GenomeNet

Database: RefSeq
Entry: NC_014121
LinkDB: NC_014121
Original site: NC_014121 
LOCUS       NC_014121            5314581 bp    DNA     circular CON 28-AUG-2016
DEFINITION  Enterobacter cloacae subsp. cloacae ATCC 13047 chromosome, complete
            genome.
ACCESSION   NC_014121
VERSION     NC_014121.1
DBLINK      BioProject: PRJNA48363
            Assembly: GCF_000025565.1
KEYWORDS    RefSeq.
SOURCE      Enterobacter cloacae subsp. cloacae ATCC 13047
  ORGANISM  Enterobacter cloacae subsp. cloacae ATCC 13047
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
REFERENCE   1  (bases 1 to 5314581)
  AUTHORS   Ren,Y., Ren,Y., Zhou,Z., Guo,X., Li,Y., Feng,L. and Wang,L.
  TITLE     Complete genome sequence of Enterobacter cloacae subsp. cloacae
            type strain ATCC 13047
  JOURNAL   J. Bacteriol. 192 (9), 2463-2464 (2010)
   PUBMED   20207761
REFERENCE   2  (bases 1 to 5314581)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2010) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 5314581)
  AUTHORS   Wang,L., Ren,Y., Ren,Y., Zhou,Z., Guo,X., Feng,L. and Wang,L.
  TITLE     Direct Submission
  JOURNAL   Submitted (03-FEB-2010) TEDA School of Biological Sciences and
            Biotechnology, Nankai University, 23 Hongda Street, TEDA, Tianjin,
            Tianjin 300457, China
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence is identical to CP001918.
            RefSeq Category: Reference Genome
                        CLI: Clinical Isolate
                        TYS: Designated Type Strain
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..5314581
                     /organism="Enterobacter cloacae subsp. cloacae ATCC 13047"
                     /mol_type="genomic DNA"
                     /strain="ATCC 13047"
                     /sub_species="cloacae"
                     /culture_collection="ATCC:13047"
                     /db_xref="taxon:716541"
                     /note="type strain of Enterobacter cloacae subsp. cloacae"
     gene            82..1410
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /db_xref="GeneID:9127753"
     CDS             82..1410
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein"
                     /protein_id="YP_003610518.1"
                     /db_xref="GeneID:9127753"
                     /translation="MWIRPLQAELSDNTLALYAPNRFVLDWVRDKYLNNINGLLNDFC
                     GSDAPQLRFEVGTKPVTQTVRETVNVAVPAQAAPAPAPRVAPAARPGWDNVPAPAEPT
                     YRSNVNVKHTFDNFVEGKSNQLARAAARQVADNPGGAYNPLFLYGGTGLGKTHLLHAV
                     GNGIMARKPNAKVVYMHSERFVQDMVKALQNNAIEEFKRYYRSVDALLIDDIQFFANK
                     ERSQEEFFHTFNALLEGNQQIILTSDRYPKEINGVEDRLKSRFGWGLTVAIEPPELET
                     RVAILMKKADENDIRLPGEVAFFIAKRLRSNVRELEGALNRVIANANFTGRAITIDFV
                     REALRDLLALQEKLVTIDNIQKTVAEYYKIKVADLLSKRRSRSVARPRQMAMALAKEL
                     TNHSLPEIGDAFGGRDHTTVLHACRKIEQLREESHDIKEDFSNLIRTLSS"
     misc_feature    82..1401
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="chromosomal replication initiator protein DnaA;
                     Region: DnaA; TIGR00362"
                     /db_xref="CDD:273037"
     misc_feature    <82..207
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:288486"
     misc_feature    403..1056
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="Bacterial dnaA protein; Region: Bac_DnaA;
                     pfam00308"
                     /db_xref="CDD:278724"
     misc_feature    520..543
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(523..546,709..711,811..813)
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    697..714
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    847..849
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1132..1401
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1201..1203,1225..1230,1249..1251,1267..1275,
                     1300..1314,1321..1323,1330..1335)
                     /gene="dnaA"
                     /locus_tag="ECL_00001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            1415..2515
                     /locus_tag="ECL_00002"
                     /db_xref="GeneID:9122513"
     CDS             1415..2515
                     /locus_tag="ECL_00002"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit beta"
                     /protein_id="YP_003610519.1"
                     /db_xref="GeneID:9122513"
                     /translation="MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSL
                     TGTDLEMEMIARVTLTQPHDAGATTVPARKFFDICRGLPEGAEIAVQLEGDRMLVRSG
                     RSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLF
                     ETEGEELRTVATDGHRLAVCSMPIGDSLPNHSVIVPRKGVIELMRMLDGGDTPLRVQI
                     GSNNIRAHVGDFVFTSKLVDGRFPDYRRVLPKNPDKTLEAGCDSLKQAFARAAILSNE
                     KFRGVRLYVSENQIKITANNPEQEEAEEILDVTYAGAEMEIGFNVSYVLDVLNALKCE
                     NVRILLTDSVSSVQIEDAASQSAAYVVMPMRL"
     misc_feature    1415..2512
                     /locus_tag="ECL_00002"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    order(1484..1486,1631..1633,1652..1654,2006..2008)
                     /locus_tag="ECL_00002"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1634..1636,1643..1645,1721..1723,1727..1729,
                     2228..2230,2321..2326)
                     /locus_tag="ECL_00002"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(1928..1930,1934..1945,2372..2374,2498..2509)
                     /locus_tag="ECL_00002"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(1928..1930,1934..1939,2153..2155,2258..2260,
                     2297..2302,2381..2383,2498..2509)
                     /locus_tag="ECL_00002"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2515..3588
                     /locus_tag="ECL_00003"
                     /db_xref="GeneID:9122514"
     CDS             2515..3588
                     /locus_tag="ECL_00003"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein F"
                     /protein_id="YP_003610520.1"
                     /db_xref="GeneID:9122514"
                     /translation="MSLTRLLIRDFRNIESADLALSPGFNFLVGANGSGKTSVLEAIY
                     TLGHGRAFRSLQIGRVIRHEQESFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGTDG
                     HKVAELALLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEAGFFNAWSNLKRLLKQ
                     RNAALRQVTRYAQLRPWDMELIPLAEQISRWRAEYSAGIAEDMADTCKQFLPEFSLTF
                     SFQRGWEKETDYAEVLERNFERDRMLTYTAHGPHKADFRIRADGAPVEDTLSRGQLKL
                     LMCALRLAQGEFLTRESGRRCLYLIDDFASELDDARRGLLASRLKATQSQVFVSAISA
                     EHVMDMSDENSKMFTVEKGKITD"
     misc_feature    2515..3579
                     /locus_tag="ECL_00003"
                     /note="recF protein; Region: recf; TIGR00611"
                     /db_xref="CDD:273173"
     gene            3617..6028
                     /gene="gyrB"
                     /locus_tag="ECL_00004"
                     /db_xref="GeneID:9122515"
     CDS             3617..6028
                     /gene="gyrB"
                     /locus_tag="ECL_00004"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase subunit B"
                     /protein_id="YP_003610521.1"
                     /db_xref="GeneID:9122515"
                     /translation="MSNSYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFEVV
                     DNAIDEALAGHCKDIIVTIHADNSVSVQDDGRGIPTGIHPEEGVSAAEVIMTVLHAGG
                     KFDDNSYKVSGGLHGVGVSVVNALSQKLELVIQREGKIHRQIYQHGVPEAPLAVTGDT
                     EKTGTMVRFWPSLETFTNVTEFEYDILAKRLRELSFLNSGVSIRLRDKRDNKEDHFHY
                     EGGIKAFVEYLNKNKTPIHPNIFYFSTEKDGIGVEVALQWNDGFQENIYCFTNNIPQR
                     DGGTHLAGFRAAMTRTLNAYMDKEGYSKKAKVSATGDDAREGLIAVVSVKVPDPKFSS
                     QTKDKLVSSEVKSAVEQQMNELLSDYLQENPNDAKIVVGKIIDAARAREAARKAREMT
                     RRKGALDLAGLPGKLADCQERDPALSELYLVEGDSAGGSAKQGRNRKNQAILPLKGKI
                     LNVEKARFDKMLSSQEVATLITALGCGIGRDEYNPDKLRYHSIIIMTDADVDGSHIRT
                     LLLTFFYRQMPEIVERGHVYIAQPPLYKVKKGKQEQYIKDDDAMDQYQIAIALDGATL
                     HANSSAPALAGEPLERLVSEFNATQKMIGRMERRYPKALLKELIYQPTLTEADLSNEQ
                     AVTRWVNALVSELNEKEQHGSQWKFDVQQNAAQQFEPIIRVRTHGVDTDYPLEHEFVT
                     GPEYRRICTLGEKLRGLIEDDAFIERGERRQPVASFEQALEWLVKESRRGLSIQRYKG
                     LGEMNPDQLWETTMDPESRRMLRVTVKDAIAADQLFTTLMGDAVEPRRAFIEENALKA
                     ANIDI"
     misc_feature    3617..6025
                     /gene="gyrB"
                     /locus_tag="ECL_00004"
                     /note="DNA gyrase subunit B; Provisional; Region: gyrB;
                     PRK14939"
