVALLVLP
                     AVVRYIDEPDRGDKQQAGSIPTWTELREILSTLPLAFLAALYLIMFAGMIGYNQINVE
                     IPFYLRTVTSVGGLMTGVALAAMMIISGVVTMNFDQIRERFDPVVILVGVFVATGVGF
                     TVTSLTTNYWAIVVGIVIAGTGLGLLLPTTNYWVSARVDEQYRGRALSGVTTTQFLGM
                     FISPIAVAPLIEMFGTGRTFLVLGAVGLVLAGVFGAIAVRNQSSLTEATPAGSDG"
     gene            300525..301328
                     /locus_tag="HVO_RS01235"
                     /old_locus_tag="HVO_B0253"
                     /db_xref="GeneID:8919101"
     CDS             300525..301328
                     /locus_tag="HVO_RS01235"
                     /old_locus_tag="HVO_B0253"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041284.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 1,6-bisphosphatase"
                     /protein_id="WP_004041284.1"
                     /db_xref="GI:490140936"
                     /db_xref="GeneID:8919101"
                     /translation="MDADPREAVAIDAAEVGADHASARFRTELDIEQKGDAIDLVTEV
                     DRETQRRVIAAIRERFPDDAVVGEEDDELKTVPESGYAWIIDPIDGTQNYTRGAREWV
                     TSVAVVENQTPIAAVNVSPETGDTYVATAARVERNGRPMTVSDESNTSAFLVSSTLRY
                     QVGDRPGIERLSGDIFGTFGEMRKLGTTQLTLSRLADGSIDAVIGFDEHPNAWDTVAG
                     VYLVERAGGTVTDIHGNAWGPGQPGLVASNGHAHDEVLEAAQAAFEETR"
     gene            302018..302815
                     /locus_tag="HVO_RS01240"
                     /old_locus_tag="HVO_B0255"
                     /db_xref="GeneID:8919021"
     CDS             302018..302815
                     /locus_tag="HVO_RS01240"
                     /old_locus_tag="HVO_B0255"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572835.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArcR family transcriptional regulator"
                     /protein_id="WP_004041283.1"
                     /db_xref="GI:490140935"
                     /db_xref="GeneID:8919021"
                     /translation="MNRHDPSGVLKTTAASLALVDHILELEGATMGELVEATDLAKST
                     VHAHLKTLAEYGYVVNVDNEYHLGAKFCHLGDYVRTRKDYYRVAQETVSWLDSESSMD
                     ADFAVEEHGRIVSLYGDLEFANTPRFLIDGSPFHVHTTCSGKAIIAEYPETRVREIID
                     RWGLPAATDDSITTEDELFAELATVREQGYAENSGEAVEGFWAIGKAVKSPRGEVYGS
                     LNLSGPAYVIDEETRATQVELLERAAERFEQGVAELYQTQANEPNEE"
     gene            complement(302870..304537)
                     /locus_tag="HVO_RS01245"
                     /old_locus_tag="HVO_B0256"
                     /db_xref="GeneID:8919329"
     CDS             complement(302870..304537)
                     /locus_tag="HVO_RS01245"
                     /old_locus_tag="HVO_B0256"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605911.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde:ferredoxin oxidoreductase"
                     /protein_id="WP_004041282.1"
                     /db_xref="GI:490140934"
                     /db_xref="GeneID:8919329"
                     /translation="MLHAKGPLLTVDLGDETSRTEDIDGILESYVGGRGVATRLAHER
                     VPFDVDPFSPDNRVYFSTGPMQASNMSFTGRTNCTSVSPLTGGLCSSNAGGFVSRNFA
                     DAGYSAVELAGVSDELVVLHVTDEGVEFEAVPDLAGATVPETVAYLDDEHDIEADRTM
                     VVGPAGENLVRFASIMTSEERAFGRGGLGAVLGSKNVKALTFGGDAAPDIEIPASQME
                     IHREAATDDHIMKRQGTVAVLDLANEMDGLPSYYFSERHFEGAEGINGDAIEQKKYKK
                     GTCSACAFACKLPTRDEAAGVETEGPEFEVTMAFGSNSGVDDIVEVMKSNELCDRYGL
                     DAISAGNTVAAYLASEDEFGNTDLIHDLVEKIALREGVGDDLAEGIARVHDDLGVENW
                     TVKGMDFAAHEGRVLHGQGLSYAVANRGADHMYAVFYSQEYPLVGKDDAYPPEGFEGK
                     PKRLIEKENQMALNDSGIVCKFSRDFMTPERYEMLFGADFEDLLAVGDRIVTLERHFN
                     NQRGFDRGDDTLPYADELDGFEAALDAYYERRGWTDDGVVPSGNVPA"
     gene            304696..306075
                     /locus_tag="HVO_RS01250"
                     /old_locus_tag="HVO_B0257"
                     /db_xref="GeneID:8919249"
     CDS             304696..306075
                     /locus_tag="HVO_RS01250"
                     /old_locus_tag="HVO_B0257"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971673.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aminotransferase class III"
                     /protein_id="WP_004041281.1"
                     /db_xref="GI:490140933"
                     /db_xref="GeneID:8919249"
                     /translation="MVADPPIHELHFDDAPSVDDVPGPKSTRLLEKQQRIDSSAVSYP
                     EDIPIAFDSGKGATVRDADGNTFIDMFAGIGVLNVGHSNPYVLEAVHEQTDKFVHTVD
                     FPTEARLDLIEKLDEIAPAGLRGNNRVVFGGPTGSDAIEASIKLAKYNTEGTGLVAFR
                     GAYHGATSGAMSLTGNKKFKGDYSPLLPDVVHAPYPNTVEMGKGPQEAVDHCLEEVKA
                     IFEDPYGGLANPAGIFVEPIQGEGGVVTPPKGFLKGLRDIADDNDVPLVFDEIQSGLG
                     RSGKWWASEWYGVTPDVMTSAKALGGTGFPLSATIYHEDLDTWGSGDHAGTYRGHVVG
                     MRAGTRAIEYIQEHDLLAHARDLGQYIRGRLSEVAEDNPRIVDVRGKGLFIGAEFVDA
                     EGNPDGEAADALQQYCFERGVLVWKAGRHGNILRLLPPLVLTHDLAETALDVITDGIE
                     AVTAETQRV"
     gene            306094..306480
                     /locus_tag="HVO_RS01255"
                     /old_locus_tag="HVO_B0258"
                     /db_xref="GeneID:8919194"
     CDS             306094..306480
                     /locus_tag="HVO_RS01255"
                     /old_locus_tag="HVO_B0258"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="reactive intermediate/imine deaminase"
                     /protein_id="WP_004041280.1"
                     /db_xref="GI:490140932"
                     /db_xref="GeneID:8919194"
                     /translation="MPPERVITDDAPRTDNPYSQGVVAGDTLYVSGYGPVDPETGEEI
                     DGDIEAQTDRVLDNIAAVVSEAGGDGLDDAVKLTVYVTDLDDYERVNEAYGARFDEVP
                     PARVCVEVARLPGDVRVEMDAIAYLG"
     gene            complement(306556..307209)
                     /locus_tag="HVO_RS01260"
                     /old_locus_tag="HVO_B0259"
                     /db_xref="GeneID:8919083"
     CDS             complement(306556..307209)
                     /locus_tag="HVO_RS01260"
                     /old_locus_tag="HVO_B0259"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041279.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041279.1"
                     /db_xref="GI:490140931"
                     /db_xref="GeneID:8919083"
                     /translation="MANDADGTDGTDDLAYAADRGRGILTPSDREFLLGRKTDYTDHS
                     KKQKRNRIRRRLRNAILDFTILFESLEDRDRETVFNPDAADREAYTRGITDMLAFLHL
                     GTMGYYTPFKDMLAEGVNKAEQELAGSDYRMVTVDFNVEPVGQIDVDAVIDKLERGAF
                     DQLTDEELQAFVRLLAESDDFSATDLRADMKAQMSEFVERIDAANERRDRRVDDLND"
     gene            307669..309303
                     /locus_tag="HVO_RS01265"
                     /old_locus_tag="HVO_B0260"
                     /db_xref="GeneID:8919013"
     CDS             307669..309303
                     /locus_tag="HVO_RS01265"
                     /old_locus_tag="HVO_B0260"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968327.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="BCCT family transporter"
                     /protein_id="WP_004041278.1"
                     /db_xref="GI:490140930"
                     /db_xref="GeneID:8919013"
                     /translation="MSAVSSSNGAVSEFLDEIEPVIFAFGAAITLLFVGAFSLNPEGS
                     YEFVLGIRRWILATFNWFFLIAMLGFVLFLGFVIFGPWGNLKLGDEDPEYGFLSYFAM
                     MYSAGLAAGIVFWGPAEALFHYSTVPPLYGAEAQSSAAMPLAVQYSIFHWSLTQWSCF
                     TVMGLAIGYFVYNYDAPLRVSAVLTPILGADNVDGAIGKTVDILAVFATLGGVATSLG
                     FIGSQFITGLNFQWGIQLGDVGTILVITGMVVIFTISLVLGVDKGIRRLSNFNMVVFG
                     LLMLATLIFGPTFRILELGTQATGGFVGDFFQMSLFTQATATSASKWVNAWTVFYWLW
                     PLAWSPFAGLFIARISRGRSVREVAFAGIGATSLATVPWFAIVGGAGVIMQHTGAANV
                     LGPVSEYGEAVSGYVLFGNLPIAGPLLLFAFLVLVTTFFVTSADSSTLAVSMMTTGGK
                     EEPSALNRIFWAVLQGAVASILMVVGGVNALQSAAIITGAPFAIICVIATLGLIRTFQ
                     QDYGSLLLQDETRLWGKSESTGGQAPAVNVSSHDDD"
     gene            309476..310840
                     /locus_tag="HVO_RS01270"
                     /old_locus_tag="HVO_B0261"
                     /db_xref="GeneID:8919129"
     CDS             309476..310840
                     /locus_tag="HVO_RS01270"
                     /old_locus_tag="HVO_B0261"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4-aminobutyrate aminotransferase"
                     /protein_id="WP_004041277.1"
                     /db_xref="GI:490140929"
                     /db_xref="GeneID:8919129"
                     /translation="MNRDTAEPDAAALPGPNAEKWVEFHHEHAAPSEYSHEFVWDVTA
                     EADGPFVTDVDGNVLLDFTCHIGAAPLGYNNEKVLSKLREFDLVEPMKIAGQDMYFGA
                     GPDPETAEFPGASHLMDKLTDVSSHYGMDTVFLSNSGAEAVENAMKITHDHEAPAKYG
                     YAFEGSFHGRTLGTLSLTKSKEVYTRHYPQVAGIETVPFCADSGCSGDDDACDCGFFA
                     GDGSRLRNSLSPEGGHVNPDEVAFAILEPIQGVGGYRFPSEAFMAEVGDVCDTYDIPL
                     VVDEIQSGVGRTGEMWAADHYPIEPDVIASAKGLRVGATVSRTDVFPTEKNRLGSTFG
                     GGDLLASMQGALTLDAIEEYDLLDNATERGRQARELLADDAPDHVVDVRGKGLMLAVE
                     FDTKKRRDAVVEAALDRGLLTLGCGKKTIRLLPPLDSTEREIELGVGIFCEAMDAVAT
                     EAVA"
     gene            complement(310915..312210)
                     /locus_tag="HVO_RS01275"
                     /old_locus_tag="HVO_B0262"
                     /db_xref="GeneID:8919097"
     CDS             complement(310915..312210)
                     /locus_tag="HVO_RS01275"
                     /old_locus_tag="HVO_B0262"
                     /EC_number="4.3.1.19"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="threonine dehydratase"
                     /protein_id="WP_004041276.1"
                     /db_xref="GI:490140928"
                     /db_xref="GeneID:8919097"
                     /translation="MSDGRVTGESAPPASEIVTADDVADAHERLDGVVHRTPLDSSRT
                     IADRCGAERVDLKLENVQRTGSFKIRGAYNAMAQLPESVRERGVVASSAGNHAQGVAL
                     AGDLLDIDTTIVVPEITPAVKIDATRGYGADVVVEGELYEESYEHALRLAEDEGLEFV
                     HPFDDAAVIAGQGTVGREIAADAPGVDAVLVSIGGGGLISGIATAMQARDPEVRVIGV
                     QPEGAAHAKPSLEADEIRMLSAVDTVAEGIADARLLERTFAVVRDRVDDVVSVDDTDL
                     AVATTVLAQRAKTVTEPAGAAPVAALLSGAVDVEDERVAAVVSGGNVGLSEHAELTRV
                     GMQALGRAVEARLELDGWPATLGDLSEAVAASGAELDSVERAARTASDAPNRVPVEVR
                     LDGSGPDHLADVLDSLSALDGVEVASHSLDERGESTESS"
     gene            complement(312207..313517)
                     /locus_tag="HVO_RS01280"
                     /old_locus_tag="HVO_B0263"
                     /db_xref="GeneID:8919230"
     CDS             complement(312207..313517)
                     /locus_tag="HVO_RS01280"
                     /old_locus_tag="HVO_B0263"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041275.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="WP_004041275.1"
                     /db_xref="GI:490140927"
                     /db_xref="GeneID:8919230"
                     /translation="MADAVRARLAELRRDLHRHPEPGWCEFRTTARLVEELRAVGVDE
                     LAVGADAYDPADRMAVPSDDRLDEWYERALDRGTDPELLEPLRGGTTGCVAVLDRGEG
                     PTVGLRVDIDGLFIEESDDAGHDPAAEGFRSETGETMHACGHDTHMTWGLATLEAVKE
                     SDFSGRLAVFFQPAEEVSGGGAPMAKSEYAAGIDYFFAVHVGLDHPTGEVVAGIEKPL
                     AMCHIDAEIEGTTAHAGKAPEAGANAIHALGTAIESVYGIPRHSDGMTRVNVGRVEGG
                     TASNVIADEVEAVAEARGETTELMEYAKSELRRRFEKAAELHGCEATVDVVSESPRAD
                     SDPELVEAVADAAETVESVDRVVQTADFGASEDATFLMERVQRDGGLACYSIVGTDHP
                     TSHHTATFDVDERSLETGVDVLTRSILSVAGFESAPTVGARANR"
     gene            313647..314615
                     /locus_tag="HVO_RS01285"
                     /old_locus_tag="HVO_B0264"
                     /db_xref="GeneID:8919338"
     CDS             313647..314615
                     /locus_tag="HVO_RS01285"
                     /old_locus_tag="HVO_B0264"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572843.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-hydroxyacid dehydrogenase"
                     /protein_id="WP_004041274.1"
                     /db_xref="GI:490140926"
                     /db_xref="GeneID:8919338"
                     /translation="MTETDIVVLREGTEGLSMESYADALRERLPDRTVTLARTPKQER
                     ELVVDARVVTGITIDEDLLDRADRLELFACTFAGTDHVPMDALADHGVAVTNAGGIHA
                     PGIAEQAIGNMLVFARRLHEGWRRKERAEWRHFQSGEFTDSTVTIIGLGSIGQAVAQR
                     LQGFEVETIGIRYTPSKGGPTDEVAGFDSDAIHDALSRSDYVVVACPLNDLTRRLIGD
                     AEFATMPTDAVLVNAARGGIVDTDALVSALRSNKIRGAALDVTDPEPLPADHPLWGLE
                     NCLITPHTGGHTPKHWDRLADIVAGNLGRLDEGEELENQVLAAESN"
     gene            314622..317768
                     /locus_tag="HVO_RS01290"
                     /old_locus_tag="HVO_B0265"
                     /db_xref="GeneID:8919216"
     CDS             314622..317768
                     /locus_tag="HVO_RS01290"
                     /old_locus_tag="HVO_B0265"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041273.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="FAD-dependent oxidoreductase"
                     /protein_id="WP_004041273.1"
                     /db_xref="GI:490140925"
                     /db_xref="GeneID:8919216"
                     /translation="MATQERPDDSSDGQRTDPSADPGDDPRADYDYVGGDTDREALVR
                     DLERLVDGDVRFDEYTRQLYATDASAYEVLPVGVVMPTSTADVAAVVEYCADREIPVL
                     PRGGGTSLAGQAVNEAVVLDLSRHMDGVQSVDSEAATATAQAGVTLADLNNSAADHGL
                     TFGPDPAAGDRSVLGGAIGNNSTGAHSLKYGKTDYYVEECEVVLADGSVHRFDEMRVA
                     ELREKADPESDAWGSDGPQSPLLPRIYAEVVRVLDEERAEIDARYPDLKRNVSGYNLD
                     ALVEEARGERPLADGTGTDPDCGSGTVNLARLLAGSEGSLAVVTEATVSLEPLPETKA
                     VALLTYEDVFDAAADVAPILDHDPAAVELIDDVLIDLALDTAEFHDVAASLPDGTRAA
                     LLVEFYADSDADGRRKVADLLTARAPSVTPEATPSSGVGVDDDARAFDALEAHDEAAR
                     AGLWEMRKAAAPILLSRTTDEKHISFIEDCAVPADELPGYVERFREVIDDHDANTSFY
                     AHAGPGVLHVRPLVNTKTLDGLDSFETIADEVTDFVVEAGGSVSGEHGDGRARTQWNR
                     KLYGDRLWNAFRDLKTAFDPDWILNPGQVCGDVSMTENLRFDPDYEFDAGFDPELEWD
                     TENGFQGMAELCHGCGGCRGDQSTTGGVMCPTYRATEEEGLSTRGRANMLRQAMSGDL
                     DADATDTEFMREVLDLCVGCKGCARDCPSEVDMAKLKAEVEHAHHQREGASLRDHLFA
                     EVDRLNELGSRLAPLSNWAAKVPGARTVMEKTVGIARERSLPTFHRESLEDWFEARGG
                     ARVPEAEATDKVLLFPDSYTNYNHPDAGKAAVRVLEAAGVHVSIPDDVTATGRPAHSK
                     GFLDRSRARAETNVDALAPRVEAGWSVVLVEPSDAVMFQSDYLDLLSSKDAERVAAET
                     YGIMEYLDAKRLVEDLDRDASAGADDETLTYHGHCHQKATRKDHHAVGVLRRAGYDVD
                     PLDSGCCGMAGSFGYEAEHHSLSTAIGGILADQISGNRGDTVVAPGASCRTQLEDVDG
                     AADDPPHPIEKVSEAVAD"
     gene            complement(317826..319133)
                     /locus_tag="HVO_RS01295"
                     /old_locus_tag="HVO_B0266"
                     /db_xref="GeneID:8919132"
     CDS             complement(317826..319133)
                     /locus_tag="HVO_RS01295"
                     /old_locus_tag="HVO_B0266"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041272.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="WP_004041272.1"
                     /db_xref="GI:490140924"
                     /db_xref="GeneID:8919132"
                     /translation="MMNEDGKNRNGEAVTDGGSGSEPETALATARRQLERAASHADVD
                     DGVVARLKHPTRVQQVSVPLRRDDGSLDVFTGFRAQHDDVRGPYKGGLRYHPEVTADE
                     CIGLSMWMTWKCAVMDLPFGGGKGGVAVDPKTLSDEERERLTRRFAEEIRNVVGPKKD
                     VPAPDMGTGPQEMAWFMDAYSMQQGETTPGVVTGKPPVIGGSYGREEAPGRSVAIVTR
                     EAVDFYDWDIEDTTVAVQGFGSVGANAARLLDEWGAKVVAVSDVDGAIYDPDGLDTQD
                     VEGHDERPGMVSGYDAPESLSNEELLELDVDVLIPAAIGNVITTENVDSISAEMVVEG
                     ANGPTTFAADAVLEERGIPVIPDILANAGGVTVSYFEWLQDINRRQWSLERVHEELES