                     /db_xref="CDD:237860"
     gene            complement(6049..6996)
                     /locus_tag="ECL_00005"
                     /db_xref="GeneID:9122516"
     CDS             complement(6049..6996)
                     /locus_tag="ECL_00005"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003610522.1"
                     /db_xref="GeneID:9122516"
                     /translation="MTSTLKDIPVFVAAVEAGSFAQAAIRLHLSRSAVGKSIARLEER
                     LGVRLFHRTTRSQSLTDNGALFYERCLRALEEIRGAESLLETGKQQISGRLRVAMPVL
                     FGRQCVAPLLIELAQEHPGLELEMSFSDRVVDLVEEGFDMAVRNGTLQDSSVLVVRRL
                     GEHRMVLCAAPEYLQKSGQPDTVADLPHHTAINYLRAGRVLPWQLMDNEGRSHTFTPR
                     SSLNMDDLQAICDAALAGYGIAWLPCWMARREIQQGKLIPLLKQAPDVRFDVHAVWQQ
                     TPHLPLRVRIAIDTLASRLPSVLSLDMPEPKKSRAKCAA"
     misc_feature    complement(6808..6981)
                     /locus_tag="ECL_00005"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:306606"
     misc_feature    complement(6124..6720)
                     /locus_tag="ECL_00005"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_6; cd08475"
                     /db_xref="CDD:176164"
     misc_feature    complement(order(6187..6189,6268..6270,6319..6321,
                     6508..6510,6514..6516,6559..6561,6676..6678,6688..6690))
                     /locus_tag="ECL_00005"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176164"
     misc_feature    complement(order(6292..6294,6301..6306,6325..6339,
                     6427..6429,6613..6633,6637..6639,6649..6651,6658..6663,
                     6667..6672,6682..6687))
                     /locus_tag="ECL_00005"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176164"
     gene            7107..8132
                     /locus_tag="ECL_00006"
                     /db_xref="GeneID:9122517"
     CDS             7107..8132
                     /locus_tag="ECL_00006"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase protein"
                     /protein_id="YP_003610523.1"
                     /db_xref="GeneID:9122517"
                     /translation="MAETMQRWSMNALGRENLKLTQEPVPKPGPGEVRVRVNAVALNY
                     RDKMVIEGMMPIPLSFPFTPASDMAGVVDSIGEGVTRFQPGARVISTFFPEWIDGRPQ
                     ADARHLPYKTSGGYFPGMLAEYVIVNENGLVAAPETLDDVEASTLPCAGLTAWFALVE
                     RGNLRAGQSVLVQGTGGVAIFALQIAKALGAEVYVTSGSDEKLARAKKLGADRGINRL
                     KGDWAEALLTLTQDRGIDHIIETVGGENLQHSLRAVAVHGRISVIGVLAGSEITLSAG
                     ELLLKSPVIQGIGVGHRRALEEFVRAVEVTGLKPVIEQRYRFDQLEQALEHLDRGAFG
                     KIVLTRE"
     misc_feature    7119..8123
                     /locus_tag="ECL_00006"
                     /note="Medium chain dehydrogenases/reductase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR7; cd08276"
                     /db_xref="CDD:176237"
     misc_feature    order(7233..7241,7248..7250,7551..7553,7563..7565,
                     7626..7643,7695..7700,7710..7712,7755..7757,7827..7832,
                     7836..7838,7893..7898,7968..7976)
                     /locus_tag="ECL_00006"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176237"
     gene            8247..9059
                     /locus_tag="ECL_00007"
                     /db_xref="GeneID:9122518"
     CDS             8247..9059
                     /locus_tag="ECL_00007"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphatase"
                     /protein_id="YP_003610524.1"
                     /db_xref="GeneID:9122518"
                     /translation="MAIKLIAIDMDGTLLLPDHTISPAVKNAIAAARAKGVNVVLTTG
                     RPYAGVHSYLKELHMNQPGDYCITYNGALVQKAADGSTVAQTALNYDDYLFLEKLSRE
                     VGSHFHALDRTTLYTANRDISYYTVHESYVATIPLVFCEAEKMDPNTQFLKVMMIDEP
                     EVLDKAIARIPAEVKEKYTVLKSAPYFLEILDKRVNKGTGVKSLADALGIKPEEIMAL
                     GDQENDIAMIEYAGMGVAMENAIPSVKEVANFVTKSNLEDGVAYAIEKFVLS"
     misc_feature    8247..9053
                     /locus_tag="ECL_00007"
                     /note="sugar phosphate phosphatase; Provisional; Region:
                     PRK10513"
                     /db_xref="CDD:182509"
     gene            9286..9975
                     /locus_tag="ECL_00008"
                     /db_xref="GeneID:9122519"
     CDS             9286..9975
                     /locus_tag="ECL_00008"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_003610525.1"
                     /db_xref="GeneID:9122519"
                     /translation="MTLNKTDRIVITLGTQIVGGKYVPGSPLPAEAELCEEFETSRNI
                     IREVFRSLMAKRLIEMKRYRGAFVAPRNQWNYLDTDVLQWVLENDYDPRLIGAMSEVR
                     NLVEPAIARWAAERATSGDLAQIESALNDMIANNQNREAFNEADIRYHEAVLQSVHNP
                     VLQQLSVAISSLQRAVFERTWMGDEANMPKTLQEHKALFDAIRHQDGDAAEQAALTMI
                     ASSTRRLKEIT"
     misc_feature    9289..9972
                     /locus_tag="ECL_00008"
                     /note="DNA-binding transcriptional regulator, FadR family
                     [Transcription]; Region: FadR; COG2186"
                     /db_xref="CDD:225097"
     gene            9972..10850
                     /locus_tag="ECL_00009"
                     /db_xref="GeneID:9122520"
     CDS             9972..10850
                     /locus_tag="ECL_00009"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygalactonate kinase"
                     /protein_id="YP_003610526.1"
                     /db_xref="GeneID:9122520"
                     /translation="MTSRYIAIDWGSTNLRAWLYQGEQCLESRQSEAGVTRLNGKSPE
                     AVLAEVTQNWRDSATPVVMAGMVGSNVGWKIAPYLPVPVSFSAIGKQLTSVGDNILIV
                     PGLCVSRDDNHNVMRGEETQLLGARTLSPSSVYVMPGTHCKWVQADAEHIHDFRTVMT
                     GELHHLLLNHSLLGAGLPEQVPSPEAFAAGLARGIAFPDVLPQLFEVRASHVLGNLPR
                     EQVSEFLSGLLIGAEVASMREFVGCEQAVTIVAGAALTSRYEQAFRAIGREVSTVSGD
                     TAFQAGIRSIAHAVAN"
     misc_feature    9978..10847
                     /locus_tag="ECL_00009"
                     /note="2-keto-3-deoxy-galactonokinase [Carbohydrate
                     transport and metabolism]; Region: DgoK; COG3734"
                     /db_xref="CDD:226257"
     gene            10834..11451
                     /locus_tag="ECL_00010"
                     /db_xref="GeneID:9122521"
     CDS             10834..11451
                     /locus_tag="ECL_00010"
                     /codon_start=1
                     /transl_table=11
                     /product="2-dehydro-3-deoxy-6-phosphogalactonate aldolase"
                     /protein_id="YP_003610527.1"
                     /db_xref="GeneID:9122521"
                     /translation="MQWQTSLPLIAILRGITPDEALAHVGAVIDAGFDAVEIPLNSPE
                     WEKSIPTVVEAFGDKALIGAGTVLQPEQVERLAKMGCKLIVTPNINPEVIRRAVSHGM
                     TVCPGCATATEAFTALEAGAQSLKIFPSSAFGPDYIKALKAVLPASVPVFAVGGVTPE
                     NLAQWINAGCVGAGLGSDLYRAGQSVERTAQQAAAFVKAYREAVQ"
     misc_feature    10834..11442
                     /locus_tag="ECL_00010"
                     /note="2-dehydro-3-deoxy-6-phosphogalactonate aldolase;
                     Reviewed; Region: PRK09140"
                     /db_xref="CDD:181670"
     gene            11448..12596
                     /locus_tag="ECL_00011"
                     /db_xref="GeneID:9122522"
     CDS             11448..12596
                     /locus_tag="ECL_00011"
                     /codon_start=1
                     /transl_table=11
                     /product="galactonate dehydratase"
                     /protein_id="YP_003610528.1"
                     /db_xref="GeneID:9122522"
                     /translation="MKITKLTTYRLPPRWMFLKIETDEGVVGWGEPVIEGRARTVEAA
                     VHELGEYLIGQDPARINDLWQVMYRAGFYRGGPILMSAIAGIDQALWDIKGKVLNAPV
                     WQLMGGLVRDKIKAYSWVGGDRPAEVIDGITQLRNIGFDTFKLNGCEEMGVIDNSRAV
                     DRAVNTVAQIREAFGNEIEFGLDFHGRVSAPMAKVLIKELEPYRPLFIEEPVLAEQAE
                     YYPKLAEQTHIPIAAGERMFSRFEFKRVLEAGGIAILQPDLSHAGGITECYKIAGMAE
                     AYDVALAPHCPLGPVALAACLHVDFVSRNAVFQEQSMGIHYNKGAELLDFVKNKEDFS
                     MEGGFFKPLMKPGLGVDIDEAKVIELSKNAPDWRNPLWRHEDGSVAEW"
     misc_feature    11448..12593
                     /locus_tag="ECL_00011"
                     /note="galactonate dehydratase; Provisional; Region:
                     PRK14017"
                     /db_xref="CDD:184455"
     gene            12758..14050
                     /locus_tag="ECL_00012"
                     /db_xref="GeneID:9122523"
     CDS             12758..14050
                     /locus_tag="ECL_00012"
                     /codon_start=1
                     /transl_table=11
                     /product="D-galactonate transporter"
                     /protein_id="YP_003610529.1"
                     /db_xref="GeneID:9122523"
                     /translation="MDIPVTATKTGRRRYLTLIMIFITVVICYVDRANLAVASAHIQE
                     EFGITKAEMGYVFSAFAWLYTLYQIPGGWFLDRVGSRLTYFIAILGWSVATLFQGFAT
                     GLMSLIGLRAITGVFEAPAFPTNNRMVTSWFPEHERASAVGFYTSGQFVGLAFLTPLL
                     IWIQELLSWHWVFIVTGGIGIIWSLIWFKVYQPPRLTKNITKAELDYIRDGGGLVDGD
                     APVKKEARQPLTRADWKLVFHRKLVGVYLGQFAVTSTLWFFLTWFPNYLTQEKGITAL
                     KAGFMTTVPFLAAFFGVLLSGWLADKLVKKGVSLGVARKTPIICGLLISTCIMGANYT
                     NDPVWIMTLMALAFFGNGFASITWSLVSSLAPMRLIGLTGGVFNFVGGLGGITVPLVI
                     GYLAQDYGFGPALVYISAVALIGALSYILLVGDVKRVG"
     misc_feature    12824..14026
                     /locus_tag="ECL_00012"
                     /note="D-galactonate transporter; Region: 2A0114;
                     TIGR00893"
                     /db_xref="CDD:273326"
     gene            14101..15330
                     /locus_tag="ECL_00013"
                     /db_xref="GeneID:9122524"
     CDS             14101..15330
                     /locus_tag="ECL_00013"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ATP/GTP-binding protein"
                     /protein_id="YP_003610530.1"
                     /db_xref="GeneID:9122524"
                     /translation="MKQITFASRNHQLTNTNTWTPDSQWLVYDVRPSGASFTGETIER
                     VNVSTGEVEVIYRAKHGAHVGVVTVHPAQDKYVFIHGPKNPDADWQYDFHHRQGVIVH
                     NGQASNLDAMDITVPYTAGALRGGSHVHVFSPNGQFVSFTYNDHVLHERDPKLDLRNV
                     GVAAPFGPVTPQGNHPHEYPGTFWSVLVSRTTPNPQPGSDEINRAYEEGWVGNGRLAF
                     IGDTLSVKGEKVPELFIVDLPKDEQGWKQAGDAPLQGTPETMPAPPAGVLQRRLTFTH
                     QKAYPGLVNVPRHWVRSNPQGTQIAFLMRDDNGIVQLWLISPEGGEPRQLTHTESGIQ
                     SAFNWHPSGDSLGFVLENRIACCDAQTGEVTFLTSDHGNPPSADAVVFSPNGRAIAWM
                     EEKEGFRQLWLTETVQD"
     misc_feature    14287..14634
                     /locus_tag="ECL_00013"
                     /note="Protein of unknown function (DUF3748); Region:
                     DUF3748; pfam12566"
                     /db_xref="CDD:315276"
     misc_feature    <14908..15309
                     /locus_tag="ECL_00013"
                     /note="Dipeptidyl peptidase IV (DPP IV) N-terminal region;
                     Region: DPPIV_N; cl27623"
                     /db_xref="CDD:332444"
     gene            complement(15327..15662)
                     /locus_tag="ECL_00014"
                     /db_xref="GeneID:9122525"
     CDS             complement(15327..15662)
                     /locus_tag="ECL_00014"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610531.1"
                     /db_xref="GeneID:9122525"
                     /translation="MMMKNVLIKLTTFSGVVLLCGCSSVMSHTGGKEGTYPGTRASAA
                     MISDDDTNWGTKSLVILDMPFTAVADTLLLPWDMFRTDSSVRSRVEKSEQQNLATNAV
                     IPPAEMPRP"
     misc_feature    complement(15330..15656)
                     /locus_tag="ECL_00014"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11616"
                     /db_xref="CDD:183233"
     gene            15974..16384
                     /gene="ibpA"
                     /locus_tag="ECL_00015"
                     /db_xref="GeneID:9122526"
     CDS             15974..16384
                     /gene="ibpA"
                     /locus_tag="ECL_00015"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock protein"
                     /protein_id="YP_003610532.1"
                     /db_xref="GeneID:9122526"
                     /translation="MRNFDLSPLYRSAIGFDRLFNHLENNQSQSNGYPPYNVELVDEN
                     HYRIAIAVAGFAESELEITAQDNLLVVKGSHTAEQKERTYLYQGIAERNFERKFQLAE
                     NIHVKGANLVNGLLFIELERVIPEEKKPRRIEIN"
     misc_feature    15974..16381
                     /gene="ibpA"
                     /locus_tag="ECL_00015"
                     /note="heat shock protein IbpA; Provisional; Region:
                     PRK10743"
                     /db_xref="CDD:182691"
     misc_feature    order(16079..16093,16118..16120,16124..16126,16130..16135,
                     16259..16261,16313..16318)
                     /gene="ibpA"
                     /locus_tag="ECL_00015"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            16521..16949
                     /gene="ibpB"
                     /locus_tag="ECL_00016"
                     /db_xref="GeneID:9122527"
     CDS             16521..16949
                     /gene="ibpB"
                     /locus_tag="ECL_00016"
                     /codon_start=1
                     /transl_table=11
                     /product="heat shock chaperone"
                     /protein_id="YP_003610533.1"
                     /db_xref="GeneID:9122527"
                     /translation="MRNYDLSPLLRQWIGFDKLANALQSTTEHQTFPPYNIEKSDDNH
                     YRITLALAGFRQDDLDIQLEGTRLTVKGSPEKQETETKWLHQGLVTQPFSLSFTLADH
                     MEVSGATFTNGLLHIDLVRNVPEAIAPQRIAISERPALNS"
     misc_feature    16521..16946
                     /gene="ibpB"
                     /locus_tag="ECL_00016"
                     /note="heat shock chaperone IbpB; Provisional; Region:
                     PRK11597"
                     /db_xref="CDD:183223"
     misc_feature    order(16623..16637,16662..16664,16668..16670,16674..16679,
                     16803..16805,16857..16862)
                     /gene="ibpB"
                     /locus_tag="ECL_00016"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:107227"
     gene            17114..18775
                     /locus_tag="ECL_00017"
                     /db_xref="GeneID:9122528"
     CDS             17114..18775
                     /locus_tag="ECL_00017"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610534.1"
                     /db_xref="GeneID:9122528"
                     /translation="MSDIALTVSVLALVAVVGLWIGNIKIRGVGFGIGGVLFGGIFVG
                     HFADKLGLVLSADMLHFTQEFGLILFVYTIGIQVGPGFFASLRVSGLRLNLFALGIVV
                     MGGLVTAILHKLFAIPLPVVLGIFSGAVTNTPALGAGQQILRDLGIEPGIVDQMGMSY
                     AMAYPFGICGILLSMWLVRVLFRINVDKEAKDHETTLTNGHMPIKTINIRVDNPNLNN
                     MAIQDVPILNSANIICSRLKRDEMLMVPAPGTIIRQGDLLHLVGQPGDLNNARLVIGQ
                     EVDTSLSTRGTDMRVERVVVTNEHVLGKKIRDLQVKERYDVVISRLNRAGVELVASPE
                     ASLQFGDILNLVGRPSSIDAVADMVGNAQQKLQQVQMLPVFIGIGLGVLLGSIPLYIP
                     GFPVALKLGLAGGPLIMALILGRIGCVGKLYWFMPPSANLALRELGIVLFLAVVGLKS
                     GGDFVDTLVRGEGMSWVGYGIFITAIPLLTVGILARMFAKMNYLTLCGMLAGSMTDPP
                     ALAFANSLHATSGAAALSYATVYPLVMFLRIITPQLLAVLFWGMS"
     misc_feature    17114..18769
                     /locus_tag="ECL_00017"
                     /note="putative transporter; Validated; Region: PRK03818"
                     /db_xref="CDD:179654"
     gene            complement(18743..19489)
                     /locus_tag="ECL_00018"
                     /db_xref="GeneID:9122529"
     CDS             complement(18743..19489)
                     /locus_tag="ECL_00018"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="YP_003610535.1"
                     /db_xref="GeneID:9122529"
                     /translation="MIYKSIADRLRLRLNSSDYNIGSPIPGEKALAQEFGVARMTIRK
                     ALDLLVSWGLVERRHGSGTFVARKDVHHETTNLTGLVEVLRQQGKEVQSKVLQFEVMP
                     APPAIASQLRIQVDERIYFSRRVRYVDGKPLMLEDSFMPVKLFRNLSLAHLEGSKFDY
                     IEKECGITISGNYESLTPVLADKQLAGYMNLPEQTPLLRITSLSYSDSGEFLNYSVMF
                     RNTSDYQVDYHLRRIHPDDLLTHPPEQHRQ"
     misc_feature    complement(18815..19486)
                     /locus_tag="ECL_00018"
                     /note="DNA-binding transcriptional regulator, GntR family
                     [Transcription]; Region: MngR; COG2188"
                     /db_xref="CDD:225099"
     gene            19712..21334
                     /locus_tag="ECL_00019"
                     /db_xref="GeneID:9122530"
     CDS             19712..21334
                     /locus_tag="ECL_00019"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS family protein IIC"
                     /protein_id="YP_003610536.1"
                     /db_xref="GeneID:9122530"
                     /translation="MLSQIQRFGGAMFTPVLLFPFAGIVVGIAIMLRNPLFVGEALTA
                     PDNLFAQIVHIIEEGGWAVFRNMPLIFAVGLPIGLAKQAQGRACLAVLISFLTWNYFI
                     NAMGMTWGHFFGVDFSAEPTAGSGLAMIAGIKTLDTSIIGAIAISGIVTAIHNRFFEK
                     PLPVFLGIFQGTSFVVIIAFFVMIPCAWLTLLGWPKVQMGIESLQAFLRSAGALGVWV
                     YTFLERILIPTGLHHFVYGPFIFGPAAVEGGIQVYWAQHLQAFSQSTLPLKTLFPEGG