                     EMLKAWNAVREHVEERDLTWRDAAYVVALSRIGGAKETRGLWP"
     gene            complement(319160..320338)
                     /locus_tag="HVO_RS01300"
                     /old_locus_tag="HVO_B0267"
                     /db_xref="GeneID:8919043"
     CDS             complement(319160..320338)
                     /locus_tag="HVO_RS01300"
                     /old_locus_tag="HVO_B0267"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600085.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="X-Pro dipeptidase"
                     /protein_id="WP_004041271.1"
                     /db_xref="GI:490140923"
                     /db_xref="GeneID:8919043"
                     /translation="MPRAVFDSAEYDRRIARTKERMAERGLDALFVSDPANMNYLTGY
                     DGWSFYVHQGVVVTRDRDEPVWVGRDMDANGARATTTLSEESIRPYSDDHVQSPHDLH
                     PMDFVAAVLEDLGVDDARVGLEMDAYYFTAKSYTRLQKNLAEASFEDTTLLVNRVRIK
                     KSDAELDYMREAARISENAMQAGLDVIEAGVPEYEAAEAIYSVLIEGTDDYGGDYPSI
                     VPLMPSGDHTGTPHLTWTDREFEDGDPVIIELSGCRHRYHSPLARTTFVGDPPEELSR
                     RADIVVEGMEAALDAVAPGVTCEAVEKAWRDTIAQYGIEKKDRIGYSMGLGYPPDWGE
                     HTASLRPGDETVLEENMTFHTIPGLWFDDFGVELSETFVVTSDGAEPLADFPRRLFTT
                     "
     gene            320684..321706
                     /locus_tag="HVO_RS01305"
                     /old_locus_tag="HVO_B0268"
                     /db_xref="GeneID:8919190"
     CDS             320684..321706
                     /locus_tag="HVO_RS01305"
                     /old_locus_tag="HVO_B0268"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041270.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="alkane monooxygenase"
                     /protein_id="WP_004041270.1"
                     /db_xref="GI:490140922"
                     /db_xref="GeneID:8919190"
                     /translation="MDFSIVDLSPVPKGGTATDAYANTVETAKQAERLGYSRFWVAEH
                     HGMANTLAGTTPEVLLGHLAAETDSIRLGSGAVLLNHYSPFKVAEQFGALDGLAPGRI
                     DAGLGRANGSPAADQALGTDRHVEDPDGDHAEKIEAVVNHLYDDYPDEHPYADLEIPR
                     GDGDLPVPWVLGSSPSSATIAGELGLPYCFAGFIRPQFAVHSFEEYRESFQSSSLDGG
                     IDEPHGMVAVNAVCAETDEEAARLRAVAEASYKRMRRGEVGTRPTVEEAIDELGGVPE
                     PTPATLGAKEWPRAISGSPDTISGLLDQLAERVGADEMMIQHVVGNHEDGLRSHELLA
                     EGVDLV"
     gene            321772..322128
                     /locus_tag="HVO_RS01310"
                     /old_locus_tag="HVO_B0269"
                     /db_xref="GeneID:8919065"
     CDS             321772..322128
                     /locus_tag="HVO_RS01310"
                     /old_locus_tag="HVO_B0269"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_006600083.1"
                     /db_xref="GI:493648508"
                     /db_xref="GeneID:8919065"
                     /translation="MSRLRHLRLEDTPFEAREFSLLWLIALATYGVGDIVTTLTILYY
                     ERRFDEANALLVASTDALGRWGLVLPKLAVFLLCLGICVYGARAGDKVLYYLPPVTLA
                     VIGAFATAFNLRLFVG"
     gene            complement(322163..323644)
                     /locus_tag="HVO_RS01315"
                     /old_locus_tag="HVO_B0270"
                     /db_xref="GeneID:8919252"
     CDS             complement(322163..323644)
                     /locus_tag="HVO_RS01315"
                     /old_locus_tag="HVO_B0270"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041268.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041268.1"
                     /db_xref="GI:490140920"
                     /db_xref="GeneID:8919252"
                     /translation="MVEYRPPRASLFPLPLSLASLLPAKLFGTLSPQFSQVVGRVFMV
                     FVVIGIVLVGTGFAAPGSIERFLDDRGINGVLSDLRGDDPEPSPPTVTVTPPPPPTPD
                     APPEETNQFEDPDTPTPASTPSATTTPNPPPSSPTPTPAPTSSPPPTTTARAGTGGGV
                     GGGGGGSGGGGSGGGGGGGGSGDSQTTTTAESSVSPDPTLTVEAADPATVRSVDGTVG
                     TLSGPVTGTLSWTGTVDSVVLVVNAWVPDDGWQEERRVTLRESSPVDIATALGSDVTY
                     AEGNRTAGFAATDDGETTVTTGYVSVTAVFFRDSTEVARTEETASFDVTVENTAGSAP
                     AGVDLELGSGGAGVSLLDTQSVAPGSAGNSTGTLTNRGRDPGVLTLESMPFESAENGR
                     SGPELAVDSTGGADEGELHEALAVRLRVERANGTSSYVLGNETTYLDFADVWNESVSL
                     GRLDGGESLSLVVEWQIREAAGNEIQTDSVDVEFVFALEQATG"
     gene            323559..324497
                     /locus_tag="HVO_RS01320"
                     /old_locus_tag="HVO_B0271"
                     /db_xref="GeneID:8919156"
     CDS             323559..324497
                     /locus_tag="HVO_RS01320"
                     /old_locus_tag="HVO_B0271"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041267.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041267.1"
                     /db_xref="GI:490140919"
                     /db_xref="GeneID:8919156"
                     /translation="MPKSFAGKSEASDSGSGNRLARGGRYSTTSAVSVGRSPGSTSSP
                     TSTGRVSVRGPSPSSEEDRSRSRSTSVASPSTPTNDADDGSQRRTARTTPWTGRRSPG
                     RQRTRSPRERRSKSTSSKHSASSSRSAADASTRRRHRVAVRRDHVGEGGRAAEAVVEH
                     VEAPDFERRHVEDAREVRHRGVRVAVVAGRGVAVVFGQREVDVETAVERPVVFEVDFE
                     SVGLVAGRETRGAETRGTGSVGEAQRPRLKRVLGARFVSLKRANVPTPAAALPAPIVR
                     SPPRARRRVSLNTLSAIEFSVRPTVHPLPSVIFWVG"
     gene            complement(324636..325424)
                     /locus_tag="HVO_RS01325"
                     /old_locus_tag="HVO_B0272"
                     /db_xref="GeneID:8919276"
     CDS             complement(324636..325424)
                     /locus_tag="HVO_RS01325"
                     /old_locus_tag="HVO_B0272"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041266.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="bacterio-opsin activator-like protein"
                     /protein_id="WP_004041266.1"
                     /db_xref="GI:490140918"
                     /db_xref="GeneID:8919276"
                     /translation="MTETTDETSADPVTVLLVDDNRDWLALVVQRLREEAPDFDVREA
                     NSPEGALDRLTDDVERVVSDYYMPGRTGIELLSEVREHRPDIPFLLFTGASNEGLASS
                     ALSAGANDYIVKTSSETAPRRSPHASERPSTSTGPSARLPRARRATGRSSRTSATPSS
                     SPATAASSSSTRRRRRSPATTARSYRTVESDIGASVLAGLTDRQRESLEVAYRTGYFE
                     RPKRRSAAEVAEAIGVSRSTFTQHLRAAHRKVFAELFDGERGGR"
     gene            325629..327335
                     /locus_tag="HVO_RS01330"
                     /old_locus_tag="HVO_B0273"
                     /db_xref="GeneID:8919373"
     CDS             325629..327335
                     /locus_tag="HVO_RS01330"
                     /old_locus_tag="HVO_B0273"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041265.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="histidine kinase"
                     /protein_id="WP_004041265.1"
                     /db_xref="GI:490140917"
                     /db_xref="GeneID:8919373"
                     /translation="MDWQYTVLVLPTLFAMSTAVLLGAYSLRHMQAHGQSSELVTFFA
                     VNVGLALWTGFAALKLLQTDPALKLLFYRFLYFGVAPLGALAFLFTLLHTDRISRITP
                     GLVAAVMTVPAVFLAVLFANPNGLAIEATRLVETNGLVVLRVDVGLGHVVLQLLYNAV
                     LSVLAIVLILYEAARLGRTYIPQAVLVSVGLAAPFVFVACSSLGIPPFNSDGVNLVPT
                     SAAVTSAAIGIALFRYRFLDLPPIAYTTAMEESPDGVFVLDADKRIVHVNTRGAALLE
                     RFGAAVGDPVTAVSPDLDLTTEQNDSIETTREGGEAVYLSARSQRLERGDQTVGWVIV
                     LRDVTELHRQKQTILSQNEKLTLLNQIVRHDIRNDMAVILGNAQLVEESVDDEALRER
                     LDTIIRNGEHATELTVNVRNLMATMLDDEETNRPTTLAGPLWAEASAVRDGTSEAAVS
                     LPGEPPDVTVVADDMLGTVFRNLLTNAVRHNDADRAEIDVSVEVRDDDALVRIADNGP
                     GIPDDRKEVVFGRGEKGLESPGTGLGLYLVDTIVSGYGGDVWVEDNEPRGAVFVVRLR
                     KA"
     gene            327435..327758
                     /locus_tag="HVO_RS01335"
                     /old_locus_tag="HVO_B0274"
                     /db_xref="GeneID:8919113"
     CDS             327435..327758
                     /locus_tag="HVO_RS01335"
                     /old_locus_tag="HVO_B0274"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034933.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidate cytidylyltransferase"
                     /protein_id="WP_049914730.1"
                     /db_xref="GI:909671376"
                     /db_xref="GeneID:8919113"
                     /translation="MAVLAAVAAVLVGLATLTDEPVGPVFAAMGLLTLVYMAAGAVDT
                     VREHPAFPLASAVYTTFLFAGGYVSGALSNLLWAVLAVLSAFGVVVEAYNYRHGTSYL
                     RLDFE"
     gene            327755..328153
                     /locus_tag="HVO_RS01340"
                     /old_locus_tag="HVO_B0275"
                     /db_xref="GeneID:8919025"
     CDS             327755..328153
                     /locus_tag="HVO_RS01340"
                     /old_locus_tag="HVO_B0275"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041263.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041263.1"
                     /db_xref="GI:490140915"
                     /db_xref="GeneID:8919025"
                     /translation="MTGPSETAVSGAIAATSVFVGLAVAFGGPQVNLAAGVVWTVATG
                     MVLLHLRGKVRDARSDESPEPGPLLRLAEIDYDPRYDRYLGVLLFALGIAAFAALLVV
                     DPSGWNALFLVDVGNCCLIAALGAVALSDR"
     gene            complement(328409..329380)
                     /locus_tag="HVO_RS01345"
                     /old_locus_tag="HVO_B0276"
                     /db_xref="GeneID:8919274"
     CDS             complement(328409..329380)
                     /locus_tag="HVO_RS01345"
                     /old_locus_tag="HVO_B0276"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061899.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_004041262.1"
                     /db_xref="GI:490140914"
                     /db_xref="GeneID:8919274"
                     /translation="MTATRRRLVLFVLTAFFFGGTFVAAKAGLDYLPPLLFVALRFDI
                     AAVLLVGYVVATRSRAELLPRSVRDVVGILATGVFVIGLANALLFVGQEHVSSGVGSI
                     IFSLNPILTPVFAMALLADERLSTRGVLGMLIGLLGVGLVVGVDPANLLDGEALWKGV
                     VFLGAVSGALGTVLIRWADTSLSSTVRTAWALPVSAALTHGMSVASGESLAAATWSPT
                     ALVALAYVGVFAGAVAYLTYFGFLDDVGPIRGNLVFYAVPIVATLGGTALLGESISTL
                     TVVGFATIFTGFAVLATESLRGTVVRVYDELGSRVAGLAGGAAPGRD"
     gene            329580..330368
                     /locus_tag="HVO_RS01350"
                     /old_locus_tag="HVO_B0277"
                     /db_xref="GeneID:8919162"
     CDS             329580..330368
                     /locus_tag="HVO_RS01350"
                     /old_locus_tag="HVO_B0277"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097237.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="WP_004041261.1"
                     /db_xref="GI:490140913"
                     /db_xref="GeneID:8919162"
                     /translation="MESALDEIEFLALSQNRVDALRYLAERPHSRRELVERTGASQPT
                     MGRILSDFEDRSWLVREDGAYRATVTGELVSRGFDDLVDILDTDAKLRPVVEWLPTDA
                     ITFDLEHLTEATITTPSQVRPNAPVKRAVSLLSEAEDVRIFSYAFNEQNLDIVRERTA
                     AGDQRFEGVFSSDAIDALAHDSQLREQLRDLLDADAAAVRITDEPIPMAATIADSTVH
                     LFLRDDSGILQASIDVTEPEVLTWADELFERYWEAAEPLDLDRL"
     gene            complement(330697..331314)
                     /locus_tag="HVO_RS01355"
                     /old_locus_tag="HVO_B0279"
                     /db_xref="GeneID:8919233"
     CDS             complement(330697..331314)
                     /locus_tag="HVO_RS01355"
                     /old_locus_tag="HVO_B0279"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572866.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase type 11"
                     /protein_id="WP_004041259.1"
                     /db_xref="GI:490140911"
                     /db_xref="GeneID:8919233"
                     /translation="MDADDNHRGWAERSGDFSPEYYAQIGPNEVSETLATVFEHYAAE
                     DASILELGCSSGRHLAHLHDRGYEDITGIDINDDSFEVMAEYFPELVDTGTFLTGAIE
                     DLLPDFPDDKFDVIYSVETLQHVHPDDTWVFEEIARVSSDLVITAENEGNGPTRGRSG
                     SEVSYVNDDFPLYHRNWKDEFSEFGLAQLLCEPGKRDTVRVFRVL"
     gene            complement(<331668..331859)
                     /locus_tag="HVO_RS01360"
                     /old_locus_tag="HVO_B0280"
                     /pseudo
                     /db_xref="GeneID:8919343"
     misc_feature    complement(<331668..331859)
                     /locus_tag="HVO_RS01360"
                     /old_locus_tag="HVO_B0280"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061893.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
     gene            332280..333530
                     /locus_tag="HVO_RS01365"
                     /old_locus_tag="HVO_B0282"
                     /db_xref="GeneID:8919105"
     CDS             332280..333530
                     /locus_tag="HVO_RS01365"
                     /old_locus_tag="HVO_B0282"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041257.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041257.1"
                     /db_xref="GI:490140909"
                     /db_xref="GeneID:8919105"
                     /translation="MPVKRVSGVGWTLVAALLVVAVAVSPVVVAADGVEVRAVDHGGP
                     GVVPTENGRPYVASWQPSTVSVTVAGDGNGTEVCLQTDRDDGSTMLLGCEPLGSAGAN
                     PTDERRVGFEFATWPANATGDRTVTAVVRPGDGGEPVAQASRGVTVLAPAGDADGDNL
                     GNRDELDRGTDVLVTDTDTDTDGVPDGEEVNRYETDPTSTDTDGDDLSDGVEINEQGS
                     NSTETDTDGDGRGDGAEVEAGTDPNAAPGAVVGSLELGGEGWLLVLAVAAIAVALLVV
                     GVRVRDSDARARLSDVRARAADHVDGRGDGASADAVQTGGGDSAARAQSAANSSPADG
                     SPAAEELLDDETRVLRLLDDNGGQLRQSKVVEGTEWSKSKVSRVLSRMADEGTVAKIN
                     LGRENLIARPESVPEHARSPFDES"
     gene            333644..334417
                     /locus_tag="HVO_RS01370"
                     /old_locus_tag="HVO_B0283"
                     /db_xref="GeneID:8919206"
     CDS             333644..334417
                     /locus_tag="HVO_RS01370"
                     /old_locus_tag="HVO_B0283"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572869.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004041256.1"
                     /db_xref="GI:490140908"
                     /db_xref="GeneID:8919206"
                     /translation="MREFVFTVEYERGADEVMDLFIENPDLHSKTMAIHATSESMWRL
                     DRLTGPTEALEAFDEVIEQATRCNGVLGMCGAPVVEWEYEVLSETPNGRIVYSCREEG
                     DGIQSIPHVAAKHIGDGLLMQAERRGAQNQWRLLISDDDTVSEIYEEVKDSLSDGLSL
                     SVQRISEPECWLEESVSADGLPPEQQAALEAAVEFGYYETPRQHTVQEISEELDIPNS
                     TLQYRLTRAEAWLARQFVTGTLGTEVEDRVDPEQLEASA"
     gene            334517..334819
                     /locus_tag="HVO_RS01375"
                     /old_locus_tag="HVO_B0284"
                     /db_xref="GeneID:8919309"
     CDS             334517..334819
                     /locus_tag="HVO_RS01375"
                     /old_locus_tag="HVO_B0284"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008611416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translation initiation factor IF-1"
                     /protein_id="WP_004041255.1"
                     /db_xref="GI:490140907"
                     /db_xref="GeneID:8919309"
                     /translation="MGKDTFSDITGLPDDLGIGDDLARADQRASIRVDTRRYGKPVTV
                     VDGLDLPADELDALASTLKRRLAVGGTVTDGRIELQGEHGERLEAALRDEGFGVER"
     gene            335020..336024
                     /locus_tag="HVO_RS01380"
                     /old_locus_tag="HVO_B0285"
                     /db_xref="GeneID:8919282"
     CDS             335020..336024
                     /locus_tag="HVO_RS01380"
                     /old_locus_tag="HVO_B0285"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097219.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription initiation factor IIB 2"