                     FALHGNAKVFGSVGIALAIWYTASPENRVKVAGLLIPATLTAVLVGITEPLEFTFLFI
                     SPLLFAIHAVLAATMATVMYTFGVVGNMGGGLLDQFLPQNWIPMFHNHASTVFTQIGI
                     GVCFTGLYFVVFKTLIERLNLKTPGREESEIKLYSKADYKAARGQTTAPAAASQQVGQ
                     AAGFLQALGGAANIESINNCATRLRIALVDMAQTQSDEVFKALGAHGVVRRGNGIQVI
                     VGLHVPQVRDQLESLMKTPLTNEQTTLTEAIS"
     misc_feature    19715..21283
                     /locus_tag="ECL_00019"
                     /note="bifunctional PTS system maltose and
                     glucose-specific transporter subunits IICB; Provisional;
                     Region: PRK10110; cl28341"
                     /db_xref="CDD:333161"
     gene            21331..22653
                     /locus_tag="ECL_00020"
                     /db_xref="GeneID:9122531"
     CDS             21331..22653
                     /locus_tag="ECL_00020"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose-6'-phosphate glucosidase"
                     /protein_id="YP_003610537.1"
                     /db_xref="GeneID:9122531"
                     /translation="MKKFSVVIAGGGSTFTPGIVLMLLANRDRFPLRALKFYDNDGAR
                     QETIAEACKIILKEQAPEIEFSYTTDPKAAFTDVDFVMAHIRVGKYPMREKDEKIPLR
                     HGVLGQETCGPGGISYGMRSIGGVLELVDYMEQYSPNAWMLNYSNPAAIVAEATRRLR
                     PHAKILNICDMPIGIEGRMAQIVGLKDRKQMRVRYYGLNHFGWWTSIEDLNGNDLMPK
                     LREYVAKHGYVPPSEDAHTEASWNDTFAKAKDVQALDPDTMPNTYLKYYLFPDYVVAH
                     ANPERTRANEVMDHREKHVFSSCRAIIEAGKSSAGELEIDEHASYIVDLATAIAFNTQ
                     ERMLLIVPNNGAIHNFDADAMVEIPCLVGHNGPEPLTVGDIPHFQKGLMSQQVAVEKL
                     VVDAWEQRSYQKLWQAITLSKTVPSASVAKAILDDLIEANKDYWPELH"
     misc_feature    21340..22650
                     /locus_tag="ECL_00020"
                     /note="Glycoside Hydrolases Family 4; GlvA- and pagL-like
                     glycosidases; Region: GH4_GlvA_pagL_like; cd05298"
                     /db_xref="CDD:133434"
     misc_feature    order(21364..21375,21445..21450,21580..21588,21598..21600,
                     21655..21657,21682..21684,21763..21765,21769..21771,
                     21832..21840,22201..22203)
                     /locus_tag="ECL_00020"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:133434"
     misc_feature    order(21607..21609,21655..21657,21769..21771,21835..21843,
                     21928..21930,22117..22119,22177..22179,22201..22203)
                     /locus_tag="ECL_00020"
                     /note="sugar binding site [chemical binding]; other site"
                     /db_xref="CDD:133434"
     misc_feature    order(21835..21837,21928..21930)
                     /locus_tag="ECL_00020"
                     /note="divalent metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133434"
     misc_feature    order(21895..21897,21904..21906,21952..21954,21964..21966,
                     22324..22326,22360..22362,22417..22422,22426..22428,
                     22432..22443)
                     /locus_tag="ECL_00020"
                     /note="putative tetramer (dimer of dimers) interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:133434"
     misc_feature    order(22096..22098,22132..22134,22456..22461,22471..22473,
                     22480..22482,22492..22494,22501..22503,22513..22515,
                     22531..22533,22537..22539,22546..22551,22558..22563,
                     22576..22578,22582..22584,22588..22590,22594..22596)
                     /locus_tag="ECL_00020"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133434"
     gene            22746..23093
                     /locus_tag="ECL_00021"
                     /db_xref="GeneID:9122532"
     CDS             22746..23093
                     /locus_tag="ECL_00021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610538.1"
                     /db_xref="GeneID:9122532"
                     /translation="MKISRLGEAPDYRFSLANERTYLAWIRTALGFLAAGVGLDQLAP
                     DFATPLIREVLALLLCLFAGVLAIYGYLRWLRNEKAMRLKQDLPYTRGLLIISAILLT
                     VAGVVMVLVVYGG"
     misc_feature    22746..23048
                     /locus_tag="ECL_00021"
                     /note="Domain of unknown function (DUF202); Region:
                     DUF202; cl09954"
                     /db_xref="CDD:324552"
     gene            23083..23430
                     /locus_tag="ECL_00022"
                     /db_xref="GeneID:9122533"
     CDS             23083..23430
                     /locus_tag="ECL_00022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610539.1"
                     /db_xref="GeneID:9122533"
                     /translation="MADSRKARREADPGLQPERTSLAWLRTLLGYGALIALAIKHNWH
                     RTGLPFWISLVVLALVAIILWRYTRSRNVMDVAQDDFVQPKAVRDKFLIALAVLSLSL
                     LFAVTHIQQIVHL"
     misc_feature    23116..23298
                     /locus_tag="ECL_00022"
                     /note="Domain of unknown function (DUF202); Region:
                     DUF202; pfam02656"
                     /db_xref="CDD:308336"
     gene            complement(23463..24749)
                     /locus_tag="ECL_00023"
                     /db_xref="GeneID:9122534"
     CDS             complement(23463..24749)
                     /locus_tag="ECL_00023"
                     /codon_start=1
                     /transl_table=11
                     /product="D-serine deaminase"
                     /protein_id="YP_003610540.1"
                     /db_xref="GeneID:9122534"
                     /translation="MENATITALTAQFPLVEDLMALKETTWLNPRTTSLAEGLPYVGL
                     TKADVDDAHARLNRFAPYLAKAFPETAATGGIIESELVAIPAMKKRLERESGKALPGT
                     LLLKKDSHLPISGSIKARGGIYEVLTHAEKLALEAGLLSTEDDYSILLEPRFKDFFSQ
                     YSIAVGSTGNLGMSIGIMSARIGFKVTVHMSADAREWKKAKLRSHGVTVVEYEQDYGV
                     AVEQGRKAAENDPNCFFIDDENSRTLFLGYAVAGERLKAQFAEQGRVVDAEHPLYVYL
                     PCGVGGGPGGVAFGLKLAFGDNVHCFFAEPTHSPCMLLGVYTGLHDEIAVQDLGIDNV
                     TAADGLAVGRASGFVGRAMERLLDGFYTLSDQSMYDMLGWLAQEEGIRLEPSALAGMA
                     GPLRVQADANVTHLVWATGGGMVPEDEMAKYLAKGK"
     misc_feature    complement(23466..24737)
                     /locus_tag="ECL_00023"
                     /note="D-serine dehydratase; Provisional; Region:
                     PRK02991"
                     /db_xref="CDD:235096"
     misc_feature    complement(order(23517..23522,23592..23594,23901..23915,
                     24240..24242,24396..24401))
                     /locus_tag="ECL_00023"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:107208"
     misc_feature    complement(24396..24398)
                     /locus_tag="ECL_00023"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107208"
     gene            complement(24767..25084)
                     /locus_tag="ECL_00024"
                     /db_xref="GeneID:9122535"
     CDS             complement(24767..25084)
                     /locus_tag="ECL_00024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610541.1"
                     /db_xref="GeneID:9122535"
                     /translation="MGSPVWVVVTLLVSIVLIVLTIVKLKFHPFLAPMLPLYPNVSPE
                     IITIAIGSGAIGCTIVTDSLFWLVKQYCGATLNETFKYYTTATFIASVLALGGTFLLS
                     FII"
     misc_feature    complement(<24980..25084)
                     /locus_tag="ECL_00024"
                     /note="Anion permease ArsB/NhaD. These permeases have been
                     shown to translocate sodium, arsenate, antimonite, sulfate
                     and organic anions across biological membranes in all
                     three kingdoms of life. A typical anion permease contains
                     8-13 transmembrane helices...; Region: ArsB_NhaD_permease;
                     cl21473"
                     /db_xref="CDD:328738"
     misc_feature    complement(24770..>24994)
                     /locus_tag="ECL_00024"
                     /note="Anion permease ArsB/NhaD. These permeases have been
                     shown to translocate sodium, arsenate, antimonite, sulfate
                     and organic anions across biological membranes in all
                     three kingdoms of life. A typical anion permease contains
                     8-13 transmembrane helices...; Region: ArsB_NhaD_permease;
                     cl21473"
                     /db_xref="CDD:328738"
     gene            25289..26215
                     /locus_tag="ECL_00025"
                     /db_xref="GeneID:9122536"
     CDS             25289..26215
                     /locus_tag="ECL_00025"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding transcriptional regulator"