                     /protein_id="WP_049896026.1"
                     /db_xref="GI:909652613"
                     /db_xref="GeneID:8919282"
                     /translation="MRDESAPAAGPEARQSGDERDEGEAETESAEAAVAERTDLVYDE
                     QHGEWVDPETGEILREDEIDRGPEWRAFDAAERDQKSRVGSPTTTMMHDKGLSTNIGW
                     QNKDAYGNSLSTGQRQKMQRLRTWNERFRTRDSKERNLKQALGEVERMGSALGLPDTV
                     RETASVIYRRALDDDLLPGRSIEGVATAAIYAAARQAGVPRSLDEVRRVSRVDKMELT
                     RTYRYVSRELGLDMKPADPAQYLPRFVSELDVSDDVERRARSLLDNAKRQGIHSGKSP
                     VGLAAAAIYAGALLADEELTQSEVSDVTDISEVTIRNRYRELLEATQKSGERAVGSTA
                     "
     gene            complement(336166..336606)
                     /locus_tag="HVO_RS01385"
                     /old_locus_tag="HVO_B0286"
                     /db_xref="GeneID:8919163"
     CDS             complement(336166..336606)
                     /locus_tag="HVO_RS01385"
                     /old_locus_tag="HVO_B0286"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041253.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041253.1"
                     /db_xref="GI:490140905"
                     /db_xref="GeneID:8919163"
                     /translation="MSERTFRHASTLSDDARAESHRTDRPASESGDDADMDAADVQAR
                     SARTNRWCPTIRQGIALWAIIAVGWAVIPADHPMQIAVAISGVYASLLLPTALYFDYR
                     ERRAESSAEGRVRETAGALADRVRDALPGRGSSTRASSSCSCNR"
     gene            complement(336700..337218)
                     /locus_tag="HVO_RS01390"
                     /old_locus_tag="HVO_B0287"
                     /db_xref="GeneID:8919085"
     CDS             complement(336700..337218)
                     /locus_tag="HVO_RS01390"
                     /old_locus_tag="HVO_B0287"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041252.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041252.1"
                     /db_xref="GI:490140904"
                     /db_xref="GeneID:8919085"
                     /translation="MTDISDSLRLLFETSVERDGDRYVVSIPTELVENGSISTEELYR
                     VALLSSPHAASATEAAVESAAATTTETTATTTADDRDIDSDPARESAADTASGPREAH
                     SQPRQPPVAEGDVRSVIIDTLGDQGDGIAKVERGFVIIVPGTEPGDRVEVEVTDVKQT
                     VAFAEPVDGASV"
     gene            337368..337565
                     /locus_tag="HVO_RS01395"
                     /old_locus_tag="HVO_B0288"
                     /db_xref="GeneID:8919127"
     CDS             337368..337565
                     /locus_tag="HVO_RS01395"
                     /old_locus_tag="HVO_B0288"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572873.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041251.1"
                     /db_xref="GI:490140903"
                     /db_xref="GeneID:8919127"
                     /translation="MARDTLVSWQTFALFVLFPPAALVALVFFPLTLLVFGWLYYRGK
                     YESIQESDDEQTAVEPSDAAR"
     gene            337707..338765
                     /locus_tag="HVO_RS01400"
                     /old_locus_tag="HVO_B0289"
                     /db_xref="GeneID:8919196"
     CDS             337707..338765
                     /locus_tag="HVO_RS01400"
                     /old_locus_tag="HVO_B0289"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041250.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="biotin synthase"
                     /protein_id="WP_004041250.1"
                     /db_xref="GI:490140902"
                     /db_xref="GeneID:8919196"
                     /translation="MVYETGNPTVDDAVWRVLDGDELDRTDGIALIAQPVEPLAAGAD
                     YVRSVRSDGTVDACSIVNAKAGDCAEDCGFCAQSAHFDTGIETHGFLGAEAVLDAARR
                     AERDGAQRFGIVVAEKGVSKERRPDEWADVLEAIRLVRDETSVEIDASLGLLTEEEAR
                     ILADEGVNHYNHNIETSPRYFDEVVGTHDFEDRLVTLRRAKDAGMDLCAGVILGMGET
                     PADRVDAALELQKIGVESLPVNVLNPVPGTPLGDADHADITTTELVKTVAVYRLLHPD
                     ARVRLTGGREVNLAPDEQHLPFEAGADGVLTGDYLTTDGQSPAADIEVVERAGLEPNR
                     AVNDFDVDAVKRREARDG"
     gene            complement(338888..339652)
                     /locus_tag="HVO_RS01405"
                     /old_locus_tag="HVO_B0290"
                     /db_xref="GeneID:8919326"
     CDS             complement(338888..339652)
                     /locus_tag="HVO_RS01405"
                     /old_locus_tag="HVO_B0290"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008610349.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="fructose 1,6-bisphosphatase"
                     /protein_id="WP_004041249.1"
                     /db_xref="GI:490140901"
                     /db_xref="GeneID:8919326"
                     /translation="MVNDRYLWTAIRAAEVAGDELRARFESSSRERFRDRPADEAAEA
                     RITDVIAAAFPDDNVVSEEGSPEFRPKPRWVVDPLDGTVNFHNGVPHFSVSIMYEGAT
                     RPDVGVVNYVPADQLYVAIEGEGAFVNGRELSVSNAAELSEALVVTGFDSLARANGDG
                     AYLEALCESTRGVRRMGSAAAELALVAAGRFDVYFEQNLDMWDTRTGPLLVREAGGEV
                     THVEAIDDVTGDTVVASNQALHRQVISLMSRHSALG"
     gene            339767..340444
                     /locus_tag="HVO_RS01410"
                     /old_locus_tag="HVO_B0291"
                     /db_xref="GeneID:8919312"
     CDS             339767..340444
                     /locus_tag="HVO_RS01410"
                     /old_locus_tag="HVO_B0291"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerophosphodiester phosphodiesterase"
                     /protein_id="WP_004041248.1"
                     /db_xref="GI:490140900"
                     /db_xref="GeneID:8919312"
                     /translation="MLTIGHRGCAGQYPENTIPAIEGSAPHVDLVEVDVMRCGSGELV
                     AFHDDDLSRLTTAAGRLDETAVDDLTALRVDGSEATIPRFDQVVEAWPAGTGMNLDTR
                     DPGLVEDALAAVEGLDERVVFSSPSREAVDIALETPTPAEVGYSFRDDVSAELTWAAE
                     RGCEFVHVEHGLCTSSDLVERAHDAGLLVDAWTVDDEATATTLRSLGVDALTVDRWDV
                     VAPEACS"
     gene            340576..342057
                     /locus_tag="HVO_RS01415"
                     /old_locus_tag="HVO_B0292"
                     /db_xref="GeneID:8919018"
     CDS             340576..342057
                     /locus_tag="HVO_RS01415"
                     /old_locus_tag="HVO_B0292"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041247.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate ABC transporter
                     substrate-binding protein"
                     /protein_id="WP_004041247.1"
                     /db_xref="GI:490140899"
                     /db_xref="GeneID:8919018"
                     /translation="MSQYMPENGPIGERAETTNRAIGRTTSRRGFLATAGAVGVAGLA
                     GCSGGGGDSPTGTEGGSGSTEQSGTTAGTSGAQDVTVSFWHIFGGELGQTLGDMAAEF
                     SQQNDGITIEAVNNGGYRQNLNQSLQASRAGDPPGIVQIFEVGTRLALDSGSFTPVEE
                     ILPEEEIDFDDFLPSVLNYYRMDGTLNSMPFNSSNTIMLYNKTAFEEAGLDPETPPRS
                     LAEVRQAAQTIVDQTDMESGISWPNHTWMQVEQQFAKQDQVLVNQENGRDGRPDQTFF
                     NSEAGRSVYSWWKGMAQDGLYLNPGIEAWGEARQAFLTQKVPMLWDSTSNIVSMQSGA
                     KENGFELGSGYLPTPDGANTGVVIGGGSLWVPDALSDEKKQAAGEFIAYVTQTEQQAR
                     WHRNSGYFPVRQSSIDQLTDDGWFDNNPNFSTAFDQLQDTEDTPATRGAVMGVFPKTR
                     SINEEISVSIINDQLGVEEGLSRMDTQVGEALAGYNGNFDGSE"
     gene            342080..342973
                     /locus_tag="HVO_RS01420"
                     /old_locus_tag="HVO_B0293"
                     /db_xref="GeneID:8919150"
     CDS             342080..342973
                     /locus_tag="HVO_RS01420"
                     /old_locus_tag="HVO_B0293"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061879.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate ABC transporter
                     permease"
                     /protein_id="WP_004041246.1"
                     /db_xref="GI:490140898"
                     /db_xref="GeneID:8919150"
                     /translation="MSTATKPYDSTLQAALLLLPTAAVLVAFLYYPALETFRLSLYET
                     LFLGQRQTWTGLGNFVTLLTSGTYQYSFFITVAFAAVVVFGTLGVSLLIGYLIFSVDV
                     RSSVYLVAAIWPYALPPAVAAILLNFILHPNLGIFTHYLELLTPLTLDWFNDGPQAFA
                     ILAVVAVWKQLGYNIIFIVAALNNIPEILTENARIDGVGRFRMLYKVYVPMIAPTMTF
                     LVVMNTIYAFFSTFPLVDLMTSGGPSDATNFLIFKLYRDAFQFNSLGLASAQSVILFV
                     VVSVLMYIQLRFASGYGRYGG"
     gene            342978..343844
                     /locus_tag="HVO_RS01425"
                     /old_locus_tag="HVO_B0294"
                     /db_xref="GeneID:8919344"
     CDS             342978..343844
                     /locus_tag="HVO_RS01425"
                     /old_locus_tag="HVO_B0294"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041245.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sn-glycerol-3-phosphate ABC transporter
                     permease"
                     /protein_id="WP_004041245.1"
                     /db_xref="GI:490140897"
                     /db_xref="GeneID:8919344"
                     /translation="MATETDTTTFDAGRLAHRLPDDALLHGGIVFAILLMASPLLLAI
                     IMSTQSTTEVYQVTNLGLGSRGLSNYSDALVNYDFSTYMLNSFVMSVVVVVGKVTLSL
                     FAALALVYYRFPYERAVFMFILLTLLLPVPVRIVPLFQLMADLGWTNSLLALTGPYIA
                     SATAVFLFRQQFTGIPASLVEVARLDGVGPLTFLFRVLVPMSRGMIAGVCVITFIYTW
                     NQFLWPLVVVTDKSSQVVQVGIRYLQGSAQAGLTQWGLIMAGAVLALLPPLVVLVVLH
                     RPLLRTLTIQQK"
     gene            343855..344988
                     /locus_tag="HVO_RS01430"
                     /old_locus_tag="HVO_B0295"
                     /db_xref="GeneID:8919149"
     CDS             343855..344988
                     /locus_tag="HVO_RS01430"
                     /old_locus_tag="HVO_B0295"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572878.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter ATP-binding protein"
                     /protein_id="WP_004041244.1"
                     /db_xref="GI:490140896"
                     /db_xref="GeneID:8919149"
                     /translation="MSDITIQNLRKTYDDVRAVKGIDLEIEDGEFLVVVGPSGCGKST
                     TLRMLAGLESVTDGSIAIGDRVVNEVPPKDRSIAMVFQNYALYPHMTAAENMKFGMKS
                     ASEFSADEIERRVEDATETLGIAHLRDRKPKELSGGERQRVAIGRALVREPDVFLMDE
                     PLSNLDAKLRVQMRAELLKLHRDLDTTTVYVTHDQTEAMTLGDRVAVLEDGRLQQVAP
                     PQELYDYPTNQFVAGFVGEPAMNFVPVAVRRQRSELVAEAPGLSLTLPAGSGLDDVDD
                     DGLTLGVRPEDVSLVSNTAGASESFTAEVTVTEPLGELLLLHCRLGDEEIRVKVEPRS
                     RITAGDTVELAVDTDRLHLFDADGDAVYHSSVPERATESVVAD"
     gene            complement(345036..345437)
                     /locus_tag="HVO_RS01435"
                     /old_locus_tag="HVO_B0296"
                     /db_xref="GeneID:8919122"
     CDS             complement(345036..345437)
                     /locus_tag="HVO_RS01435"
                     /old_locus_tag="HVO_B0296"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041243.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041243.1"
                     /db_xref="GI:490140895"
                     /db_xref="GeneID:8919122"
                     /translation="MSESHAPSLDGRVFKSVANAESGDVGGDTHFWFDQSGDLIHAAY
                     RGGTVRLGHLVGRHRGDTLDFRYSHVTDDGTTATGHSTDRIERLEDGRLRLHEDWSWD
                     SKPGSGTSVLEDLTDEERAGLDLSPEAFDGR"
     gene            complement(345549..345734)
                     /locus_tag="HVO_RS01440"
                     /old_locus_tag="HVO_B0297"
                     /db_xref="GeneID:8919292"
     CDS             complement(345549..345734)
                     /locus_tag="HVO_RS01440"
                     /old_locus_tag="HVO_B0297"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034998.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041242.1"
                     /db_xref="GI:490140894"
                     /db_xref="GeneID:8919292"
                     /translation="MGVMSKLRRLLGLVEGHEDEVAKQVGKRTKVSEEKAKKGIEKAT
                     DAVKNGSDSGSGDRSSY"
     gene            complement(346327..346677)
                     /locus_tag="HVO_RS01445"
                     /old_locus_tag="HVO_B0299"
                     /db_xref="GeneID:8919120"
     CDS             complement(346327..346677)
                     /locus_tag="HVO_RS01445"
                     /old_locus_tag="HVO_B0299"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041241.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="5-hydroxyisourate hydrolase"
                     /protein_id="WP_004041241.1"
                     /db_xref="GI:490140893"
                     /db_xref="GeneID:8919120"
                     /translation="MSEGVTTHVLDTSSEGPAAGVDVTLQKLDSSGEAETVGRGTTND
                     DGRVDEPLLSGDAMETGTYQLLFEVGPYYRDGPTESSFLETVPVRFVVDDANEHYHVP
                     LLLSPGSYTTYRGS"
     gene            complement(346679..347665)
                     /locus_tag="HVO_RS01450"
                     /old_locus_tag="HVO_B0300"
                     /db_xref="GeneID:8919178"
     CDS             complement(346679..347665)
                     /locus_tag="HVO_RS01450"
                     /old_locus_tag="HVO_B0300"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572882.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="urate oxidase"
                     /protein_id="WP_004041240.1"
                     /db_xref="GI:490140892"
                     /db_xref="GeneID:8919178"
                     /translation="MTAQQSPVDGDAPDSGEQRTMNYGKENVAVYRTYATPLEGVRTI
                     PESSFDGRDNVLFGLDVRVQVEGEEFLPSFSEGDNTKVVATDSMKNFILHHAGEYDGA
                     TLEGFLEFVGSGFLDTYSQMSAVEVSADEIRFDELPVPEDDGDGYEASDLVFRVSDNE
                     SGYGSISLTRDDGTPVITDQTSGVTGLELVKVEGSSFTGYVQDEYTTLPEREDRTLYI
                     SLDIFWSYDDPEDALGEDPERYVPSEQVRDIAHVVFDEVDSNSIQDLIYQIGLRVLER
                     YPQLASVRFEANNRTWLSVRDDLDGDASVLREPPAPTGFQQFSMDRGDLDEQ"
     gene            complement(347763..348269)
                     /locus_tag="HVO_RS01455"
                     /old_locus_tag="HVO_B0301"
                     /db_xref="GeneID:8919056"
     CDS             complement(347763..348269)
                     /locus_tag="HVO_RS01455"
                     /old_locus_tag="HVO_B0301"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:D4GPU8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
                     decarboxylase"
                     /protein_id="WP_004041239.1"
                     /db_xref="GI:490140891"
                     /db_xref="GeneID:8919056"
                     /translation="MHELTLQQVNRLDDDSFVDAFGEIYEHSPWVAERARSSRPFSSV
                     DELRSAMKRAVEDASREKQLQLLRAHPDLGERTEMTDASEAEQASAELDSLSRSQYET
                     FQRLNETYRERFGFPFVMAVKDENPDAIAAAMERRVDHSESTEFRTALDEVHTIAELR
                     LAERFSSE"
     gene            complement(348353..349732)
                     /locus_tag="HVO_RS01460"
                     /old_locus_tag="HVO_B0302"
                     /db_xref="GeneID:8919211"
     CDS             complement(348353..349732)
                     /locus_tag="HVO_RS01460"
                     /old_locus_tag="HVO_B0302"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013034947.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="D-hydantoinase"
                     /protein_id="WP_004041238.1"
                     /db_xref="GI:490140890"
                     /db_xref="GeneID:8919211"
                     /translation="MTVDTILAGGTVVTDSRTLDAAVAVDEGRIVGVGDEDALPAGRN
                     RIDATGQVVMPGVVDPHIHVDDHVSIDTYRTVSSAAALGGVTTFIDFAWQAYEGADSP
                     WDEPATLSEGLERKRDQQEQSLVDFGLHGGILREDDAVFEEIPVLVDDGVTSFKMYTA
                     YEFGVSNGFLKRVFDRLAEHDAVGVVHSEDDSVCRALTAELRAAGEDAPETYPQSRPD
                     YAEAMAASDAVTLATEAGAKYYGIHTTCRAAADALARHREDGSRVRAETCTHYTTLDD
                     SVYAELGNLPKIAPPIRKEDDVEAMFEYLRRGVLSVVSTDHVASKRADKVDRPWWEGP
                     FGANGVQVSLPVFHDEAVNERGLSYPFLVRVMCSNPAETFGLPNKGTLEPGTDADIVL