                     /protein_id="YP_003610542.1"
                     /db_xref="GeneID:9122536"
                     /translation="MTDANEVRNRLLNGWQLSKMYTFEVAARHESFALAAAELSLSPS
                     AVSHRINLLEEELGIQLFVRSHRKVELTLEGKRVYWTLKSSLDTLNQEILDIKNQALS
                     GTLTVYSRPSIAQCWLVPMLGDFTRRYPSISLTILTGNEYVNMQRTGIDLAIYFDDTP
                     PNYLSHHFLMDEEILPVCSPAYAREHALLKNPDNLSHCTLLHDRQAWSNDSGTDEWLS
                     WAQHFAMNMPSSSGIGFDRSDLAIVAAMNHVGVAMGRKRLVQKRLERGELIAPFGNKT
                     LKCHQHYYISTLPGRQWPKIDAFIGWLRELAG"
     misc_feature    25292..26212
                     /locus_tag="ECL_00025"
                     /note="DNA-binding transcriptional regulator DsdC;
                     Provisional; Region: PRK10086"
                     /db_xref="CDD:182231"
     gene            26300..27388
                     /locus_tag="ECL_00026"
                     /db_xref="GeneID:9122537"
     CDS             26300..27388
                     /locus_tag="ECL_00026"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610543.1"
                     /db_xref="GeneID:9122537"
                     /translation="MLKPLIATALLLSSGWAIAAEPPLTAALYAQKLGVGMDVDWART
                     ERGIREFDPLVVRDFRAKGISHVRIRVADEPTEARLIHLRKLVEACEQYGVIPIIAYQ
                     ADSYKNDPKADNEKEVTDWWIAVAHYFGKRSPLLGFDLIYEPADKLNHNAASLNRVYE
                     KTIKVIHSIDADRMIFIAPRLRAAPEDLPSLKLPAHSQNFLLAEWHIFPWGPLKNNGK
                     YPWTSGMAAEKAAIHNRIATALRWQQKTGHVSWVGGWGVGESNRFTPTASQMAFATFM
                     ACELQKAKIPYAINADFQFYDGEEGAWRPAPEPLLEAMIAPACEKPGEKPGHHAVKQA
                     ARGGEHATPAAASTAKSVAPSASSVNPN"
     misc_feature    <26552..>26830
                     /locus_tag="ECL_00026"
                     /note="Glycosyl hydrolase family 1; Region: Glyco_hydro_1;
                     cl23725"
                     /db_xref="CDD:329037"
     gene            complement(27291..28448)
                     /locus_tag="ECL_00027"
                     /db_xref="GeneID:9122538"
     CDS             complement(27291..28448)
                     /locus_tag="ECL_00027"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug resistance protein D"
                     /protein_id="YP_003610544.1"
                     /db_xref="GeneID:9122538"
                     /translation="MLMLVLLVAVGQMAQTIYIPAIADMAKELNVREGAVQSVMAAYL
                     LTYGVSQLFYGPLSDRIGRRPVILTGMCIFMVATVIAITTHSLTVLIAASALQGVGTG
                     VGGVMARTLPCDMYQGTQLRHANSLLNMGILVSPLLAPLIGGLLDTMWSWRACYAFLL
                     VLCVIVTFSMARWMPETRPQDAPRTKLLASYKTLFGNGALTCYLLMLIGGLAGIAVFE
                     ACSGVLLGAGLGLSSMVVSILFILPIPAAFFGAWFAGRQNKRFSTLMWQSVISCLLAG
                     LMMWIPGLFGVMTVWTLLIPAALFFFGAGMLFPLATSGAMEPFPFLAGTAGALVGGLQ
                     NIGSGALAWLSAMMPQTGQASLGLLMTLMGLLILLCWLPLASRVPHHEQPV"
     misc_feature    complement(27294..28448)
                     /locus_tag="ECL_00027"
                     /note="multidrug resistance protein D; Provisional;
                     Region: emrD; PRK11652"
                     /db_xref="CDD:183259"
     misc_feature    complement(order(27435..27437,27444..27449,27456..27461,
                     27468..27473,27501..27503,27510..27515,27525..27527,
                     27534..27539,27546..27548,27696..27698,27708..27710,
                     27717..27719,27729..27731,27741..27743,27783..27785,
                     27792..27797,27804..27809,27816..27818,28041..28043,
                     28059..28064,28071..28076,28110..28112,28119..28124,
                     28131..28136,28143..28148,28284..28289,28293..28298,
                     28308..28310,28317..28322,28329..28331,28380..28385,
                     28389..28397,28404..28406))
                     /locus_tag="ECL_00027"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     misc_feature    complement(27918..28322)
                     /locus_tag="ECL_00027"
                     /note="Multidrug resistance protein; Region: 2_A_01_02;
                     TIGR00880"
                     /db_xref="CDD:273318"
     gene            complement(28651..29484)
                     /locus_tag="ECL_00028"
                     /db_xref="GeneID:9122539"
     CDS             complement(28651..29484)
                     /locus_tag="ECL_00028"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integral membrane protein"
                     /protein_id="YP_003610545.1"
                     /db_xref="GeneID:9122539"
                     /translation="MTLSVFCILLFAALLHASWNAIVKAGTDKLYSAISVSGSATLIA
                     LVLLPFSPQPSVASWPFLVVSCALQVVYTVLVAKTYQVSDMSQTYPLMRGTAPLLVAL
                     ISVLVLGDSLSWLAWAGIGVICLSILAMAMNGRLQSRKGIWLALLNACFIAGYTLVDG
                     TGVRLSDTALGYTLWTFFMNGFCLLCWAMVARRREASSYLRLHWKKGLLGGVGTMGSY
                     GLALWAMTQAPLAVVAALRETSILFGALIAFVLLKEKVAGLRIAAALGIAAGAILLRL
                     A"
     misc_feature    complement(28717..29457)
                     /locus_tag="ECL_00028"
                     /note="phosphonate utilization associated putative
                     membrane protein; Region: phn_DUF6; TIGR03340"
                     /db_xref="CDD:274527"
     gene            complement(29547..29993)
                     /locus_tag="ECL_00029"
                     /db_xref="GeneID:9122540"
     CDS             complement(29547..29993)
                     /locus_tag="ECL_00029"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_003610546.1"
                     /db_xref="GeneID:9122540"
                     /translation="MSRLLIEPITPEEPGYIALKAESIAANFNMLRRLEENWQRGENR
                     FNAPGEKLLGAFLNGKLVGVCGLNRDPFSQQPRAGRIRHLYVSEKCRGLGIGKQLLTV
                     VMADASIWFDFLNTHAPDTACGFYRRAGFRLVSDEPRVTHRLFCAV"
     misc_feature    complement(29583..29888)
                     /locus_tag="ECL_00029"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_10; cl26092"
                     /db_xref="CDD:330913"
     gene            30040..30222
                     /locus_tag="ECL_00030"
                     /db_xref="GeneID:9122541"
     CDS             30040..30222
                     /locus_tag="ECL_00030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610547.1"
                     /db_xref="GeneID:9122541"
                     /translation="MRLEPESPKVFQDSIKQLQNSNNEFEDKYHHIHYAHTRLLLVKR
                     STMLAYLSAACCQHLD"
     gene            30983..31477
                     /locus_tag="ECL_00031"
                     /db_xref="GeneID:9122542"
     CDS             30983..31477
                     /locus_tag="ECL_00031"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610548.1"
                     /db_xref="GeneID:9122542"
                     /translation="MYLSIVSIYRYRNVIAHMLYLYFESIMTDSENGNEKNRVRKTDS
                     NVTGLVNNIPASKAARLAIAWTLAKSLSESGLLSEIVVERLARRVPNVVMALQLMGTD
                     QKCALAARRLKVLDPNYYATLYAAQLEMLYYFFEPFLAEIIKKVQTGFYKDFDAIYND
                     LKDK"
     gene            31479..31661
                     /locus_tag="ECL_00032"
                     /db_xref="GeneID:9122543"
     CDS             31479..31661
                     /locus_tag="ECL_00032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610549.1"
                     /db_xref="GeneID:9122543"
                     /translation="MFKSLLSILFTDVLFPVYIFACASLFLWLVPNHWVLLTFIAIVV
                     FIIVHPIIFGRFDKYD"
     misc_feature    31485..>31619
                     /locus_tag="ECL_00032"
                     /note="Haloacid Dehalogenase-like Hydrolases; Region:
                     HAD_like; cl21460"
                     /db_xref="CDD:328728"
     gene            31683..32162
                     /locus_tag="ECL_00033"
                     /db_xref="GeneID:9122544"
     CDS             31683..32162
                     /locus_tag="ECL_00033"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin-coregulated protein"
                     /protein_id="YP_003610550.1"
                     /db_xref="GeneID:9122544"
                     /translation="MSNPAYLFLTDENGSPMVGPCLVSGREGAIELKSFTHNVNIPVD
                     GNTGKLTGTRIHMPVMFQKEFDRVTPFLFRALSTGRTLQSATIKMYQINEAGLEQEYF
                     NIIMENVKITSITPDLYPGANTGTHLETVLIRYEKITWKHCDGNVIYSDAWNERATY"
     misc_feature    31689..32150
                     /locus_tag="ECL_00033"
                     /note="Type VI secretion system effector, Hcp; Region:
                     T6SS_HCP; cl01226"
                     /db_xref="CDD:321401"
     gene            32473..34161
                     /locus_tag="ECL_00034"
                     /db_xref="GeneID:9122545"
     CDS             32473..34161
                     /locus_tag="ECL_00034"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase catalytic subunit"
                     /protein_id="YP_003610551.1"
                     /db_xref="GeneID:9122545"
                     /translation="MASSGTTSTKTRFTGAQLIVHLLERQGITTVAGIPGGTVLPLYD
                     ALSQSTQIRHVLARHEQGAGFIAQGMARTQGKPAVCMACSGPGATNLVTAIADARLDS
                     IPLICITGQVPSSMIGTDAFQEVDTYGISIPITKHNYLVRDITELPQVISYAFRIAQS
                     GRPGPVWIDIPKDVQTAEIEIDVLPEPGERAPAPEFSAESVRDAAAMINAAKRPVLYL
                     GGGAINAADEIRQFAEKANLPTTMTLMALGMLPKAHPLSLGMLGMHGARSTNYILQEA
                     DLLIVMGARFDDRAIGKTEQFCPNAKIIHVDIDRAELGKIKQPHVAIQGDVADVLAQL
                     IPQTDATDRADWRQMVADLQREFPGAIPTEGDPLSHYGLINAVAACVDDSAIITTDVG
                     QHQMWTAQAYPLNRPRQWLTSGGLGTMGFGLPAAVGAALANPDRKVICFSGDGSLMMN
                     IQEMATAAENQLDVKIILMNNEALGLVHQQQSLFYKQGVFAATYPGMINFMQIAAGFG
                     LHTCDLNAEEDAHAALQAAISRPGPALIHVRIDPEQKVYPMVPPGAANTEMVGE"
     misc_feature    32473..34158
                     /locus_tag="ECL_00034"
                     /note="acetolactate synthase catalytic subunit; Validated;
                     Region: PRK08155"
                     /db_xref="CDD:181257"
     gene            34165..34452
                     /locus_tag="ECL_00035"
                     /db_xref="GeneID:9122546"
     CDS             34165..34452
                     /locus_tag="ECL_00035"
                     /codon_start=1
                     /transl_table=11
                     /product="acetolactate synthase 1 regulatory subunit"
                     /protein_id="YP_003610552.1"
                     /db_xref="GeneID:9122546"
                     /translation="MQKQHENVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQ
                     GSEHSRIWLLVNDDQRLEQMMAQIDKLEDVTRVARNQSDPTMFNKIAVFFE"
     misc_feature    34165..34449
                     /locus_tag="ECL_00035"
                     /note="acetolactate synthase 1 regulatory subunit;
                     Reviewed; Region: PRK08178"
                     /db_xref="CDD:236174"
     misc_feature    order(34204..34206,34210..34212,34225..34227,34264..34269,
                     34282..34284,34309..34311)
                     /locus_tag="ECL_00035"
                     /note="putative valine binding site [chemical binding];
                     other site"
                     /db_xref="CDD:153150"
     misc_feature    order(34216..34221,34228..34230,34249..34251,34258..34260,
                     34270..34284,34312..34314)
                     /locus_tag="ECL_00035"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153150"
     gene            34535..35128
                     /locus_tag="ECL_00036"
                     /db_xref="GeneID:9122547"
     CDS             34535..35128
                     /locus_tag="ECL_00036"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional activator UhpA"
                     /protein_id="YP_003610553.1"
                     /db_xref="GeneID:9122547"
                     /translation="MTTIALIDDHLIVRSGFAQLLNLEPDFQVVAEFGSGREALAGLP
                     GRGVQVCICDISMPDLSGLELLSQLPKGMAIIMLSVHDSPALVEQALNAGARGFLSKR
                     CSPDELIAAVRTVSTGGCYLTPDIALKLAAGRQDPLTRRERQVAEKLAQGMAVKEIAA
                     ELGLSPKTVHVHRANLMEKLGVSNDVELARRMFDSWQ"
     misc_feature    34535..35122
                     /locus_tag="ECL_00036"
                     /note="DNA-binding transcriptional activator UhpA;
                     Provisional; Region: PRK10360"
                     /db_xref="CDD:182408"
     gene            35125..36630
                     /locus_tag="ECL_00037"
                     /db_xref="GeneID:9122548"
     CDS             35125..36630
                     /locus_tag="ECL_00037"
                     /codon_start=1
                     /transl_table=11
                     /product="sensory histidine kinase UhpB"
                     /protein_id="YP_003610554.1"
                     /db_xref="GeneID:9122548"
                     /translation="MNPLISRLIAVVASFFIFSAAWFCLWSISLHLVERPELAVLLFP
                     FGLRLGLMLQCPRGYWPVLLGAEWLMLIWLSQEVALAHLPLLMTGSLLTLLPVALISR
                     YRHQRDWRTLLRQGAALIAAALLQSLPWVGEKEMLNALLLTLTGGLTLAPTCLVFWHY
                     LTSTVWQPLGPSLVSQPVNWRARHLIWYLLLFVVSLWLQLGLPAELSRFTPFCLALPI
                     IALAWHYGWQGALIATLMNAIALIASQTWHDHPVDLLLSLLAQSLTGLLLGAGIQRLR
                     ELNQSLQTELSRNRRLAERLLETEESVRQEVARELHDDIGQTITAIRTQAGIVQRLAA
                     DNAGVKQGGAHIEQLSLGVYDSVRRLLGRLRPRQLDDLSLEQAVRSLMREMELESRGI
                     VSHLDWRIDESLLSEGQRVTLFRVCQEGLNNIVKHANASAVTLQGWQQDESLRLVIED
                     DGCGLPPGSGQQGFGLAGMRERVKALGGTLNISCTHGTRVSVSLPLRSHHV"
     misc_feature    35134..36615
                     /locus_tag="ECL_00037"
                     /note="sensory histidine kinase UhpB; Provisional; Region:
                     PRK11644"
                     /db_xref="CDD:236945"
     gene            36623..37942
                     /locus_tag="ECL_00038"
                     /db_xref="GeneID:9122549"
     CDS             36623..37942
                     /locus_tag="ECL_00038"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein UhpC"
                     /protein_id="YP_003610555.1"
                     /db_xref="GeneID:9122549"
                     /translation="MFKTPANAAPIGNKAEIDARYRYWRRHILITIWLGYALFYFTRK
                     SFNAAAPEILASGVMTRTDIGLLATLFYITYGLSKFFSGIVSDRSNARYFMGFGLIAT
                     GVVNILFGFSTSLWAFALLWALNAFFQGWGAPVCARLLTAWYSRNERGGWWAIWNTAH
                     NVGGALIPMVVGAAALHYGWRAGMMIAGGLAILAGLFLCWRLRDRPQTVGLPAVGDWR
                     HDEMEVAQQLEGAGLTRKEILTKYVLLNPYIWLLSLCYVLVYVVRAAINDWGNLYMSE
                     TLGVDLVTANSAVTMFELGGFIGALVAGWGSDKLFNGNRGPMNLIFAAGILLSVGSLW
                     LMPFASYVMQAACFFTIGFFVFGPQMLIGMAAAECSHKEAAGAATGFVGLFAYLGASL
                     SGWPLARVIDIWHWSGFFAVIAIAAGISALLLLPFLHAQAPREASVM"
     misc_feature    36635..37933
                     /locus_tag="ECL_00038"
                     /note="regulatory protein UhpC; Provisional; Region:
                     PRK11663"
                     /db_xref="CDD:183266"
     gene            38083..39474
                     /locus_tag="ECL_00039"
                     /db_xref="GeneID:9122550"
     CDS             38083..39474
                     /locus_tag="ECL_00039"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar phosphate antiporter"
                     /protein_id="YP_003610556.1"
                     /db_xref="GeneID:9122550"
                     /translation="MLAFLNQVRKPTLDLPLDVRRKMWFKPFMQSYLVVFIGYLTMYL
                     IRKNFNIAQNDMISTYGLSMTQLGMIGLGFSITYGVGKTVVSYYADGKNTKQFLPFML
                     ILSAICMLGFSASMGAGSVSLFLMIAFYALSGFFQSTGGSCSYSTITKWTPRRKRGSY
                     LGMWNISHNLGGAGAAGVALFGANYLFDGHVIGMFIFPSIIALIVGFIGLRFGSDSPE
                     SYGLGKAEELFGEAISEEDKETEENEMTKWQIFVEYVLKNKVIWLLCFSNIFLYVVRI
                     GIDQWSTVYAFQELKLSKEVAIQGFTLFEVGALVGTLLWGWLSDLANGRRALVACVAL
                     ALIIATLGVYQHASNQYVYLASLFALGFLVFGPQLLIGVAAVGFVPKKAIGAADGIKG
                     TFAYLIGDSFAKLGLGMIADGTPIFGLTGWAGTFAALDAAAIGCIVLMAMVAVLEERK
                     IRRENRVQKLKAA"
     misc_feature    38086..39468
                     /locus_tag="ECL_00039"
                     /note="sugar phosphate antiporter; Reviewed; Region: uhpT;
                     PRK09556"
                     /db_xref="CDD:236564"
     gene            39636..40640
                     /locus_tag="ECL_00040"
                     /db_xref="GeneID:9122551"
     CDS             39636..40640
                     /locus_tag="ECL_00040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610557.1"
                     /db_xref="GeneID:9122551"
                     /translation="MLTRRLSCLALLMALATHAMATDAPTYGEKLEGFDYGWPVKHFT
                     FTSQEQSLDMAYLDVKPEKPNGRTVVLMHGKNFCAGTWDGTIRALSASGYRVIAPDQI
                     GFCKSTKPEHYQYTFQQLADNTHALLKTLGLDRVTVIGHSTGGMLATRYALMWPQQVE
                     QLVMVNPIGLEDWKARGVPHITVDQWYQRELKVSADGIRQYEKNTYYAGAWKPEYERW
                     VTMLAGLNNGPGKERVAWNSALLYDMIYTQPVIYEFSELKMPVLLMIGTKDNTAIGKD
                     LAPPEIRKTLGNYAVLGKETAKRIPHATLVEFNDMGHAPQMQDPARFHEALLKGLQAR
                     "
     misc_feature    39789..40637
                     /locus_tag="ECL_00040"
                     /note="Pimeloyl-ACP methyl ester carboxylesterase
                     [Coenzyme transport and metabolism, General function
                     prediction only]; Region: MhpC; COG0596"
                     /db_xref="CDD:223669"
     gene            complement(40628..41530)