                     FDPDETYTISADANASKADYSIYEGREVTGRVTKTLVRGEVVAADGEVVGDPGHGRFV
                     ERERPDWSA"
     gene            complement(349819..351243)
                     /locus_tag="HVO_RS01465"
                     /old_locus_tag="HVO_B0303"
                     /db_xref="GeneID:8919090"
     CDS             complement(349819..351243)
                     /locus_tag="HVO_RS01465"
                     /old_locus_tag="HVO_B0303"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uracil permease"
                     /protein_id="WP_004041237.1"
                     /db_xref="GI:490140889"
                     /db_xref="GeneID:8919090"
                     /translation="MTSTSADAESDSVVLYDIEDRPPLGEAVPLGIQHVLAMFLGNVA
                     PPLILAGAVGSVSGQTTFLVQMALIVAGAATLVQAFPIGPVGARLPIVMGTSFAFLGP
                     LIGIGQQFGIAAVFGTSLLAAPVELVMGVTLDRFQKYFPPLVTGIVVMLIGLTLIPTG
                     MNYAAGASAGPSAAGYGSFANLGLAGLVLVVTVVLNQFFDGFLRVISVFVGIVVGYVA
                     AIALGMVDFTAVATAGWITVPTPLRFGLEFPPSAVLTVAFLYVITGLETIGDISGTVS
                     ATGRNPTRKEFRGGLVADAVMSAFAALFNALPNTSFSQNVGLVSFTGVASRYVVGIGG
                     VVLVVLGFVPKVGAVVSVMPDAVLGGGALILFAMIFSSGARIITQNVTLDHRNSTILA
                     LSMAFGLGVAFRPEVLQNFPAEVQTLFGSALVTGGFTALALNVVLPGGGVGLGPTEHT
                     DGLDPEDLTELSSSESSPSAPVDD"
     gene            complement(351603..352019)
                     /locus_tag="HVO_RS01470"
                     /old_locus_tag="HVO_B0305"
                     /db_xref="GeneID:8919094"
     CDS             complement(351603..352019)
                     /locus_tag="HVO_RS01470"
                     /old_locus_tag="HVO_B0305"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041235.1"
                     /db_xref="GI:490140887"
                     /db_xref="GeneID:8919094"
                     /translation="MLQLEIGDRTFTAELHEDRAPASVEAVREFLPLESELMHVRWSG
                     IATWINIDEIDLPEIPRENHTVYPSRGDLLLYPGYRNEQEILVPCGPTCFKSPAGELA
                     GNHFATIDATAEELKAIEELTLREGVQDVVIREVSE"
     gene            complement(352046..353365)
                     /locus_tag="HVO_RS01475"
                     /old_locus_tag="HVO_B0306"
                     /db_xref="GeneID:8919361"
     CDS             complement(352046..353365)
                     /locus_tag="HVO_RS01475"
                     /old_locus_tag="HVO_B0306"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041234.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="amidase"
                     /protein_id="WP_004041234.1"
                     /db_xref="GI:490140886"
                     /db_xref="GeneID:8919361"
                     /translation="MTAPTRGSAGRVSFDIDGDSFREDIERTAVFGSVDTEHGRGRTA
                     LPADAANGRARDYLVSRLEAVGLDVRIDAVGNIAGRWTPDGVDPDAAPVAAGSHLDSV
                     PNGGIFDGPLGVYAAVEAVRSIRESDLTPARPLEVVCFTGEEGTRFADGVLGSTVAAG
                     KRGVDETLALTDGDVTLEDALDRVGYRGSGRLDASAWDAWVELHIEQNTRLGDAGVPL
                     GIVTDITGTARCHVSIEGQADHSGTTEMTARHDALAAASELVLEVERRAADIATTGSG
                     TAVGTVGELDVEPNVVNVVPGAASLRLDLRSVDREEIRLQLDAVERALDAVETHRGVT
                     TSFDCTYDVPPTPLSERCRRVATEASRACDIETLSLHSGAGHDTMQVADVTDAALVFV
                     ASENGHSHSPRERADWADCTAATEVLAGTLARLATTDDTETDDTERN"
     gene            354289..354765
                     /locus_tag="HVO_RS01480"
                     /old_locus_tag="HVO_B0308"
                     /db_xref="GeneID:8919160"
     CDS             354289..354765
                     /locus_tag="HVO_RS01480"
                     /old_locus_tag="HVO_B0308"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041233.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="WP_004041233.1"
                     /db_xref="GI:490140885"
                     /db_xref="GeneID:8919160"
                     /translation="MNGEDEQFAVSSGETLMETLRGAGYYGVKNGCDEGVCGACNVIL
                     GDEGVTRSCLVPAASCDGAEVMTVEGLADDDGGLHPLQSAFLEHGAAQCSYCIPGVLL
                     ASYDLLQRNDEPTESEVADGLSGNICRCTGYVQQIEAVQAAADRLSGSDASSEGSG"
     gene            354767..357130
                     /locus_tag="HVO_RS01485"
                     /old_locus_tag="HVO_B0309"
                     /db_xref="GeneID:8919255"
     CDS             354767..357130
                     /locus_tag="HVO_RS01485"
                     /old_locus_tag="HVO_B0309"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041232.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypoxanthine oxidase XdhD"
                     /protein_id="WP_004041232.1"
                     /db_xref="GI:490140884"
                     /db_xref="GeneID:8919255"
                     /translation="MPRSDTGDPETAAKSTSEARGDDAPVGESVEKVDGWGLVTGKAR
                     YTDDVPTDDALAAKVLRSPHAHARVRSIDTEAAETIAGVKAVLTHEDVPEDRFTRTGF
                     PYPAPAPFDERVLNETVRFVGEPVAAVAARTAEAAAAAVDAIEVDYEPYDHVLDAHEA
                     MGADAPTLHPEPYENPQENAAPERNVVCETRHEEGNVERGFEAADEVVEGEYETQAVH
                     HLPMETNTTIAWVDDRRRLVLRTTTQVSHICRDKIARVFGLNRTDVRVVKPRVGGGFG
                     VRQDTLPNQFIGAALALETGEKVRLKNDRKEDLHGAQTRHAQTVRVKTGVREDGTLTA
                     MHVDVTSNTGAYGCHASAVLMNAAHEPLSVYPCENRLFTGRAVYTNVTPGGAMRGYGA
                     VQGTFGIESHLDEVAAAIGMDPVELRRRNAVEEGDESFEPEYSESKRTLESVGVKECL
                     ERACETLGWADGPEEPADDRYQRGYGVALAMAKSGVPSSEFSRCNITLEDDGTLTVRV
                     GVGDTGQGSETVMGQIAASVFGLGIESVHVKADDTDATPWDNGAYASSTTYISGNATE
                     KAARDLAAKVRDLAAEWRGVAPDDVELADGEVRFPDGESMALERFASEAFQGIHGPKR
                     RLTGTGKHHTALSPKPFAAQLAAVEVDTETGEFEVRRLVNAVDCGRAINPAGARGQVI
                     GGAVMGLGQTVSEDLPLDDRGAPEFRGLRDYEVMHAPELPDIDTELVETDEPTGPFGA
                     KSVGEVSILGPPAAIANAIHDAVGVRATELPITPETVWTALQEDRDR"
     gene            357127..357996
                     /locus_tag="HVO_RS01490"
                     /old_locus_tag="HVO_B0310"
                     /db_xref="GeneID:8919375"
     CDS             357127..357996
                     /locus_tag="HVO_RS01490"
                     /old_locus_tag="HVO_B0310"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041231.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041231.1"
                     /db_xref="GI:490140883"
                     /db_xref="GeneID:8919375"
                     /translation="MTAFESVEYVEPETVSEAVERLADADEARVIAGGYSLVPLLKDG
                     IETPDRLIDVSGLNELRGITERGDGVAIGALVTHDEIATDATVAERARALADATDSVG
                     DFQARNRGTIAGNLVFADPKYDAPAAFLALGGRVVTLGPAGRRAIAADDWFRGPGTTA
                     LDGNELVTRVEVPSVERSGYVRTSEYSGYAVVGVAAAFETDDGVVRSARVAVNGAKPY
                     PVRLPNVERALVDEAVGRVVDGDGATEAATAALDDVETASLLANDAATEEYRRQLVRT
                     YCRQAIEQAASEP"
     gene            358112..359250
                     /locus_tag="HVO_RS01495"
                     /old_locus_tag="HVO_B0311"
                     /pseudo
                     /db_xref="GeneID:8919007"
     misc_feature    358112..359250
                     /locus_tag="HVO_RS01495"
                     /old_locus_tag="HVO_B0311"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572896.1"
                     /exception="annotated by transcript or proteomic data"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /pseudo
     gene            359247..359831
                     /locus_tag="HVO_RS01500"
                     /old_locus_tag="HVO_B0313"
                     /db_xref="GeneID:8919337"
     CDS             359247..359831
                     /locus_tag="HVO_RS01500"
                     /old_locus_tag="HVO_B0313"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041229.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine pyrophosphorylase"
                     /protein_id="WP_004041229.1"
                     /db_xref="GI:490140881"
                     /db_xref="GeneID:8919337"
                     /translation="MTRVGILLAAGAGTRFEPGNKLCQPLDGEPIVRRAARRLIESPV
                     DETVVVLGHDAERVRRALEPLETRLTVVRNERYDAGQSASVRRGAEEVLSRGGSVGVF
                     ALGDMPAVGSATYDELLAAIDRDDRHVVVPVYDGQRGNPVAFDAAALDRFGRLTGDAG
                     ARALFEAMPVARVAVDDPGIHADIDTVADLEAHR"
     gene            complement(360154..361146)
                     /locus_tag="HVO_RS01505"
                     /old_locus_tag="HVO_B0314"
                     /db_xref="GeneID:8919054"
     CDS             complement(360154..361146)
                     /locus_tag="HVO_RS01505"
                     /old_locus_tag="HVO_B0314"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041228.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sugar ABC transporter permease"
                     /protein_id="WP_004041228.1"
                     /db_xref="GI:490140880"
                     /db_xref="GeneID:8919054"
                     /translation="MVSFAAGLLNATVQAATVLLLAGLGELISERAGVLNLGVEGMML
                     VGALGGFVVTAVTGNYWLGFGVGIACGMALAAVHAFLCISLKSNQVISGVMLTLLGTG
                     LTTFFGSGWVQESITGFPQMTFPIVGRYLVHLPLVGEAFFRSTATDYLALLAVPVVWF
                     FLYRSNLGLEIIAVGEDPEMADTMGVPVFKFRYLAVIIGGGFAGAAGAHLSLAFSQLW
                     VPGMTVGRGWIAVALVVFAQWRPSRMLVGAYLFGLLDALQLRSQSLSLALDPNAPLAG
                     VLNPLVNTLMNPQIMSTYPYLTTIAVLSYAVIRTESVRLAVPSALLQSYNREMD"
     gene            complement(361140..362282)
                     /locus_tag="HVO_RS01510"
                     /old_locus_tag="HVO_B0315"
                     /db_xref="GeneID:8919186"
     CDS             complement(361140..362282)
                     /locus_tag="HVO_RS01510"
                     /old_locus_tag="HVO_B0315"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:D4GPW2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose ABC transporter permease"
                     /protein_id="WP_004041227.1"
                     /db_xref="GI:490140879"
                     /db_xref="GeneID:8919186"
                     /translation="MNVELQLDPRRTVPAWLAYGTPVLTVLAALAVGGVALVALNVDP
                     VDAYGVMFVETLTSQFGLTEVLVRAVPLILAGLAVYLPLKAGLFNIGAEGQLLLGALA
                     GTWVAVNVSLPAVALLPLMFLAACVAGAFWAGIPAWLRAKWDVNEIITSLLLTFVAQE
                     LQSYLLRGPMQGGTGNFPQSARFSDAATLPPLAGLVPGGESIPLFADVHAGLLVAVAA
                     VVATYVVMTKTRLGFEVTFVGSNDEAARQAGMSRHTVYLFVFLLGGAFAALGGIAEIA
                     GSQGRFRAAFAPGYGFTAIPIALLGRNSAVKVTLAGLFFAVLFVGGSSVEVAFGVPAA
                     LVEIIQALVILFLITSEFFKRYRVGIAFDRRGNDAPADATGGDARW"
     gene            complement(362279..363931)
                     /locus_tag="HVO_RS01515"
                     /old_locus_tag="HVO_B0316"
                     /db_xref="GeneID:8919244"
     CDS             complement(362279..363931)
                     /locus_tag="HVO_RS01515"
                     /old_locus_tag="HVO_B0316"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:D4GPW3.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter"
                     /protein_id="WP_013034986.1"
                     /db_xref="GI:502800010"
                     /db_xref="GeneID:8919244"
                     /translation="MTREPFLRMENIVKAFPGVVANDHIDLTVERGEIHGLLGENGAG
                     KSTLMKILYGLYSQDDGEISLSGTRLRLDSPQDAIDAGIGMVHQHFMLIPRLTVAENV
                     VLGEREPATPFRPDADAGGWLPDAVRSNSLVQSLAGRFSLGLDVPERRIQELADRYGF
                     DIDVSAKVWELGVGQQQRVEILKALYRDVDLLILDEPTAVLTPTEADLLFDSLERLTD
                     EGVSIIFITHKLEEVEAVVDRVTVLRDGENVGTVSTSDVSRADLAEMMVGREVLFTVD
                     RERVAPGEPVLRARNVSATDDRGIEALSNVDLTVRRGEVVGIAGVSGNGQKELAEVIA
                     GLRTVSAGELTVDGRDLTNASPRTFIDNGVSFVPEDRNRYGSAGDLSVMHNAAMKDFR
                     EDRFGSGVTLDYGELRAHAEALVEAFDVRGVHDVTDATAGDLSGGNLQKLILAREISR
                     DPDLLVANQPTRGVDVGAIESIREAILDQRTEGTGVVLLSEDLDEIIDLSDRILVVYE
                     GEVVYETTPEDADRERIGLEMTGGGDATATAGAQVRGLGGSS"
     gene            364128..365807
                     /locus_tag="HVO_RS01520"
                     /old_locus_tag="HVO_B0317"
                     /db_xref="GeneID:8919291"
     CDS             364128..365807
                     /locus_tag="HVO_RS01520"
                     /old_locus_tag="HVO_B0317"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adenosine deaminase"
                     /protein_id="WP_049914729.1"
                     /db_xref="GI:909671375"
                     /db_xref="GeneID:8919291"
                     /translation="MSDEPVDLLVSGNLVNVDTGTVSESFVAVDDGRIVALEERPAAR
                     ELDAEYIAPGLIDAHMHVESSMVTLPQYADAVVPRGVTSVVHDPHEIANVSGVAGVEA
                     MMADATRTPLKVRFTVPSSVPATTLQDGGATLDAEAVDALLGEDEVVALGEVMNVPGV
                     VAGDDSVHEKIRAARDHGLTVDGHAPRVRGSDLQTVARYLDNDHESISLAEAREKVEA
                     GLRVYLREGSASKNLADVVGLVDEVGSRRLSLCTDDRDVVDLVERGGVDFAVRKAIRL
                     GVDPVEAVQMATVNTAESYGLPFGRIRPGAPADLVLLSDLRTWEVDHVVVDGAVDPTK
                     GGGAPPASAIATGTVRFEPVSAADLAVRHAGDYPVRVRVIDAVGGLQTGRAEADVPVA
                     PVNEERVLTANADDDVLPLAVIERHGEAGGIGRGFVRGLGLERGAVGSTVAHDAHNCI
                     VAGVDHDSMATVANHLRDVGGGVAAYDPEDDALSSLALPMGGLMSDESLGTVKETFES
                     VEATADDLGLDRDGGLMALSFLALEVIPTYRLTNNGLVDVESFEYVPTVID"
     gene            365977..367152
                     /locus_tag="HVO_RS01525"
                     /old_locus_tag="HVO_B0318"
                     /db_xref="GeneID:8919116"
     CDS             365977..367152
                     /locus_tag="HVO_RS01525"
                     /old_locus_tag="HVO_B0318"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:D4GPW5.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glucose ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004041224.1"
                     /db_xref="GI:490140876"
                     /db_xref="GeneID:8919116"
                     /translation="MLDEESSIQRRDVLSALGAAGVTTLAGCTGGDTGDTDDTEASET
                     TASEGTTSGTTTGDVETTDGGGPSEGETVNAAWVYISEIGDLGWSWAHDQARQAVDEQ
                     YDWLETEYTEAVAPSDSERVFEQYAQGDVDVIFGTTFGYQDPMYAVAEDYPDTVFEHA
                     TGYRTRENMGRYMGRIYEPRYLAGQATGMVTENNTIGYVAAFPIPEVVRSINAMALGA
                     RSVNPEATFKVRWVNAWFDPPTAREAANALIDEGCDVIAQEQDSPAAVRAASDAGVWT
                     SGYNAPMGQFGGENYLISPIWDWTEFYGPTLESLHEGSWEADAFWGGMETGVPMLDEW
                     GPNVSQEVKDQVAATEEQILNDELDVWAGSAFEGESDEFLFQEMSSFVEGVEGEVPS"
     gene            367486..368280
                     /locus_tag="HVO_RS01530"
                     /old_locus_tag="HVO_B0319"
                     /db_xref="GeneID:8919332"
     CDS             367486..368280
                     /locus_tag="HVO_RS01530"
                     /old_locus_tag="HVO_B0319"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605613.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004041223.1"
                     /db_xref="GI:490140875"
                     /db_xref="GeneID:8919332"
                     /translation="MKQTGQKGGPRTLKTVTTASRVLDAVKDCDGIGVSELSDYLDIS
                     KSTAYIHLRTLEENGLLVQRGDRYRFAFKFTVLGEYARNQSPLYRYGKPEVEKLAAET
                     DQYTHIVTEENGYGVNLYQVKGDTSVDGEYQTEKVQSQDHLHYTASGKAILAALPDER
                     VEKIIEQRGLPAQTKATITDREALFDELEQIRERGYAYNDEEEIRGFRAIGAPIEDPS
                     GQVLGSVSVSGPTSLLQGEQFQEHVPKLVTQSANVIEVNINMNAQS"
     gene            complement(368668..369435)
                     /locus_tag="HVO_RS01535"
                     /old_locus_tag="HVO_B0320"
                     /db_xref="GeneID:8919250"
     CDS             complement(368668..369435)
                     /locus_tag="HVO_RS01535"
                     /old_locus_tag="HVO_B0320"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041222.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ArcR family transcriptional regulator"
                     /protein_id="WP_004041222.1"
                     /db_xref="GI:490140874"
                     /db_xref="GeneID:8919250"