                     /locus_tag="ECL_00041"
                     /db_xref="GeneID:9122552"
     CDS             complement(40628..41530)
                     /locus_tag="ECL_00041"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_003610558.1"
                     /db_xref="GeneID:9122552"
                     /translation="MKTDLRTLDLNLLKTLDALLDERSVTRAATRLALTQPAVSGMLN
                     RLRDYFDDPLFIRAPHGIVPTTRAEELAAPVKRILADIDLLLQPVAFDPRQATLTFTL
                     AATDYALRAIAVPFIAALKVRAPAIRVRVIPVDSERMMNQLERGNVDVALITPHTTPD
                     DLHSRALYDERYVCMMRADHPDAGKPLSLARFCALEHVLVSYEGDSFRGVTDGALEKM
                     GRTRHVGLSVSNFLVLPDVLAISDMIAVVPSRIAENQTGMFVCDTPVPVPGFTKCMAW
                     HTRTHRNPAQMWLRGLLLETSQRA"
     misc_feature    complement(41324..41500)
                     /locus_tag="ECL_00041"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:306606"
     misc_feature    complement(40643..41236)
                     /locus_tag="ECL_00041"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl25412"
                     /db_xref="CDD:330233"
     misc_feature    complement(order(40811..40816,40820..40825,40841..40858,
                     41132..41152,41156..41158,41168..41170,41177..41182,
                     41186..41191))
                     /locus_tag="ECL_00041"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            41630..42082
                     /locus_tag="ECL_00042"
                     /db_xref="GeneID:9122553"
     CDS             41630..42082
                     /locus_tag="ECL_00042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610559.1"
                     /db_xref="GeneID:9122553"
                     /translation="MVWIMLATLAVVFVVGFRVLTSDSRRAIKRLSERLGITPMPVES
                     MIDQFGKTPGNEFIRYLERPDEAHLQNVAQVLLIWQVCIVDGSEENLHTWHRMLRKAR
                     LAAPITDAQIRLALGFMREMEPDPQELNAFQLRYNQLFLPEEGVFYLH"
     misc_feature    41630..42058
                     /locus_tag="ECL_00042"
                     /note="Protein of unknown function (DUF1198); Region:
                     DUF1198; pfam06711"
                     /db_xref="CDD:310960"
     gene            42179..42706
                     /locus_tag="ECL_00043"
                     /db_xref="GeneID:9122554"
     CDS             42179..42706
                     /locus_tag="ECL_00043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610560.1"
                     /db_xref="GeneID:9122554"
                     /translation="MKQSAIIWPDDYLPGTTDNFASNEIIVAGLSAKAIWAQLNDTTL
                     WPNYYSNAEDIRFHDGSGPELSANARFRFTTFGFPVEAQVTEYVPPVDGEAARIAWHG
                     WVEGEESARLDVIHAWLFEDLPGNRVRILTQESQKGVPAQELARTLPNPMINGHQEWI
                     VGLAKAAMQEKLSKR"
     misc_feature    42242..42679
                     /locus_tag="ECL_00043"
                     /note="Ligand-binding SRPBCC domain of an uncharacterized
                     subfamily of proteins; Region: SRPBCC_4; cd07822"
                     /db_xref="CDD:176864"
     misc_feature    order(42245..42247,42251..42253,42281..42289,42293..42298,
                     42341..42343,42368..42370,42380..42382,42386..42388,
                     42392..42394,42422..42424,42428..42430,42470..42472,
                     42476..42478,42524..42529,42533..42535,42539..42541,
                     42566..42568,42572..42574,42578..42580,42584..42586,
                     42620..42634,42638..42646,42650..42658,42665..42667)
                     /locus_tag="ECL_00043"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176864"
     gene            42771..43961
                     /locus_tag="ECL_00044"
                     /db_xref="GeneID:9122555"
     CDS             42771..43961
                     /locus_tag="ECL_00044"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside transporter"
                     /protein_id="YP_003610561.1"
                     /db_xref="GeneID:9122555"
                     /translation="MTEHIQPTTRPQTKEVSRPNWSAVFSVAFCVACLITVEFLPVSL
                     LTPMAQDLGISEGVAGQSVTVTAFVAMFASLFITQVIGAIDRRKVVILFSVLLTLSCL
                     LVSFAESFTLLLLGRACLGLGLGGFWAMSASLTMRLVPARTVPKALSVIFGAVSIALV
                     IAAPLGSFLGGIIGWRNVFNAAAVMGFLCILWVWKALPSLPGEAAHHKQNMFSLLKRP
                     GVLAGMTAIFMAFAGQFAFFTYIRPVFMTMAGFDVDGLTLVLLSFGIASFVGTSLSSQ
                     FLKRSLKVALAGAPLVLAVSAVVLILWGSDKWVASAIAIIWGFAFALVPVGWSTWITR
                     SLADQAEKAGSIQVAVIQLANTCGAAVGGVALDHLGLTSPLVISGTLMLLTALLVAGK
                     VKAK"
     misc_feature    42771..43958
                     /locus_tag="ECL_00044"
                     /note="ribonucleoside transporter; Reviewed; Region: nepI;
                     PRK10213"
                     /db_xref="CDD:182309"
     gene            complement(44010..44915)
                     /locus_tag="ECL_00045"
                     /db_xref="GeneID:9122556"
     CDS             complement(44010..44915)
                     /locus_tag="ECL_00045"
                     /codon_start=1
                     /transl_table=11
                     /product="carboxylate/amino acid/amine transporter"
                     /protein_id="YP_003610562.1"
                     /db_xref="GeneID:9122556"
                     /translation="MGSTRKGMLNVLIAAVLWGSSGVCAQYIMEKSQISSPYLTMVRL
                     LFTGLILLTLSFVHGDKIFSVIKHRKDALSLLFFSLAGALTVQLTFLVTIEKSNAATA
                     TVLQFLSPTIIVAWFALARKKRPGLFVLSAILTSLVGTFLLVTHGDPTSLSISPAALF
                     FGIASAFAAAFYTTYPSTLIARYGTLPIVGWSMLIAGLTLTPFYAGRGTAFVIDGSLL
                     LAFFYLVVIGTALTFSLYLKGAQMIGGPKASILSCAEPLSSALLSVILLGVAFTLPDW
                     LGTLLIVSSVVLISMDSRKRVKAPE"
     misc_feature    complement(44055..44864)
                     /locus_tag="ECL_00045"
                     /note="Permease of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism, Amino
                     acid transport and metabolism, General function prediction
                     only]; Region: RhaT; cl28280"
                     /db_xref="CDD:333100"
     gene            complement(45060..46439)
                     /locus_tag="ECL_00046"
                     /db_xref="GeneID:9122557"
     CDS             complement(45060..46439)
                     /locus_tag="ECL_00046"
                     /codon_start=1
                     /transl_table=11
                     /product="putative maltoporin"
                     /protein_id="YP_003610563.1"
                     /db_xref="GeneID:9122557"
                     /translation="MTTLKKLPLTMAVIAALCPISVLAQEFTQEQIDAIVAKAVDKAL
                     AERQAKMDAAVAKKADVVTEPQSAAQSPDMAIPFGIKFTGYARYGAHFQAADQKYVAV
                     DGSYNGASAIGRLGNEGNGGEFQLSKAFKGDNGAIWDINVMIDHWGDEVNLKKAYAGV
                     TNIMASNPNAYFWAGRDFHQRPQQGINDYFWMNHDGQGAGVKNFDIGGVQFDVAAVAA
                     VESCSPEVMEDEANPSRITCTGGSGTGDKGNYAATSKIHGMKVGPLDLELYANYGFDS
                     KAVESDERLNAWQGGVVLSHTNDSGVNKVIARYSDNADNSVFNKTEDLTTVYASFEGL
                     YKFTQATQVEYILAFHDYDNSRDKTDNRKNYNAIVRPMHWWNDVHSTWLEAGWQHVDY
                     DNGGDNKGWKLTLSQNMSIAMGPEFRPMLRFYVTGGKVDNERTARVNNTKDETLDDFN
                     VGAMWEAWF"
     misc_feature    complement(45063..46196)
                     /locus_tag="ECL_00046"
                     /note="LamB porin; Region: LamB; pfam02264"
                     /db_xref="CDD:308079"
     gene            complement(46574..46876)
                     /locus_tag="ECL_00047"
                     /db_xref="GeneID:9122558"
     CDS             complement(46574..46876)
                     /locus_tag="ECL_00047"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system lactose/cellobiose-specific
                     transporter subunit IIA"
                     /protein_id="YP_003610564.1"
                     /db_xref="GeneID:9122558"
                     /translation="MIALEEAVMEIIVNAGQSRSLCFEALHAARQGNIDEAKSLLREA
                     DGYARQAHKMQTKLIEQDAGEARQPMTLIMVHAQDHLMNSLLARELSEEIIHLYQR"
     misc_feature    complement(order(46631..46633,46652..46657,46703..46705,
                     46865..46867))
                     /locus_tag="ECL_00047"
                     /note="methionine cluster; other site"
                     /db_xref="CDD:238133"
     misc_feature    complement(46586..46861)
                     /locus_tag="ECL_00047"
                     /note="PTS system, Lactose/Cellobiose specific IIA
                     subunit; Region: PTS_IIA; pfam02255"
                     /db_xref="CDD:308071"
     misc_feature    complement(order(46637..46645,46649..46651,46820..46822))
                     /locus_tag="ECL_00047"