                     /translation="MPTDNSPKTLRTTATSIAILKQLEAIDGARVSEIAERMDKPKST
                     IHGHLATLKQEQFVIKEGDFYFIGPELLRLGNQVRTREPAFVLARQFTERLFEETRLR
                     SIFTVEMGGKAVFLHTASGSKMGWSHEQLGNRLFLHNTAVGKAILAELPEPRIEQILD
                     RWGLPQETENTTTDREALFEELERVREQGYAVNRAENFNELYAIGVAATRRSGDVIGG
                     FSVTGPAHSVTGEDRKAELAHTVKDIVSEFELELALA"
     gene            complement(369539..370645)
                     /locus_tag="HVO_RS01540"
                     /old_locus_tag="HVO_B0321"
                     /db_xref="GeneID:8919281"
     CDS             complement(369539..370645)
                     /locus_tag="HVO_RS01540"
                     /old_locus_tag="HVO_B0321"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-dependent dehydrogenase"
                     /protein_id="WP_004041221.1"
                     /db_xref="GI:490140873"
                     /db_xref="GeneID:8919281"
                     /translation="MGTNIGYIGIDHHHRDPYFAVASELDATITAVCEPGRRVDVENI
                     AAMDDRPDEITTEGQDMADLVGGAAVYEDPHELVSDADVDVAWITYRSDETPEIIESA
                     VENGVHVVSEKPIARTAADLEDIAERANELGVTVSPTMYYRRNPVAMALRDRVSEGFF
                     GDVWTLDGRFNASQLSYRDTDHYLYDRETSRGGALQWIGPHWVDVMPWILDDPIARVN
                     ARFHDAVEADVEAGAVLQFETESGTLGTYHTGYYLSDRGKDTHLGLYGTEGQALTPLH
                     HDSLQHEPTVPLDITSEHPDWTAAPKRTVEFEFTYDRFPAWGDFVQDYFEDYFAGYET
                     GDVPATADDAVQLLRVLDAAYESGERGGWVEVEG"
     gene            complement(370745..372736)
                     /locus_tag="HVO_RS01545"
                     /old_locus_tag="HVO_B0322"
                     /db_xref="GeneID:8919188"
     CDS             complement(370745..372736)
                     /locus_tag="HVO_RS01545"
                     /old_locus_tag="HVO_B0322"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pectate lyase"
                     /protein_id="WP_049914727.1"
                     /db_xref="GI:909671373"
                     /db_xref="GeneID:8919188"
                     /translation="MQGGGDDIWGTADAFHYYYTELSGDFDVAVQNTGIDNVESWTKA
                     GPMVRESLDPDSKNVMVRRRPNGEASMQYRPEDGAETDSVGGTPADWLRLKRSGDAIE
                     TYHSTDGETWTSINTLDAADISLGDSVYVGLAVTSHLSGTLATATFQSLSGVDPDRNR
                     DIGDVEVAGSVENTTGVPLVSTGDVTDIGPGSATLTGDLGDLGGADSAECYFEYREVP
                     TESWKTTDSTELTSSGAFSVDADDLTRRRYYEVRAVADTADGDTARGSVSTFNTPNPS
                     NSKVPAHPGPDSVSHFGPSDGFAEAAPWLDDDTPIIVITEPTRRQLEKAVTIDGERLV
                     VFETSGTIDLGVRDLPIPYDKCYIAGQTAPSPGVTLVKGRVNIGASDCVLQHVRVRLG
                     DAGIEDATEDWALDTVNTADETTNNVIDHVSASWSVDECLSVGYETAETTVSNCLVAE
                     ALDDSVHPKGEHGYGSLIGNDAKNVAMLGNVWAFNTDRHPRLKEGTQSVVVNNVMYDF
                     EDGTWLDPDTEASIVGNAYLRPNSDKANVFTEDDVDTAVAYLEDNLTDGDVAMVDENV
                     TVVDERPLWPDGLAAMSSDRTFDHNLANVGARPADRTATDERILENVEGGESYLVDSQ
                     EQVGGYPDLPVNSHELNVPNGGTRPWLRSWSRRVETPQR"
     gene            373220..374368
                     /locus_tag="HVO_RS01550"
                     /old_locus_tag="HVO_B0323"
                     /db_xref="GeneID:8919082"
     CDS             373220..374368
                     /locus_tag="HVO_RS01550"
                     /old_locus_tag="HVO_B0323"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008605609.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004041219.1"
                     /db_xref="GI:490140871"
                     /db_xref="GeneID:8919082"
                     /translation="MQELGIIMNGVTGRMGTNQHLIRSIVALREEGGVELPSGERVMP
                     DPLLVGRNERKLRELSEEHGIDRWTVDPDLETCLDGDDEVYFDSQITPRRPDSVMKAI
                     DAGKHVYCEKPLASDLSAALDVAGMAEESDVKHGIVQDKLWLPGLLKLQRLIEQDFFG
                     DILSVRVEFGYWVFTGHGQEAQRPSWNYRAEDGGGIVDDMFSHWSYVLENLFGEVESV
                     RCLQKTHIDERIDEDGEPYEATADDAAYAIMELEDDIVAQLNSSWTVRVNRDDLLEIQ
                     VDGTEGSAVAGLRDCKTQGHANTPKPEWNPDTPKEHDFYEDWTGVPNNRVFENAFKLQ
                     WEKFVRHVVADEPFPWDFTAGARGVQLTEASYRSSEEGRRVVLDDLSV"
     gene            374393..375769
                     /locus_tag="HVO_RS01555"
                     /old_locus_tag="HVO_B0324"
                     /db_xref="GeneID:8919358"
     CDS             374393..375769
                     /locus_tag="HVO_RS01555"
                     /old_locus_tag="HVO_B0324"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572929.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041218.1"
                     /db_xref="GI:490140870"
                     /db_xref="GeneID:8919358"
                     /translation="MSNSAVEFRMHTDGDENPVDWLSVPEDVILEACGNPSLPELGII
                     EQVWETNPIPAADVPEAAAKAVAALSFAAVPEGGEVALGVGSRGIANIPDIVAGVVDA
                     VSEAGYEPFVFPAMGSHGGATGDGQREMLNELGITEERIGCEIRSSMEVVEVGRTPDR
                     DVPVVADANAAGADAIIPINRVKPHTDFDGEVESGLSKMLVIGMGKQRGAQIAHKWAV
                     DWSFRRMIPEITEQLLDSLPIVGGVAIVEDQHDDTTLIEGVPPSGFLDRERELLETAY
                     ELMPKLPFEELDLVVFDRQGKEISGQGMDTNVIGRRPFSINEPAPEKPNIKRIYTHGL
                     TEKTHGNAMGVGSADVIHEDIVAELDAQTTLINALTASTIRGVKLPPVVETDRAGVVA
                     ALSTIGVVEPDTVRVVRAADTMHLHRLYASPALVEEARERDDLRVVEDPTPIAFEDGQ
                     FAAPSLRD"
     gene            complement(375818..377356)
                     /locus_tag="HVO_RS01560"
                     /old_locus_tag="HVO_B0325"
                     /db_xref="GeneID:8919225"
     CDS             complement(375818..377356)
                     /locus_tag="HVO_RS01560"
                     /old_locus_tag="HVO_B0325"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971557.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 28"
                     /protein_id="WP_049914710.1"
                     /db_xref="GI:909671356"
                     /db_xref="GeneID:8919225"
                     /translation="MTLEQRNVRDYGIEDDDSLDTAAIQAALDDCAGEGGEVYLPPGT
                     YRSAPLRVGDDTTFRLANGAELRFVQDFTEFPTVESRWEGWDQDGFHPCLHVADASNV
                     TITGEGVIDGGGSYWWVFVSLPPEQYPSELAARLEEIRSGNQQDEVSTFTVRPPLLQI
                     DGCENVTVSGVTLRNSPFWNTHVVYSDDVTIHDVSIQNPPDAPNGDGIDIDSSRFVRV
                     SDTHIDAGDDAICLKSGKDEQGREVGRPTENVVVTNCTVEHGHGGVVIGSETAGDVRH
                     VTVTNCTFTDTDRGIRIKSKRGRGGTVEDLRFDTIIMRRVACPFVINGYYQTDIDSDP
                     KPVTEATPNVRNVDFHHITAEEVESAAFLAGLPEQRFEGISFTDVDIDATRPFDASDL
                     SPAMAKGYDQRHGVFCKSLGRVSFKDVRVTVPDGSGTPLTAEASSTVVLDGFEAEADE
                     GPAVEADGVENLRIGGCVAPDDGEPFARVRGESDGESSVLLAGNYGDMDEAVVSVQPE
                     TVER"
     gene            complement(377474..378460)
                     /locus_tag="HVO_RS01565"
                     /old_locus_tag="HVO_B0326"
                     /db_xref="GeneID:8919147"
     CDS             complement(377474..378460)
                     /locus_tag="HVO_RS01565"
                     /old_locus_tag="HVO_B0326"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041216.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041216.1"
                     /db_xref="GI:490140868"
                     /db_xref="GeneID:8919147"
                     /translation="MTGFDYDDWFDDVLRATDGSAAYAGETGQEFEAWQESFRAELRD
                     VLGFPAVRDSAVEDIDPRRREHPEATVRHRSYERRTWSVRTERGFRVPFYLLLPDSVD
                     PPYPVAVALHGHTEHGKDLAAGVAEGEAAGRHIADDRRDMARQAARRGFAVVAPDMRA
                     FGELSPDTSDDSDSSDAVSACTRWQKRAQLLGRSLVGERVWDVRRLVDFVEGHSALDD
                     RIGHVVACASVCPFEDSIVPIDHCLCNYVPGLRRLGEAWDIAGLVAPRPLRIVAGESD
                     PIFPIAGTRRAFDRIQGRYRAADAERECSLFVGDGGHRFFEAGAWPFLRDRL"
     gene            complement(378951..379142)
                     /locus_tag="HVO_RS01570"
                     /old_locus_tag="HVO_B0327"
                     /db_xref="GeneID:8919143"
     CDS             complement(378951..379142)
                     /locus_tag="HVO_RS01570"
                     /old_locus_tag="HVO_B0327"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041215.1"
                     /db_xref="GI:490140867"
                     /db_xref="GeneID:8919143"
                     /translation="MLWTSVLSFTLLIVVLGLLAMTGIERGTASYVVLMMDFALAGVL
                     LATVGVVFWRCGYLSDALD"
     gene            379348..381444
                     /locus_tag="HVO_RS01575"
                     /old_locus_tag="HVO_B0328"
                     /db_xref="GeneID:8919044"
     CDS             379348..381444
                     /locus_tag="HVO_RS01575"
                     /old_locus_tag="HVO_B0328"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041214.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter substrate-binding
                     protein"
                     /protein_id="WP_004041214.1"
                     /db_xref="GI:490140866"
                     /db_xref="GeneID:8919044"
                     /translation="MDSQSSAESDKWISDDEWEDVSPQTRRRLLRNAFGATAGAAALA
                     GCSQGGNEDTPTPLENEGGGGESTTTDGDSTSQSSGRTLDHIISLAPTNARFNPYGNA
                     ANFSFRWYWAMFDQLAVHDKVSNKTKGMVVEDWEYADNGQVAWNIRDTYTWHNGDDLT
                     AEDVATQLKIGKLMQTVHKGYGAQPLYENVETTGKYELTFDLVEPDISREIFEFGHMK
                     RRAWLWAHRDIWGKYAEMFDDATTESERTSAQQEMMQAVQQNVWDNANVPGNSVWEFV
                     SGEENVAHFEPYDDYVSPFSDAEWSNGEITGDMIDYSLDWHRYPNQQQRTKAMQEGVI
                     DVSYPPESQSARDRLKENGWGPADSLSEDQITPQMRSGAMGVLLNCQSDITGDPRVRK
                     AIHHIVPRKPLVEWVPDYGTYWVEDRIPSGIGQDKEVPWFGGNSNWPSGDLAKLERYA
                     HTEDDVDEQRATELLEAAGFSKSGNRWKDPNGENVTLRFYTATSDEEPMALRFAQIAK
                     SYLDDFGLQTEVTAQEATIRAGKTIESGDWELLFDNWGGAKSGPPFLGFSNSFRVQES
                     LSGQPLPSNDSWAMDRVVEVPYPIGDPAGDLQEVDVIDKLNELRTQMSDEERRQKVAE
                     VSWIFNQSLPMMLINEEGGTGGYWLNHDNWATKPPNDNLNPAYRYEIVEIGQYSYCQY
                     MAKMGTEYFHPAEGGQ"
     gene            381652..383778
                     /locus_tag="HVO_RS01580"
                     /old_locus_tag="HVO_B0329"
                     /db_xref="GeneID:8919272"
     CDS             381652..383778
                     /locus_tag="HVO_RS01580"
                     /old_locus_tag="HVO_B0329"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971552.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter permease"
                     /protein_id="WP_004041213.1"
                     /db_xref="GI:490140865"
                     /db_xref="GeneID:8919272"
                     /translation="MVEKNYYVRRIAQALITVWAAITFSFVTVRLIPGGPMDYIAAQI
                     RQRSGGAVSSTRLNQMVEMYSNINPDKPMLQAYVEYIVSVAQLDFGRSIFYADPVWNV
                     LGPAIPWTMFVSLFALVIGTIMVFLIGGFLAVHEGDTWDVVGSYFVIFSDAVPYYIVG
                     LVLLFTLGFGTEFFPNGGRYDNALTPGFNIEFMASVLRHAALPIMSFALTSWGGLEFR
                     AHCTRIIGEDYVDVAELRGLPDSRIQLRYIGWNSMLPMYTGLMAGLASLFGGSVIMEQ
                     IFRYRGMGFYFYEATMARDYTTVMAAVILFTIVTVIGLLIADFTYGFIDPRAGHTQRE
                     SYSRSYRETLQRFVNRLRGGGADETETIDDRIEGNRISASGAMSFDVDSSDFSRGEYI
                     RERIDQSLLTPFRIIWTSPRARVGAIILGIFGFLGLFGQFLVPEVSPMQGPILLQPLE
                     NVRYPLGTDDIGRDLLAQQVLATRPMLIMMLSGAAVTLSLAILLGVTAGYLGGVIDKV
                     LMTVTDVMMNIPGLALVIVLAVILEPKSPVFVGVVLAIDNWPRLARQLRSQVLTIRSE
                     SHVEASRVLGLPTSSILSKNVMSRLMPMLTMGTVGSMRNILMESVGLYFIGVLPFTTS
                     NWGVVLNIARNGGALSGMDRFHWLLAPTLFIVTMTYGLQLFAQGTDRLFNPRLRARHA
                     ATVSTDDMEGGRGGSEGGDGAASAAD"
     gene            complement(384012..384230)
                     /locus_tag="HVO_RS01585"
                     /old_locus_tag="HVO_B0330"
                     /db_xref="GeneID:8919356"
     CDS             complement(384012..384230)
                     /locus_tag="HVO_RS01585"
                     /old_locus_tag="HVO_B0330"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041212.1"
                     /db_xref="GI:490140864"
                     /db_xref="GeneID:8919356"
                     /translation="MAQAQTRQNVLWTVRSKIGGVTSTVVFLGALLILFGAALQTGVW
                     AGMFGIIGGLLVFVAVAFRVLLWAYRLF"
     gene            384446..385507
                     /locus_tag="HVO_RS01590"
                     /old_locus_tag="HVO_B0331"
                     /db_xref="GeneID:8919087"
     CDS             384446..385507
                     /locus_tag="HVO_RS01590"
                     /old_locus_tag="HVO_B0331"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971549.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004041211.1"
                     /db_xref="GI:490140863"
                     /db_xref="GeneID:8919087"
                     /translation="MATQHTKRKTRDEPSAEHNVLEITNASVAFAMERGDARVLDDVS
                     INVRRGEVLGVVGESGSGKSMLADSMLDAIDSPGTLTGDVVFNPPEGGEPIKVNELSK
                     EELRRFRWERVSMVVQGALDSFNPTLSIGDHFVETLRAHDYDIQEGMERARQLISDVH
                     LEPDRVLDAYPHELSGGMKQRALIALSLILDPDVLVMDEPTAALDLLMQQSILKLLSE
                     LKAEYDLTIVIVTHDLSHVARISDRLAVMYAFELLELGPVQDIVMDPAHPYTRELLNS
                     IPDIDADLDEMASIEGTSPDPLNVPKGCSYHTRCPLADERCRATNPDLMEVSDDHGAA
                     CFYTDEARETIPLKKEVSK"
     gene            385504..386619
                     /locus_tag="HVO_RS01595"
                     /old_locus_tag="HVO_B0332"
                     /db_xref="GeneID:8919307"
     CDS             385504..386619
                     /locus_tag="HVO_RS01595"
                     /old_locus_tag="HVO_B0332"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572946.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide ABC transporter ATPase"
                     /protein_id="WP_004041210.1"
                     /db_xref="GI:490140862"
                     /db_xref="GeneID:8919307"
                     /translation="MSADPLLRVDDLSVHFGGNQGILDRFLGDDKGVVRAVDNVSLDI
                     GENDVVALVGESGCGKTTLGKAMIGLQRPTSGTVRFRGQDIWKSDLEPGDIPYKEIRK
                     SLQMVHQDAGNSLDPNRTIFKNLNPALKKWRPELNLVERRELVHQMLDTVGLTPADDY
                     ASRYPHQLSGGEAQRTVIVRSMLLEPDLILADEAVSALDVSLRVNLMDLLLELQEMFS
                     TSFVFISHNMANARYLAGRADGRIAVMYLGRIVEIGPADEIIKNPQHPYTKSLLWATS
                     GLSEINDPIETPPVRKIDIPDPENPPSGCRFHTRCPEAREYCTSNTPDLSGMSGPSDR
                     HEAACFDAHDRIDYRNSEPITDDLDIDVADDAEQPAD"
     gene            complement(386757..387875)
                     /locus_tag="HVO_RS01600"
                     /old_locus_tag="HVO_B0333"
                     /db_xref="GeneID:8919310"
     CDS             complement(386757..387875)
                     /locus_tag="HVO_RS01600"
                     /old_locus_tag="HVO_B0333"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041209.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004041209.1"
                     /db_xref="GI:490140861"
                     /db_xref="GeneID:8919310"
                     /translation="MERVTLGIIGCGAISDVYFEAGNRFDALDIAACADLDADRAEAK
                     ADEYGVPRVLATEDLLADPVIDVAVVLTPAGTHGDLVSAALRAGKHAYTEKPLAATKA
                     EGEAILETADERGLTVGVAPDTVLGTGIQTCRDLIDEGRIGDPVGATAFWSNHGHEHW
                     HPDPDGFYAEGGGPLFDMGPYYLTSLVTLLGPIRSVAGTANTPFAEREITSEPRRGER
                     IPVSVPTHETAVVTFESGATGTLLTSFDVWGSELPGFEIYGTEGTLSVTDPNRFDGTP
                     RVHLSDDGGEWREISVERDHPGQQRGLGLVDLAYSLDSDWDHRTSGDLGFHVLEAMDG
                     IRESAEEGAYVELSAQCERPPSVPNGFPTDLGPAGDAE"
     gene            complement(387954..388988)
                     /locus_tag="HVO_RS01605"
                     /old_locus_tag="HVO_B0334"
                     /db_xref="GeneID:8919227"
     CDS             complement(387954..388988)
                     /locus_tag="HVO_RS01605"
                     /old_locus_tag="HVO_B0334"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572949.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041208.1"
                     /db_xref="GI:490140860"
                     /db_xref="GeneID:8919227"
                     /translation="MTETPVRVGIVGCSSMGRSHAEALAAVDGADLVGCADHTAETAR
                     SFGETYGCPSYTDHAALLADADLDAVCVCTPNGAHRDIVVDAAADGIDVLCEKPLEIT
                     PDRVDDMVAACRDAGVTLACILQRRLFPTMQFAREMVRDGRLGRLVFADVRVKWHRDR
                     SYYDVSSWHGSADLDGGVLFTQALHGIDLLQWVAGDVSRVAGTGDALYHDIDAPDTAA
                     LSLRFEGGALGQVSATTATRPQQPISLEFNGTEGTLRVTETGVELFEVNGEQQPVELP
                     EPRPDGPHVAQIRDFVAAVSEGRPPMVSPAAARKGLDIVFAAEVSDSRGEWVSVSSIG
                     GLGNLEDADD"
     gene            complement(389121..390260)
                     /locus_tag="HVO_RS01610"
                     /old_locus_tag="HVO_B0335"
                     /db_xref="GeneID:8919115"
     CDS             complement(389121..390260)
                     /locus_tag="HVO_RS01610"
                     /old_locus_tag="HVO_B0335"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008606567.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="MFS transporter"
                     /protein_id="WP_004041207.1"
                     /db_xref="GI:490140859"
                     /db_xref="GeneID:8919115"
                     /translation="MALYIGEQGSPFAVSLAYAAFSFGLFVFAPVWGAIADITGRRRA
                     ILIGTAFLSTLAIAPLTVTASVPLQIACRGLFAVFTAGFQSVILTIVSESGGESERGR
                     SIGFYSSARSSGAISGRLFVGYLVGLLVPTDLYLVVVGLGLVATLLTLRIADPTPPSE
                     ETLTTGRLLGEVRGRLLPGGARRELFERTGLGWLYVGIVLRNMTEKGFISVVPVFLVA
                     DVGLSNVVMGAVLAVSPAVRVVSMYSFGRLSDSIGRKKLIVGGLAGSGVQALVVVLAL
                     VPDGQLARIGISSTAFVVHAVTFSMLTVGTIAFVADVAPVDRESELMGLRSTARGLGG
                     VLGPLLVGVLATRFDYATAFVCTSVLAFVAAGLVGRTLTESFSPE"
     gene            complement(390456..390767)
                     /locus_tag="HVO_RS01615"
                     /old_locus_tag="HVO_B0336"
                     /db_xref="GeneID:8919335"
     CDS             complement(390456..390767)
                     /locus_tag="HVO_RS01615"
                     /old_locus_tag="HVO_B0336"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="WP_004041206.1"
                     /db_xref="GI:490140858"
                     /db_xref="GeneID:8919335"
                     /translation="MTLLDAPSRVEEAATGLAAAGAHLVLHVTGQGTPAGHPIVPVVK
                     LSGDADTLAAVPDDIDLDARETDADDLEAYLLAVADGDRTCAERHGLTEFSIARAGPS
                     T"
     gene            390699..391313
                     /locus_tag="HVO_RS01620"
                     /db_xref="GeneID:25143368"
     CDS             390699..391313
                     /locus_tag="HVO_RS01620"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041205.1"
                     /db_xref="GI:490140857"
                     /db_xref="GeneID:25143368"
                     /translation="MRARGGEAGRGLLDPRGRVEQRHRAGGGIGSVRFIDSLAVRRDS
                     RDRRVAEESRRRVESTGRRLRSDARRPRGAARRVEQSVGVPSGRVREVVDDDADREVT
                     EGRRLFVGCRGRPVRPLSGGRLPEVGDGGRAAVDASVGPPGVLYREFADWKPAFFDRR
                     GDDVAPDRLAAEADDDRTRDVRVPGEADERPFGRVGGGPRTSLG"
     gene            complement(391344..391652)
                     /locus_tag="HVO_RS01625"
                     /old_locus_tag="HVO_B0337"
                     /db_xref="GeneID:8919284"
     CDS             complement(391344..391652)
                     /locus_tag="HVO_RS01625"
                     /old_locus_tag="HVO_B0337"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097161.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase"
                     /protein_id="WP_004041204.1"
                     /db_xref="GI:490140856"
                     /db_xref="GeneID:8919284"
                     /translation="MKGRVLDGAALVLADGDSVATALGDLDDGREVRDGDRTVTLADD
                     VPFGHKFALDPLPAGETVRKYGEVIGRTTAAVAAGEWVHTHNCESTRGRGDVAAEVER
                     "
     gene            complement(391649..392839)
                     /locus_tag="HVO_RS01630"
                     /old_locus_tag="HVO_B0338"
                     /db_xref="GeneID:8919168"
     CDS             complement(391649..392839)
                     /locus_tag="HVO_RS01630"
                     /old_locus_tag="HVO_B0338"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041203.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="carbohydrate hydrolase"
                     /protein_id="WP_004041203.1"
                     /db_xref="GI:490140855"
                     /db_xref="GeneID:8919168"
                     /translation="MRREFTGYRRESGRIGVRNHVAVLPTSVASSCVARGIAAEAGAW
                     ARATPHQMGANQPDEARAQTERVLVGVGRNPNVGAALVVEFGTEDIDAADLADRIARD
                     GKPVETLSVREVGGMAAALQRGRTALDSLNEAAADARHESADASELVVGVECGGSDAT
                     PGIAANPAVGDACDRLVAAGGTASFSETPEFIGAEHVLAERCVDEETRRRLLDRVERR
                     EATADLIGVDLRGAQPSPGNQEGGLTTIEEKSLGAISKGGTTPVRGIVDYAERLPVGG
                     GLVLMDTPGYDVESVVGKVAGGAQIIVFTTGRGSTTGNPVAPVVKVTGNPRTWERMRS
                     NMDVNAGAVVEGDATISEAGERVFDEVLAVADGKRTGAETRRMEEFAITEVHPRELAE
                     VRGK"
     gene            392926..393609
                     /locus_tag="HVO_RS01635"
                     /old_locus_tag="HVO_B0339"
                     /db_xref="GeneID:8919091"
     CDS             392926..393609
                     /locus_tag="HVO_RS01635"
                     /old_locus_tag="HVO_B0339"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008607002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041202.1"
                     /db_xref="GI:490140854"
                     /db_xref="GeneID:8919091"
                     /translation="MRTYEVSRIDADRVVPLTGAVDGTVWERANVARLDEYAWGDEPG
                     PETTVRALFDAEALYLQFHVEDDEITADVTELNGPTFEDSSVELFATPSPPDDGSPGR
                     YCNFEANCCGTFKLAWQEPNWRERDIGRDLVSATDAAAVEVETSVPGPTKTASPDDDA
                     WWLAARLPRSTLQSLTGLPLELDSETVWRGNFYRSGLPDAQKGTWNRIELPEPTYHSP
                     AYFGRIEFE"
     gene            393703..394356
                     /locus_tag="HVO_RS01640"
                     /old_locus_tag="HVO_B0340"
                     /db_xref="GeneID:8919364"
     CDS             393703..394356
                     /locus_tag="HVO_RS01640"
                     /old_locus_tag="HVO_B0340"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl hydrolase"
                     /protein_id="WP_004041201.1"
                     /db_xref="GI:490140853"
                     /db_xref="GeneID:8919364"
                     /translation="MQQPSALVIGETTFSFHDFEEMRPHIESAIGDAAEVTATTDKDA
                     LADLAGYDLVVDYLTDATLTPEQLDGLLSFVRDGGAYLGLHCAADLINVHDGDGGLDK
                     RDEPFPDLRDLLGGHFLTHPERSTFGVEIVSDHAVTDGVGGFEVFDEPYQVDVDDDVT
                     VLARMAHPDLTDYPVAWVREYGSGRVCYASLGHTAEAFENEDYRRLLRNAVGWLVRD"
     gene            394417..394662
                     /locus_tag="HVO_RS01645"
                     /old_locus_tag="HVO_B0341"
                     /db_xref="GeneID:8919075"
     CDS             394417..394662
                     /locus_tag="HVO_RS01645"
                     /old_locus_tag="HVO_B0341"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041200.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041200.1"
                     /db_xref="GI:490140852"
                     /db_xref="GeneID:8919075"
                     /translation="MNLRAADLTVFVFVLGVMLSGMWLAQQFGMVWSPTLFAIVAVVA
                     AVWTAYYRFGVEPRIDASRGDDDDNQQEPGVSDGAQE"
     gene            complement(394719..395801)
                     /locus_tag="HVO_RS01650"
                     /old_locus_tag="HVO_B0342"
                     /db_xref="GeneID:8919370"
     CDS             complement(394719..395801)
                     /locus_tag="HVO_RS01650"
                     /old_locus_tag="HVO_B0342"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041199.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="luciferase"
                     /protein_id="WP_004041199.1"
                     /db_xref="GI:490140851"
                     /db_xref="GeneID:8919370"
                     /translation="MSSANSRGLSLGCQVVSYGNVEKTIERAVRAETAGFDTVTVPDH
                     LFHPTGSEEYLVDPPWEAFSVLGAIAQRTEEVTLMPGVADSVRRHPTELAHVTATLDR
                     MTDGRAGLGIGAGEAFNFAPISDIDWDDPYTRFRECVAVIDGLWNSTTDEPFSFAGDY
                     FDLDEAHMGLNPAQEPRPPLWIGGYGESMRGLTGAVADGWFPWIYSPDEYAADLRKVL
                     DVAADRGRDPDAIDRAVMVPTTVSEDGDEARAAGIERNRVNLALRPPLLADMGYEDIA
                     ESTPIMWQMAFDEEQERQLSAAAERIPDGAVDDICVAGDPERVIERIEAFRDAGVDNL
                     VLIPVGDYEETMRHYENEIIPYFSER"
     gene            complement(395884..397317)
                     /locus_tag="HVO_RS01655"
                     /old_locus_tag="HVO_B0343"
                     /db_xref="GeneID:8919080"
     CDS             complement(395884..397317)
                     /locus_tag="HVO_RS01655"
                     /old_locus_tag="HVO_B0343"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041198.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 4"
                     /protein_id="WP_004041198.1"
                     /db_xref="GI:490140850"
                     /db_xref="GeneID:8919080"
                     /translation="MYQLSEQAEPVPSGSSRTIDIGYIGGGSQGWAHTLINDLAQCPD
                     LAGSVTLYDVNYEMASKNALLGNRVMDREEAAGDWSFEATRSMDKALDGADFVICSIQ
                     DPPGETFVHDIDVPQEYGIYQTVADTVGPGGAIRALRAIPQYRDIAATVRERCPDAWV
                     INYTNPMTVCTRALYEEFPDINAIGLCHEVFKTQELFADMAERYIDEAEDVARDEVRV
                     NVKGVNHFTWVDEARWRDRDVFQYLDEELDRRKPLFDRESGDLDAESYWVNNEEVALD
                     LYDRFGVLGAAGDRHLVEFVPWYLSIDEPAEIQRYGIRLTPSSARVSDDEGPDEMERY
                     LEGDAAFEFRESGEEAVDIMRALSGEGTFVTHLNYPNEGQVDGLPEGAVVETNALLSG
                     DDVTPLCAGGLPDEVESMVQTHVTNQETLVRAGFEGDLDLAFQAFLNEPLVTVSRDEA
                     QELFAKLVELEREYFTDYDLDASVLRA"
     gene            complement(397381..397830)
                     /locus_tag="HVO_RS01660"
                     /old_locus_tag="HVO_B0344"
                     /db_xref="GeneID:8919099"
     CDS             complement(397381..397830)
                     /locus_tag="HVO_RS01660"
                     /old_locus_tag="HVO_B0344"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041197.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="uspA domain protein"
                     /protein_id="WP_004041197.1"
                     /db_xref="GI:490140849"
                     /db_xref="GeneID:8919099"
                     /translation="MVVDSTDSNERLLAEAGQIAAGTDTPLVLLTRITEDEIVENAET
                     LQAMSDAANTPLESNSAREVATRFASQAADEAFESVDGTVEYDAVTVVAEEGEFADEV
                     IRVAAERGCDHVYVAGRQRSPTGKALFGDTAQRVVLNFDGPVTILTE"
     gene            complement(397954..399090)
                     /locus_tag="HVO_RS01665"
                     /old_locus_tag="HVO_B0345"
                     /db_xref="GeneID:8919235"
     CDS             complement(397954..399090)
                     /locus_tag="HVO_RS01665"
                     /old_locus_tag="HVO_B0345"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_004041196.1"
                     /db_xref="GI:490140848"
                     /db_xref="GeneID:8919235"
                     /translation="MHVTDIEVIPISHRLPDGQGLGDARGFGHDRATTLIRVDTDTGE
                     VGWGEAFAPGSVIAPVVDEFFRDDVVGMDPFDVRRLAEESYTDPYHFGGSVFVQSALS
                     GIDVALWDLVGKATGKPVHRLLGGTPRETLTAYASTMYFTEADRDIAAPIRDAVDEGF
                     SAAKIKIGTGTDSDVERVRTARQLLGDDARLMVDINGNYRPRQAIRTAKAIEEFDITW
                     MEEPVPPENLSGYREVKRGVDVPLAAGEAHYGRFEFKRLVDDRTVDVAQPNLGRCGGL
                     SEASRIADLASTENVAVRPHVWNSAVGLAAAVQFAASVSDYPHTRHVPDPMLVEFDRS
                     ENPLRDEILKSPFDPTGGEVDVPQAPGLGVEIDEDAVERYRADN"
     gene            complement(399189..400430)
                     /locus_tag="HVO_RS01670"
                     /old_locus_tag="HVO_B0346"
                     /db_xref="GeneID:8919349"
     CDS             complement(399189..400430)
                     /locus_tag="HVO_RS01670"
                     /old_locus_tag="HVO_B0346"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971517.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="mandelate racemase"
                     /protein_id="WP_004041195.1"
                     /db_xref="GI:490140847"
                     /db_xref="GeneID:8919349"
                     /translation="MRIATISGYALSSPIEPPQDRPFHGGTRRLLKRDVVLVVVESAD
                     GTRGIATAGASSSAMREYFEGDSQGTFADVVNGAVADALEGEPIEEVEDAHAILRDTD
                     LPDRLRHEAISALDVALYDIRGKQVGAPIYELLADDYGTDPTTEMPLYASAGMYMEPE
                     GYAEQAATIRDLGFFGYKYRPGIGPDGDRRTIELLSDVAGEMEVMLDVHTWWKIRGGY
                     DRETVEDLVTFAAERDCYWVEEPVSPDDHAGYVDLAATGAPLAGGESEPTPDGLVALG
                     ETGAVAFLQGDVRHHCGYTGCRPAVESCVGRDVEFVPHNFGTWVGLLANAHLVAAAPE
                     VSLLEYPVFEDDPLLDAETDPGMYPFDLAFDIIEGQPAVEDGVLSLSDEPGLGIEVNF
                     DALDDYPFRDGPWTEFHYDED"
     gene            complement(400523..401575)
                     /locus_tag="HVO_RS01675"
                     /old_locus_tag="HVO_B0347"
                     /db_xref="GeneID:8919321"
     CDS             complement(400523..401575)
                     /locus_tag="HVO_RS01675"
                     /old_locus_tag="HVO_B0347"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004968404.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase"
                     /protein_id="WP_004041194.1"
                     /db_xref="GI:490140846"
                     /db_xref="GeneID:8919321"
                     /translation="MPRQTDPSPIAVGVVGLGSLGRRLCQQFVELPRSDLVAISDVDP
                     DGLTEVGDSFDVPEAHRYRSFEAFLDSAPMDAVAVATPNGLHYEQTSAVLDRGLHVLC
                     EKPLATDAEEAYELTTRAEASDQTVMVGYQRHFNPAYKRARDEWADGDRVPRFITGEV
                     THDWQSYYEKEDDWRMNPELSGGGHLLNVGTHVIDAILWTTGLTPTHVNAYVDFHDDE
                     QVFDRQSSIIIEFEEGAVANVSDTGVVARTREHVHIWDDEGAIYLEGHEWDDRTGYVI
                     DDEGTEHHPYDGYERWLSKGTAFLDAIETGETPPATARDGLKAVLITMAAYESGRRNE
                     RVALDDLYPFAADVFQ"
     gene            401690..402628
                     /locus_tag="HVO_RS01680"
                     /old_locus_tag="HVO_B0348"
                     /db_xref="GeneID:8919020"
     CDS             401690..402628
                     /locus_tag="HVO_RS01680"
                     /old_locus_tag="HVO_B0348"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthetase"
                     /protein_id="WP_004041193.1"
                     /db_xref="GI:490140845"
                     /db_xref="GeneID:8919020"
                     /translation="MPLAESGVREHLRGVAAGLLTPFDDDLDIEHDELAANATTLYDG
                     GIRTFLASANISEYHSLTRQERVDVTATAVDALPSDVCVLAGVGGSTASARELIDAYD
                     RIGVDGMMIMPPDHTYVHERGLLRYYEKLAEASTAPLVPYVKGFNPSINYLRDLAGLD
                     GVVGIKYAIEDAVKLGAAASTTGDDVVWVDGLAEPFAVSFWNEGIEGFSAGVSNFRPE
                     VGLALFEALTEENWGRARELRNICLPYQNFRDQTGQNNSLDGAISVPAVKKGLELAGL
                     RGGAVREPIRSLSADDERRAEELYDQLDDDIERLID"
     repeat_region   402238..402400
     repeat_region   402488..402605
     gene            402843..404792
                     /locus_tag="HVO_RS01685"
                     /old_locus_tag="HVO_B0349"
                     /db_xref="GeneID:8919145"
     CDS             402843..404792
                     /locus_tag="HVO_RS01685"
                     /old_locus_tag="HVO_B0349"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041192.1"
                     /db_xref="GI:490140844"
                     /db_xref="GeneID:8919145"
                     /translation="MREFEATAEATRPPTWAHKQRALFDLTADAVDRFVANYTGPDGE
                     PFWPPDDHVGVDGFDDVVEGFYNWPLVYAMGGDERLLDHARRVYESALERGAATETPF
                     GHPMVVDEFEQCRDWFHLGEGNLYTYSMGLAAPDDEAVVDRAKKFAELYTADSETGNY
                     DADERVVRGPMNGSMGPEFCDFSAYEHHPYGADYRWARHGLPWRDLEFDEAADLLDPA
                     NEERLFEVLNERCAKDDIPLNLNITSLMTNAYLHTGEERYREWVTDYLGAWRERTAEN
                     GGIIPDNVGRSGEIGEYTDGSWYGGYYGWSWGGWHYVGIGPTVAAENAVLLEGDREYL
                     DFPRSQLDILMENGIEVAEDDVHSTLYIPHKYGGEGDYHYDASGVLTEDDGEVLWRDG
                     WYEFQPHTDDPYAVHLWYMSMRDEDRDRIRRLRDWEKQDWRRVDPRAKTKHGDGHEYA
                     WLAYLDGEFPDYPDRILGATREHVDERLRLFDAEGNEPTTVDEDYLRDRNPAFHKALL
                     QLTMGAPQPVYYGGLVIAQVRHFDARRERPGLPSGVAALVESVTSDGLELTLVNTGAR
                     REEVVVQAGAYGEHRFTAVETDGAERGVDDGADDSDSASDGEDNSADALRVRLPAGSR
                     MSIRAGLDRFVDDPSYDHPWSETEP"
     gene            405285..406007
                     /locus_tag="HVO_RS01690"
                     /old_locus_tag="HVO_B0350"
                     /db_xref="GeneID:8919265"
     CDS             405285..406007
                     /locus_tag="HVO_RS01690"
                     /old_locus_tag="HVO_B0350"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600063.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="glutamine amidotransferase"
                     /protein_id="WP_004041191.1"
                     /db_xref="GI:490140843"
                     /db_xref="GeneID:8919265"
                     /translation="MPTRVTVWNENVHEREEPAVAERYPTGIHGTIAAHLEGPDREVR
                     TATLQEPEHGLDEATLDATDVLVWWSHCANDEVTDAVAERVVDRVHEGMGFIPLHSGK
                     NSKPFTRLMGTTCNIKYRHGGERERVWVADPGHPIADGLDEQFVIPATETYGEPYDIP
                     EPDRTVFISWFEGGDVFRSGVCYRRGRGRIFAFRPGHEEYPIFHQDEVKRVIDNAVEW
                     ATPTEGASARWGKTDPLEHVEE"
     gene            complement(406210..406635)
                     /locus_tag="HVO_RS01695"
                     /old_locus_tag="HVO_B0351"
                     /db_xref="GeneID:8919039"
     CDS             complement(406210..406635)
                     /locus_tag="HVO_RS01695"
                     /old_locus_tag="HVO_B0351"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041190.1"
                     /db_xref="GI:490140842"
                     /db_xref="GeneID:8919039"
                     /translation="MVSIPRFSALSPEWNAALVGAIASLPISAVVNWFPNSEATVGAG
                     MMIFGAVTAGVVAAVRSVDSDAAGLYAGFLGGVLELVIFAVTTGTTVAWPLSRVAFFA
                     FAGGVVVCLASMFGLGCGRIGGWLMRTVGSRWNPTASTS"
     gene            406887..407240
                     /locus_tag="HVO_RS01700"
                     /old_locus_tag="HVO_B0352"
                     /db_xref="GeneID:8919366"
     CDS             406887..407240
                     /locus_tag="HVO_RS01700"
                     /old_locus_tag="HVO_B0352"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041189.1"
                     /db_xref="GI:490140841"
                     /db_xref="GeneID:8919366"
                     /translation="MADSTTVDELVVTKLSDATSTALEGGRTESVELRGVSVTRATLE
                     PGWGAEADRDGTEPDYCQSAHDIYVVSGTLGLELDDGARTEIAAGCAATIPPGHRGWT
                     VGDERLVYLEFDPSE"
     gene            407283..408113
                     /locus_tag="HVO_RS01705"
                     /old_locus_tag="HVO_B0353"
                     /db_xref="GeneID:8919125"
     CDS             407283..408113
                     /locus_tag="HVO_RS01705"
                     /old_locus_tag="HVO_B0353"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061859.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="nitrilase"
                     /protein_id="WP_004041188.1"
                     /db_xref="GI:490140840"
                     /db_xref="GeneID:8919125"
                     /translation="MSRFVAAACQLDSRDDKAANVERALGLLDEAAADGADFVAFPEM
                     TTFIGPEERFAEVAEALDGPTIQRFSEKAREHGVFVHTGSFFERIPDSDRVYNTSALI
                     GPSGEVLDTYRKVHLFDIELDGSVEHRESDYVAPGDRPVTVDTDLATFGLSICYDLRF
                     PGLYRAMAQSGANVLLVPSAFTMHTGKDHWEPLLRARAIENQAYVIAPGQIGDKPSWV
                     ETYGRTLVVDPWGNVISKARDREEVVTATIDLSHLDEIRRDMQTLQHARPDVYERSEK
                     "
     gene            complement(408141..410444)
                     /locus_tag="HVO_RS01710"
                     /old_locus_tag="HVO_B0354"
                     /db_xref="GeneID:8919286"
     CDS             complement(408141..410444)
                     /locus_tag="HVO_RS01710"
                     /old_locus_tag="HVO_B0354"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041187.1"
                     /db_xref="GI:490140839"
                     /db_xref="GeneID:8919286"
                     /translation="MSSSSCRYTFDPSVQTDAHLQTTWECPHEAHPESEFCVFHMSRD
                     ERASLDVTGDDIVDELRANLQSPDTRVNEYVGADLPHLSLTYQDINGATNHVLNFQHA
                     DIEGLDLTHGRLDQGLILREATVDRLKLDEAVVTGDVDAREVTVTGAVTADEATFEQD
                     VRFSGATFRGEVRCDETVFQGDTSFADATFHGTARFRNVETSGSSHVLEDHITFADAT
                     FRDDASFRQALFDYVTFDGARFTAGSDFEHVEFEGDARFDGVRFNEMADFDEARFDDD
                     ASFANARFMQLAEFRGVEFNGGSRTTHDDVTFEGATFEGEADYKLARFRYSDFKDAVF
                     KGAVSFDRATFTARTDCYRLRVDGAFDLSLASFGGQANFDDSEFHDAVVAEEATFGSD
                     ASFEAVEFQSNARFGEARFEEDVRFNAATFRGLASFRGAFFQGELQHLEANASFNGAT
                     FEAGAEFEAANFTSASFWETTFHDRADFRQSDFETARFRVLVGDRDTYLDFTDATLDG
                     GTISQGSGEPTPYDLTRATIGDLTLEGGGNEHQLLDHFRFCLTEFDRFDFSDHHGYLE
                     RNDWTIHDFVGNGATGQFAVELTPDIIEETYRKAQDSANAVGDTPASREFEFKRYYYN
                     RQKNFDIILNEYSLNTWARGKKVASVGLNTLMQVTCGYGNRLPRIAAFTFLLPALFGL
                     CYALGGPFLTQAGSVFDPAAVDKTTMEVLFDNVYYSYISFSTVGYGDINPLGPAARVL
                     AASQGMLNGLFFTLLTFTLFKRVLGGS"
     gene            complement(410664..411635)
                     /locus_tag="HVO_RS01715"
                     /old_locus_tag="HVO_B0355"
                     /db_xref="GeneID:8919283"
     CDS             complement(410664..411635)
                     /locus_tag="HVO_RS01715"
                     /old_locus_tag="HVO_B0355"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041184.1"
                     /db_xref="GI:490140835"
                     /db_xref="GeneID:8919283"
                     /translation="MTRNASTYDGDVTLNGSERPPVELRDPADVFVGGASVAGDLAVQ
                     NAEYVFTHAPVTDDAAVGDGTGGDAAVETEIRGSLEDGYVQSVAGDVLLGDAEDVFIA
                     ADAADGAVSAPGAENVYAGEATPAAAPDDYDVSTFGWKQSGSATDPDTGVYAVGMAHD
                     IDLTKVTADVEFYLVGHGHEVRVEGRGAAVSVHFVGYDNTVSVGPYLASSVETDTGFD
                     NAVDADPYPAEDLVEMSRSEAYSNAGFGRRKVTFQEPADGDEWCPNCGKPAEAIIERH
                     QMEAFFLFGWPLWTFEQSTNPARECEHCSPNAIHAELSASERREIFD"
     gene            complement(411652..412176)
                     /locus_tag="HVO_RS01720"
                     /old_locus_tag="HVO_B0356"
                     /db_xref="GeneID:8919103"
     CDS             complement(411652..412176)
                     /locus_tag="HVO_RS01720"
                     /old_locus_tag="HVO_B0356"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041182.1"
                     /db_xref="GI:490140833"
                     /db_xref="GeneID:8919103"
                     /translation="MPSHPPSTTESPSPADPSPPAETPTELYFGYSADAPDLTTVDVK
                     TVSPATLAGEPAVLTVIGESHYVGLPALDFHELCSCKPLPYERTHETPLSVGAEREFS
                     FESDRLDAQTVVEGRPLDAFPGPDDATVAYRFDPEAWTTIRIADGGYETYHTYPEYDL
                     ALHTETTMTPKTQR"
     gene            complement(412183..414009)
                     /locus_tag="HVO_RS01725"
                     /old_locus_tag="HVO_B0357"
                     /db_xref="GeneID:8919078"
     CDS             complement(412183..414009)
                     /locus_tag="HVO_RS01725"
                     /old_locus_tag="HVO_B0357"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="spermidine synthase"
                     /protein_id="WP_004041180.1"
                     /db_xref="GI:490140831"
                     /db_xref="GeneID:8919078"
                     /translation="MSNTRTDTATLLTLTFVVSFCSFAYEFVYSELLTVMYGGTVTQY
                     VITVGLYFFSLGIGAALSDDLDGETLGGNFFRTEVLLAAAAPAGFLLIVGLNSVRIPQ
                     AVPAELVWTVARLPVVVVGFLSGFELPLLTRMFDDLDGDGSATPSWLRTAGTRIHDFV
                     VAAVGTLWTVERTEGRRSGLSVVLAMDYVGGLAGAVVYARVLYPGIGLIPTIFVLALL
                     NGVAALVFVAHFGAWSWWPLGGDEASASAGTGGNAAASARTDGSDRSLSAARVSKTLL
                     VVCLLLTATYAGVVAKHDAADERLSQLYLEQQIENEYPPGAIRATVTSQETTAYQHVI
                     RYDRTWTGTGPNPHFDGRTERCLRLGAAVQLCESWADSYHEGLVDVPMSLVDPGPDTK
                     VLVVGGGDWIAVDHLREYGVTVDHVDLDGEFMRDAKTDPFFARWHDDAYEYDRLNTTV
                     ADGYRYLQKTNETYDLVLLDIPGATDDDLLTLYSTEFYRSVRTHLSEDGVAVTWGYSP
                     DAYPEHHKAFVNTVGAAGFTRELSYWVREDLDDDGETERVEQFYVLAPGDRPRLTGDG
                     ATRYVRAREEHYGAVEWHAVPHYRGVRENSIFHPNYDILVDT"
     gene            complement(414079..414804)
                     /locus_tag="HVO_RS01730"
                     /old_locus_tag="HVO_B0358"
                     /db_xref="GeneID:8919369"
     CDS             complement(414079..414804)
                     /locus_tag="HVO_RS01730"
                     /old_locus_tag="HVO_B0358"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004971491.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041177.1"
                     /db_xref="GI:490140828"
                     /db_xref="GeneID:8919369"
                     /translation="MKRRTFLQLTGLGAAGGLAGCLGSNSPPPRKSSVVSDFEVSDGS
                     LVVDLADQTWVMSRYEAADQSSLSGFDPQSLAALSPVGVASAKGKGGGGGGRGATGRG
                     TGGYASAPRTVHGHAWYHGGDYADDWYENNAGKVSRFPVGVAALGIAYLGSTAAMRDD
                     APDAGPVPWDREIQDPSGTAEYDMSDGSQLGRDGWYRVGAHIVGDDVNHDFRWECYDL
                     EVTDGIGDAGYSIEEEWKVSPRI"
     gene            complement(414982..416148)
                     /locus_tag="HVO_RS01735"
                     /old_locus_tag="HVO_B0359"
                     /db_xref="GeneID:8919328"
     CDS             complement(414982..416148)
                     /locus_tag="HVO_RS01735"
                     /old_locus_tag="HVO_B0359"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572985.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041176.1"
                     /db_xref="GI:490140827"
                     /db_xref="GeneID:8919328"
                     /translation="MAIVESLVGNGLFVLFLAVLVGMGLGKISFRGVKFGVAGPLFAG
                     LVLGHFGFTVPDAYSGLTLALFVAAVGLIAAHEIEGTVKAYGLNFVAVAVLMPTVALA
                     LTYVWTQFVFPNASTPLIMGSFSGALTSSPGLGSAIEALPAAARQDYQIGHSVGYVVG
                     VLVIVVFQQLYPVIARLDLDEEKRGFDEAIGGTDDDESGSSVTEVTFSVMGYALVIVA
                     GAVIGSIPIPMGPFGTPSLGTTGGVLVAALVFGYFGRVGPVPTRMDTGILSEIRAFTL
                     AMFLAVVGIGAGGGFLATISEYGLQIVAASALTSFIAILAGLALTRYVWGMDWISAAG
                     GITGGHTDTKGLAAAVDATGADEVAAGYGNTYPFALLFMVVYAKLLVIIIPLAA"
     gene            complement(416397..417659)
                     /locus_tag="HVO_RS01740"
                     /old_locus_tag="HVO_B0360"
                     /db_xref="GeneID:8919213"
     CDS             complement(416397..417659)
                     /locus_tag="HVO_RS01740"
                     /old_locus_tag="HVO_B0360"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041175.1"
                     /db_xref="GI:490140826"
                     /db_xref="GeneID:8919213"
                     /translation="MFEVQSELAIFVLLMLVWTVFALYSASVFTWFVEVLVLAWRQTI
                     AADDVAYGYDDIQVRIITIDAAGIVQSTVDAVPDGLADVRVVAEKPISVDGASVHVVP
                     EEFTCTATHKGRALEWARREIPCDKEFVLYLDEDTLMANFEGLPEGDIVQITELPLYT
                     GSWVTYLSEVFRIGYQREQRAFGRFRFPLYAWGGGIAIRTRLENDITWDSKTITEDTD
                     FAWRAASATNLEFNVLDCKFRNQAPPSVMTMLKQRRRWFSGTRQDSDLLPLHYQVFLQ
                     FRLVAWGFSPLIPLITLLTFLVPGALPDLMLYRIGSLVEFATLFVVTGVGVASYRSES
                     KLTLLAVPWTPILVVLNTAGALWGFVSPVEHFTVTTKVPLETVEKRNPAFEPGSLTDH
                     DGRDDLPEQLDVHRLTTELRESFHIDDG"
     gene            417818..418459
                     /locus_tag="HVO_RS01745"
                     /old_locus_tag="HVO_B0361"
                     /db_xref="GeneID:8919166"
     CDS             417818..418459
                     /locus_tag="HVO_RS01745"
                     /old_locus_tag="HVO_B0361"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600056.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004041174.1"
                     /db_xref="GI:490140825"
                     /db_xref="GeneID:8919166"
                     /translation="MADSTSGVAEAKADTLREQHLQLLLEIEPAKRCSCPLAGPDSAV
                     EDVHTQLDGDVCHAEVTVGDGDASKVVHATTSVGDDCLCRAFAEFECVPRIRRADGEC
                     IVVETYLSDRAVITDLVERLDELTERVCLRRLTSDGRGDSTESKTATIDLSSLTAKQR
                     EAALIAVHHGYYETPRRTELATLAEALGISKSALSQRLNAVEAKLATAVFDSE"
     gene            418592..418831
                     /locus_tag="HVO_RS01750"
                     /old_locus_tag="HVO_B0362"
                     /db_xref="GeneID:8919200"
     CDS             418592..418831
                     /locus_tag="HVO_RS01750"
                     /old_locus_tag="HVO_B0362"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041173.1"
                     /db_xref="GI:490140824"
                     /db_xref="GeneID:8919200"
                     /translation="MNDPQQPRLTPLDEWETEAANILDGGDYDAELGLRMARDAIRVS
                     NGELSDEAFHEKYHEAVVAEFGEDARPTEPEGFDE"
     gene            418824..421355
                     /locus_tag="HVO_RS01755"
                     /old_locus_tag="HVO_B0363"
                     /db_xref="GeneID:8919089"
     CDS             418824..421355
                     /locus_tag="HVO_RS01755"
                     /old_locus_tag="HVO_B0363"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572988.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="dimethylsulfoxide reductase"
                     /protein_id="WP_004041171.1"
                     /db_xref="GI:490140822"
                     /db_xref="GeneID:8919089"
                     /translation="MSDDGRGSTGGGGDGDGDGVFRRDVLKASGAAAVALGLGGGGYA
                     SSLAETATEPASRQNPGIESYVGQDEIIRTACAPNCRGKCPLEAHVRDGRVRKIEPQI
                     PEDERYKRACTLGLSHTQRIYNATRLKYPMKRVGWEPGSPNPEGRGDAAEFERVTWDE
                     ALDYIAAEMERVRDDYGPESVYFETGSGNNGISGTIQSRLSSLFGGTQKSWSIDINVG
                     LGFSRLAGAGFFNVPTNEVVDWRNANTVIVWGSDIFASNLQQDASKLLDAVENGAKLV
                     CVDPVYTNTAAKADLWLPIKPGKDTLLTLSMIKTVLADETYDTEFLRKRTLGPALVRD
                     DTGELLDASDVFDDVTEDLPVAVDESTGEPVALEPETYGEYALFGEYTVAGVDCHTAL
                     SLLEEHVSDYDPDAVAAEVGINADNIRTAVRWLATRGPGGIASGYGVDRYKYGHTFGQ
                     AYAILLGLTGDFGRHGSIQGSHPLGGSYDNGGYDAPEDGPGTTSLPQTDILTAIESGD
                     PYQLKVMYSQESNFIANQMPDRQRWLEASKKLDLIAVADMHHTPSVQHADIILPASHW
                     FEREDVVDTWGGHPHIMYRQPAHDPLWESKSDHWMLVRLAERLGFGDYFNRDKSATLR
                     ELLANDDEVDYETLKEQGTVKVSTPVVKFTGEFNTPSGRLELYDEDAPTEGGVTLELP
                     KHIESRTADDWDTAEDYPLMFIQKHSKWRIHSQYEYQNWLREINNEPQLDINPKDAAA
                     RGIEDGDYVRVHNERGEMVVKAKLNDGMQPGLVNTDQGWWGSDYVRGHHNDLTHTDVC
                     EVTGNFAFYDTRVEVEPAPSDVDTSKYTSDQPTGSGATSAGAGGD"
     gene            421358..422179
                     /locus_tag="HVO_RS01760"
                     /old_locus_tag="HVO_B0364"
                     /db_xref="GeneID:8919303"
     CDS             421358..422179
                     /locus_tag="HVO_RS01760"
                     /old_locus_tag="HVO_B0364"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin"
                     /protein_id="WP_004041170.1"
                     /db_xref="GI:490140821"
                     /db_xref="GeneID:8919303"
                     /translation="MTNYGLVIDQERCIGCHACAVTCKQENNVGLGQYWNRVLTEGGD
                     KMDTPAGTYPENGEDGTLEMSYQPTACQHCDNAPCVKVCPVNATYTREDGIVEIDYDK
                     CIGCRYCMAACPYNARVFNWDEPQTVPEDGTGDVPARPQGVVEKCTFCSHRVEEGLDP
                     ACVVNCPADARIFGDLDNEESTVSKYIRKYQTTRLLEDRGTDPKTYYIRGEMSPGRPQ
                     TSDKMESELDDVSVWSEPKDNGPVEESGGSGGGGSHGSLSNDALPHVPAFEGGDD"
     gene            422179..423492
                     /locus_tag="HVO_RS01765"
                     /old_locus_tag="HVO_B0365"
                     /db_xref="GeneID:8919237"
     CDS             422179..423492
                     /locus_tag="HVO_RS01765"
                     /old_locus_tag="HVO_B0365"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin oxidoreductase"
                     /protein_id="WP_004041169.1"
                     /db_xref="GI:490140820"
                     /db_xref="GeneID:8919237"
                     /translation="MSRETATSRFVVPEFGSAGKLWVGFLAAVVLVGVVAWAYQLTTG
                     LVVTGMRNVFSWGLYIMMFVLFVGLSAGGLIISSAPKFFHSHRYEGFARLGVLVSLAC
                     ITVAGLLILPDIGRPERLYQFFTSPDFRSPMVWDFGIVILYGALNLWYLWLLTRRDLA
                     ARGSRLALGVEDTEAGRERDRTLMFWTAAVALPTAVALHSVTGWIFATQIGRGDWFSP
                     LVAPVFIAKALVSGLGLLLVVSVLVSRFTRFSVDREELTSLGKVLGIFLAFHVVYLLA
                     AERLPHAWADHFGFWAITESFLIGESAYFWLWTVVGGAVPLVMLALPSFRKRVSVIFT
                     ASALAVFGTTFEGVRLVFTGYDAANIDAAPGISVGGEYAGVTTDIWATAGSYTPTLVE
                     VAVTAGVIAIGALIVTLGLRYVPIQAETESTAVATDGGETRGEDR"
     gene            423489..424082
                     /locus_tag="HVO_RS01770"
                     /old_locus_tag="HVO_B0366"
                     /db_xref="GeneID:8919174"
     CDS             423489..424082
                     /locus_tag="HVO_RS01770"
                     /old_locus_tag="HVO_B0366"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004061839.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone TorD"
                     /protein_id="WP_004041168.1"
                     /db_xref="GI:490140819"
                     /db_xref="GeneID:8919174"
                     /translation="MSEPVAQSPSEGNEKYEEHAAAGDAFESARTATYAVLAACWREP
                     TERLVEVANDGELSALFGPLESLELHALRSEYARLFIGPAGPPCPPYESVYRDRADDD
                     EFGEVLGPATTAVERWYQAFGVEHRPEQRDLPDHVATELEFCAYLAEHGRDDRLDQFR
                     DEHLTQWVDDLCDRVETETRSPFYAALARTTREVVSD"
     gene            424234..424707
                     /locus_tag="HVO_RS01775"
                     /old_locus_tag="HVO_B0367"
                     /db_xref="GeneID:8919324"
     CDS             424234..424707
                     /locus_tag="HVO_RS01775"
                     /old_locus_tag="HVO_B0367"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008572992.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041167.1"
                     /db_xref="GI:490140818"
                     /db_xref="GeneID:8919324"
                     /translation="MHAHHDRSRPATPLSESILVCGDSRVSLTGPELRGLASEDRTVT
                     VACASGTRHTATWTGVPVLDLFADAGLDDETTHLLVESADGYRVCIDVYATLDAVVAY
                     ARDGTPIGEEHDYETRFIAPDVDGSRTVKGVRAVEALALDPATDPESLEDIFKKP"
     gene            424712..425470
                     /locus_tag="HVO_RS01780"
                     /old_locus_tag="HVO_B0368"
                     /db_xref="GeneID:8919202"
     CDS             424712..425470
                     /locus_tag="HVO_RS01780"
                     /old_locus_tag="HVO_B0368"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobA"
                     /protein_id="WP_004041166.1"
                     /db_xref="GI:490140817"
                     /db_xref="GeneID:8919202"
                     /translation="MTRERQNRPDRTDAPTAAAAPSLRPAPDATAVVLAGGESTRFGP
                     GHKALATLDGEPLIRRVVGTLRAVAGRPPIVAVRTADQRERLAQALPRDWDVRFVRDD
                     PGLSGPLAGVTAAADTVTTSWLFVAGCDMPLLEPHAVAALFECAARSDGDRDRDRDRH
                     VSADGDRPSPPAIVPVSERGHEPLHALYRRAAVRDNVSELAPDDGLGALLNRLDGVEY
                     VGFDALPESVDRSVTNVNTRTELARVAAGDEVRR"
     gene            425467..426384
                     /locus_tag="HVO_RS01785"
                     /old_locus_tag="HVO_B0369"
                     /db_xref="GeneID:8919251"
     CDS             425467..426384
                     /locus_tag="HVO_RS01785"
                     /old_locus_tag="HVO_B0369"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600052.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="WP_004041165.1"
                     /db_xref="GI:490140816"
                     /db_xref="GeneID:8919251"
                     /translation="MNPDSAAGRSSRRAFLAAVGGVAAGGLTATAGCLGRGEEAPTVS
                     ILAAGSLQRALTTEFDAPDGTRIEVEAHGSARVARMVDDDQRDPDIVALADPALFDAP
                     LSVPWYATFANNALVVAYNPQTEGGTRVTEAASWPDALLDDAVSLGRTDPDLDPLGYR
                     TRFALALAADHYDRPALTADLLRRDQIYPETQLLAQFDAGGVDAAFVYRSMAVERDYP
                     YLELPAAINLSDPDHASAYATVSYTLPDGVTVRGGPIRYAATRRTDTAAAKSVFEALV
                     GTAGDFLEPSGFTVRASHPHYFGDVPPTA"
     gene            426365..427174
                     /locus_tag="HVO_RS01790"
                     /old_locus_tag="HVO_B0370"
                     /db_xref="GeneID:8919037"
     CDS             426365..427174
                     /locus_tag="HVO_RS01790"
                     /old_locus_tag="HVO_B0370"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097121.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate ABC transporter permease"
                     /protein_id="WP_004041164.1"
                     /db_xref="GI:490140815"
                     /db_xref="GeneID:8919037"
                     /translation="MSHRQPNRRERGVTRLLPETWRGLTLLLAGVLLLYYLLPIGALV
                     FAQSPASLATDVTNEVVLTAATNSVVAATLSTLVAVAFGVPLAYWLSRTSFRGRDVIL
                     ALVMLPLVLPPVVSGMLLLRLVGPAGLGQLTSVPLTRSLFGVVLAQTYVASPFLVVTA
                     KTAFDGVDRQLEAAARSLGEDRVGSVRRVTLPLAKQGILAGVTLTFARAIGEFGATLM
                     LAYYPRTLPVQIWVSYLSTGLDAAFPVALVLVGIAVGAILLVHALGTNPWE"
     gene            complement(427389..428879)
                     /locus_tag="HVO_RS01795"
                     /old_locus_tag="HVO_B0371"
                     /db_xref="GeneID:8919003"
     CDS             complement(427389..428879)
                     /locus_tag="HVO_RS01795"
                     /old_locus_tag="HVO_B0371"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase"
                     /protein_id="WP_004041163.1"
                     /db_xref="GI:490140814"
                     /db_xref="GeneID:8919003"
                     /translation="MVDDIATDADWNALYIDGEWTESESGESIAVEDPSTRETVAHVP
                     RGTEADVDAAYEAAAEAQESWAEAPPARRQEVVEQFLQALNEYEDEIIDLLAHEVGGS
                     RIMGETSIQIASDHASEAATLPRRMRGEHVASNIPGKENIVQKNPKGVVTVISPWNFP
                     LNLSMRAVAPAVAAGNAVVLKPSTNSPITGGLLFAKLFEETDLPEGVVNVVTGRGSEI
                     GDRVAGHPESDVVAFTGSTEVGKRVSGIAGENLAVPAMELGGNNAHVVTEGADVDRAA
                     DAAVFGSFVHQGQVCISINRHIVHESVYDEYVEKLTERAAELPVGSAHEDDTVVGPII
                     DESQRDEMLGYVEETVAAGATLETGGSTADLDGVDDSLVVQPTVLSGVTNDMAAARNE
                     HFGPIAPVIPFSDVDEAVELANATEYGLSGSVHAGDLATGKEIALRMETGNVHVNDQP
                     INDEAHVPFSGTGASGVGTYNSDAFLDEITEDKWISLQHEPRDYPL"
     gene            429092..429286
                     /locus_tag="HVO_RS01800"
                     /old_locus_tag="HVO_B0372"
                     /db_xref="GeneID:8919205"
     CDS             429092..429286
                     /locus_tag="HVO_RS01800"
                     /old_locus_tag="HVO_B0372"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041162.1"
                     /db_xref="GI:490140813"
                     /db_xref="GeneID:8919205"
                     /translation="MRRTRALTMYLIVPCLLYAAAFVIVVTQFSAVVETSTLRQSHTV
                     FAAIIAVVLLVKRDELSAER"
     gene            429920..430657
                     /locus_tag="HVO_RS01805"
                     /old_locus_tag="HVO_B0375"
                     /db_xref="GeneID:8919195"
     CDS             429920..430657
                     /locus_tag="HVO_RS01805"
                     /old_locus_tag="HVO_B0375"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008573002.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041160.1"
                     /db_xref="GI:490140811"
                     /db_xref="GeneID:8919195"
                     /translation="MKKVLARIGIGNATVDTVLPSDTVRPGETVDAEVRIEGGSAEQE
                     IGKVRFELETRYRTDDGYREVDIAQYTLAESLTVQPDEQETRDVSLDIPHGTPVTLGN
                     VDVWVETELDIELAVDPEDKDYLNVQPTPRLQAVFDALDDLGFSLHTAECEADPHGVF
                     TSSRRFVQEFEFRPTSGPFAGDVDELEVVPRPDEDALELFLEVDRRGGVLSELSDLDE
                     RTVQTTVRTTDVSDVRDELESLIRANA"
     gene            430739..431749
                     /locus_tag="HVO_RS01810"
                     /old_locus_tag="HVO_B0376"
                     /db_xref="GeneID:8919073"
     CDS             430739..431749
                     /locus_tag="HVO_RS01810"
                     /old_locus_tag="HVO_B0376"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041159.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="aryl-alcohol dehydrogenase"
                     /protein_id="WP_004041159.1"
                     /db_xref="GI:490140810"
                     /db_xref="GeneID:8919073"
                     /translation="MTTLEDIDLDFVPFGQTGLQTSELQFGTWRFGKETEQGNVEIDE
                     ERAHELLDAYEAAGGRFIDTADIYGGGASERWIGDWLEDRDRERFTIASKIYWQIRDG
                     DPNSRGTNRKNVRHRIDALLDRLDTDYVDVLYIHRWDDETPTREMMKTLNGLVEDGKV
                     HYLGASTLRPNAWKVARANEIARAEGWEPFTVAQPRYNLVDREIEGDYLEMTRSYGIA
                     VCPWSPLGQGFLTGKYTREDGLTGESRAAESSRFEESYLTEENFDVHDELDAVAGEVD
                     ATPAQTALAWLMHRDGVTAPIVGARTVEQLTENLEAATIDLTDEQVDRLTGAKPDPYV
                     GL"
     gene            complement(431768..432787)
                     /locus_tag="HVO_RS01815"
                     /old_locus_tag="HVO_B0377"
                     /db_xref="GeneID:8919378"
     CDS             complement(431768..432787)
                     /locus_tag="HVO_RS01815"
                     /old_locus_tag="HVO_B0377"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004972276.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_004041158.1"
                     /db_xref="GI:490140809"
                     /db_xref="GeneID:8919378"
                     /translation="MSIEVRRATGDDVHGWDTFVEQSPHGNAFHQYDALEIQAAHAGA
                     ELVPLVGRKGEEVVGLFPVFRINKGPIATVFSPPPELRVAYLGPVLLNMDHMKQRKRE
                     GRHHEFIDDCLAWVRDEIRPRYAHIRLDGRYDDLRAFSWNDYAITPQYTYHVDLSPGV
                     DDVFMSFSSDARSNIRNALDDAYTIEEGGPEAIERIVEQVASRYEAQGISYRSSPEFV
                     RDLYATLPEGQIRPYVLRIDGEFAGGILAVDYKETVSRWQGGVRADVDSDLAINDLLD
                     WRIMRDAMDRGRTTYDLVGANNRRINRYKAKFNPELHPFYSLERNAPGMKTLAHLYKT
                     IREGV"
     gene            433048..433440
                     /locus_tag="HVO_RS01820"
                     /old_locus_tag="HVO_B0378"
                     /db_xref="GeneID:8919126"
     CDS             433048..433440
                     /locus_tag="HVO_RS01820"
                     /old_locus_tag="HVO_B0378"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600046.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase"
                     /protein_id="WP_004041157.1"
                     /db_xref="GI:490140808"
                     /db_xref="GeneID:8919126"
                     /translation="MAGLSERAASLVTSEPLMAHLATSVDDRPHVAPVWFDYAADRGV
                     IEVLTTGRKLANIRENPRVALSIQKDEKGQAQWKVTVLGTATVVTDDDALRAATRRIN
                     RKYGADESAWPENELVRISVGTATVSEY"
     gene            complement(433504..435033)
                     /locus_tag="HVO_RS01825"
                     /old_locus_tag="HVO_B0379"
                     /db_xref="GeneID:8919204"
     CDS             complement(433504..435033)
                     /locus_tag="HVO_RS01825"
                     /old_locus_tag="HVO_B0379"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_007274158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:proline symporter"
                     /protein_id="WP_004041156.1"
                     /db_xref="GI:490140807"
                     /db_xref="GeneID:8919204"
                     /translation="MVSSTVALGLTVATLVAFTGVGVWFSRGRVGSVEDLISARDSAG
                     SRRTTATLVASVMGVWVLFSAPEAGASFGIAAVVGYAVGEAVPMLVYARLGPRIRELI
                     PEGHSLTEYAHARYGTAMYAFVLLVSALYMFIFLAAELTGIAGALSLVAGVPQWQTAL
                     LVGGFVLLYTSYGGLRASIATDAVQAVVVIPLLLLAFAGALVALGGPAAAIDGITATN
                     PALLDLGAVAGLQFGLALAFAILGAELINQTWWQRIYAADSSETVGRSFRTAALANGA
                     IVFVTAFFGVVAVGNAAVVTDPASAGYNADAAFFVLLGEAFPEWLVLAAVLLALLLVM
                     SSIDTLFNALSSLVTADLARLLAEPSDRHLALGSRALTVVVAAAAIYVSLRAQSVLRL
                     FFFADLLGAAVAFPLVYGLYSTRITGLGALASSLTGLAVGLAFFPDLRGVITSIPVVG
                     GLLPAADPLYLTSFGGAFVVSTAASLVAARLADAGFDLGRLSREIRRFDDGQTDAPSS
                     D"
     gene            complement(435027..435812)
                     /locus_tag="HVO_RS01830"
                     /old_locus_tag="HVO_B0380"
                     /db_xref="GeneID:8919341"
     CDS             complement(435027..435812)
                     /locus_tag="HVO_RS01830"
                     /old_locus_tag="HVO_B0380"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_004041155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="WP_004041155.1"
                     /db_xref="GI:490140806"
                     /db_xref="GeneID:8919341"
                     /translation="MTDGDPSDSVGSPGESQPAPETYDEFAASRSDPRFTDWLRDRAG
                     ESWDDATAHRLTRELAADELADDVFRQYLVQDYAFVETLVGVFGHAVGTAPTMASKSE
                     LVSFLGVLTDDEDDYFLRAFDALDVPESVYSEPKTTPTTRAFIDLLERAAGQGGYAET
                     LAVLVPAEWVYLSWATAAADADDSPSRFYLSEWVDLHAVDDFASFVEWLRTELDREGA
                     AASPRRQRRLEQLFRRTVELEVAFFDEAYELGRGSSRPGDDRW"
     gene            complement(435809..436474)
                     /locus_tag="HVO_RS01835"
                     /old_locus_tag="HVO_B0381"
                     /db_xref="GeneID:8919302"
     CDS             complement(435809..436474)
                     /locus_tag="HVO_RS01835"
                     /old_locus_tag="HVO_B0381"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008097104.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thiaminase II"
                     /protein_id="WP_004041154.1"
                     /db_xref="GI:490140805"
                     /db_xref="GeneID:8919302"
                     /translation="MAFTDTIHDEADEFWSAILDHPMVVRLGEGSLDEEPFRYWVRQD
                     YVYLVEYSRLFALGAAKAPTLDSMGTFASLLESTVNEEMDLHRSYAAEFGIDTDELEA
                     TTPSPTTRAYTDFLVRTATLGSFGDIVAALLPCMWGFNETGRRLADAGVPDHDQYAAW
                     VEMYAGDEFTELTDWCKALMDDVAASATESDRERYRDLFRTSAQYEYLFWDAAWRQEE
                     WPL"
     gene            436747..437313
                     /locus_tag="HVO_RS01840"
                     /old_locus_tag="HVO_B0382"
                     /db_xref="GeneID:8919193"
     CDS             436747..437313
                     /locus_tag="HVO_RS01840"
                     /old_locus_tag="HVO_B0382"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_006600043.1"
                     /note="TFIID; binds specifically to the TATA box and
                     functions in transcription; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transcription factor"
                     /protein_id="WP_004041153.1"
                     /db_xref="GI:490140804"
                     /db_xref="GeneID:8919193"
                     /translation="MSQVNAIGSIEIQNVVASTEVPVELDLERLSLDMNGTDYDPENF
                     PGLVYRTRNPKSACLVFRSGKVVCTGADSVDDVSTAIETLFDEFTELGIPIPDDPDIT
                     VQNIVSSADLGAALNLNALAIGLGLEAVEYEPEQFPGLVYRLDEPSVVVLMFGSGKIV
                     ITGVKRVGDAETALETVDDDVRELGLLG"
CONTIG      join(CP001953.1:1..437906)
//
DBGET integrated database retrieval system