                     /note="active site"
                     /db_xref="CDD:238133"
     misc_feature    complement(46649..46651)
                     /locus_tag="ECL_00047"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238133"
     misc_feature    complement(46640..46642)
                     /locus_tag="ECL_00047"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238133"
     gene            complement(46888..48261)
                     /locus_tag="ECL_00048"
                     /db_xref="GeneID:9122559"
     CDS             complement(46888..48261)
                     /locus_tag="ECL_00048"
                     /codon_start=1
                     /transl_table=11
                     /product="Beta-glucosidase"
                     /protein_id="YP_003610565.1"
                     /db_xref="GeneID:9122559"
                     /translation="MKYTFPDNFWWGSASSALQTEGTREGETTWDYWFAREPNRFHNG
                     VGPQHTSTFYQHWKTDIQLLKQLNHNSFRTSISWARLIPDGIGEVNPKAVEFYNQVID
                     ELIEQGITPFITLFHFDMPMAMQEIGGWENREVVDAYARYAQICFDLFGDRVLHWFTF
                     NEPIVPVEGGYLYDFHYPNVVDFRRAATVAYHTVLAHAKAVQAYRAGHYAGEIGIVLN
                     LTPSYPRSQNPADVKAAHIADLMFNRSFLDPVLRGEYPADLVALLKSYDQLPACKPED
                     SFLIAEGKIDLLGINYYQPRRVKCRDSAVNPQAPFMPEWFFDNYEMPGRKMNPYRGWE
                     IYEPGIYDILVNLRDNYGNPRCFISENGMGVENEQRFIENGQINDQYRIDFISGHLAW
                     LHKGISEGCHCLGYHMWTFIDNWSWCNAYKNRYGFIQLDLTTQQRTIKKSGEWFAATS
                     LHNSFEK"
     misc_feature    complement(46903..48258)
                     /locus_tag="ECL_00048"
                     /note="Beta-glucosidase/6-phospho-beta-glucosidase/beta-
                     galactosidase [Carbohydrate transport and metabolism];
                     Region: BglB; COG2723"
                     /db_xref="CDD:225343"
     gene            complement(48279..49604)
                     /locus_tag="ECL_00049"
                     /db_xref="GeneID:9122560"
     CDS             complement(48279..49604)
                     /locus_tag="ECL_00049"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system lactose/cellobiose family transporter
                     subunit IIC"
                     /protein_id="YP_003610566.1"
                     /db_xref="GeneID:9122560"
                     /translation="MSSLYQSMVAVIEQSITPLAAKLGQQKYVIAIRDGFTAALPFMI
                     IGSFMLVFIFPPFSADTTNSFARGWLDFSQTYREQLMLPFNLSMGVMTFFISVGIGAS
                     LGRQFNLDPVMSGLLAFMAFLLVAAPYADGKISTQYLSGQGIFTALITAIYATRVYAW
                     LKQNNVTIRLPKEVPTGVARSFEILIPVMVVIGTLHPLNLFIEAQTGMIIPQAIMHLL
                     EPLVSASDSLPAILLSVLLCQIFWFAGIHGSLIVTGIMNPFWMANLSANQAALAAGAA
                     LPHVYLQGFWDHYLLIGGVGSTLPLAFLLLRSRVTHLRTIGKMGVVPSFFNINEPILF
                     GAPIIMNPMLFIPFVCVPLVNACLAYAATKLGWLAQVVSLTPWTTPAPIGASWAANWA
                     LSPVVMCLICMVMSALMYLPFLRAYERTLMKNEEQKAQATVGTAETASN"
     misc_feature    complement(48312..49583)
                     /locus_tag="ECL_00049"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIC [Carbohydrate transport and metabolism];
                     Region: CelB; COG1455"
                     /db_xref="CDD:224372"
     gene            complement(49616..49930)
                     /locus_tag="ECL_00050"
                     /db_xref="GeneID:9122561"
     CDS             complement(49616..49930)
                     /locus_tag="ECL_00050"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system,
                     lactose/cellobiose-specific IIB subunit"
                     /protein_id="YP_003610567.1"
                     /db_xref="GeneID:9122561"
                     /translation="MFKIMLCCSAGMSTSLLVSKMVDVAKERGLAVKIDAYGVSEFDT
                     QFPQYQVVLLGPQVKYMLQTLSDKAATKGIPVQPIDMMDYGMQRGDKVLDYALSLIEA
                     AH"
     misc_feature    complement(49637..49924)
                     /locus_tag="ECL_00050"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     misc_feature    complement(order(49679..49681,49760..49762,49889..49894,
                     49898..49903,49907..49909))
                     /locus_tag="ECL_00050"
                     /note="active site"
                     /db_xref="CDD:99906"
     misc_feature    complement(49889..49909)
                     /locus_tag="ECL_00050"
                     /note="P-loop; other site"
                     /db_xref="CDD:99906"
     misc_feature    complement(49907..49909)
                     /locus_tag="ECL_00050"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99906"
     gene            50224..51174
                     /locus_tag="ECL_00051"
                     /db_xref="GeneID:9122562"
     CDS             50224..51174
                     /locus_tag="ECL_00051"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_003610568.1"
                     /db_xref="GeneID:9122562"
                     /translation="MSTINDVSRLAGVSKATVSRVLSGSRGVKEASRQAVLKAVDELN
                     YRPNVIAQSLLSQSTGCIGVICAQENINQTTGYLYALEKQLSQHQKHLLLRFAHSKAD
                     VLHALEELSCGLCDDILVIGARFPLDIDMDNVILVDCMGSENPNSIQFDHAFAAETAC
                     NYLTSQGRRQIALIHPHGSGFADQVLLGYKHALEKNFLPFNRNLVFMDATSSSVALQE
                     LLNNASTLNFNALLVADEQEAQRVIPQLQAFNKSVPEDIMVFSLAGSLHLPGIPVIPA
                     IEYSMDAMAARIVSWLTEKTQMLGSYVLRGDLIIPDVRKR"
     misc_feature    50230..51159
                     /locus_tag="ECL_00051"
                     /note="DNA-binding transcriptional regulator, LacI/PurR
                     family [Transcription]; Region: PurR; COG1609"
                     /db_xref="CDD:224525"
     gene            complement(51236..51532)
                     /locus_tag="ECL_00052"
                     /db_xref="GeneID:9122563"
     CDS             complement(51236..51532)
                     /locus_tag="ECL_00052"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610569.1"
                     /db_xref="GeneID:9122563"
                     /translation="MKSAHLVCLLVCLLFAAFAHAQEKDDPAREAQIKQQVLKDVKKA
                     CTPQKKQSDKAWQAMILSSEANQLLIKNAITAVKRDNLEAYWDAVSQVDCMEDY"
     gene            complement(51652..53016)
                     /gene="eefC"
                     /locus_tag="ECL_00053"
                     /db_xref="GeneID:9122564"
     CDS             complement(51652..53016)
                     /gene="eefC"
                     /locus_tag="ECL_00053"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux transport outer membrane
                     protein EefC"
                     /protein_id="YP_003610570.1"
                     /db_xref="GeneID:9122564"
                     /translation="MFRLSVFVLALMSAGCVSLDPTYQRPAAPVPATLPGAHGEATAM
                     VSQWQQVMNDARLKGVVTMALNSNRDLQKAIADIDAARAQYGETRSSLFPTVDAELSH
                     TRSRTLASGVATSDEANGTVSSFELDLFGRNQSLSRAARETWLASEFTAQNTRLTMVS
                     ELTTAWVTLAADNSNLALAKSTMESAASSLRIVKRQQQVGVAAATDVSEAMAVYQQAR
                     ASVASYQTQVMQDKNALNLLAGDTVPDTLLPGTLESLSDNAITLIPAGVSSSALLRRP
                     DIKEAEHNLLSANANIGAARANFFPTISLTASAGVGSDSLSSLFSHGMKVWSFAPSIT
                     LPLFSGGNNLAQLRYAEAEKKGLIATYEKTIQSAFKDVADALARRETLSEQLDAQREY
                     VAAEQKTLDVATRSYQAGAGDYLTVLTAQRSLWSAQESLISLQQTDLENRITLWQSLG
                     GGIE"
     misc_feature    complement(51655..52989)
                     /gene="eefC"
                     /locus_tag="ECL_00053"
                     /note="Outer membrane protein TolC [Cell
                     wall/membrane/envelope biogenesis]; Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     gene            complement(53016..56126)
                     /gene="eefB"
                     /locus_tag="ECL_00054"
                     /db_xref="GeneID:9122565"
     CDS             complement(53016..56126)
                     /gene="eefB"
                     /locus_tag="ECL_00054"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux transport protein EefB"
                     /protein_id="YP_003610571.1"
                     /db_xref="GeneID:9122565"
                     /translation="MFSRFFVRRPVFAWVIAILIMLAGILAIRTLPVAQYPDVAPPSI
                     KISATYTGASAQTLENSVTQVIEQQLTGLDNLLYFTSTSSSDGSVSITVTFEQGTDPD
                     TAQVQVQNKVQQAESRLPTEVQQSGITVEKSQSNFLLIMGVYDKTDTASSSDIADWLV
                     SNMQDPLARVDGVGSLQVFGAEYAMRIWLDPAKLASYSLMPSDVQSAIEAQNVQVSAG
                     KIGALPSSNAQQLTATVRAQSRLQTVDQFKNIIVKSQSNGAVVHISDVARVEMGSEDY
                     TSTAKLNGHPAAGMAVMLSPGANALNTATAVKEKIAEFKKSMPEGYDVAYPKDSTEFI
                     KISVEDVIQTLFEAIILVVVVMYLFLQNIRATLIPALAVPVVLLGTFGVLALFGYSIN
                     TLTLFAMVLAIGLLVDDAIVVVENVERIMRDEGLPAREATEKSMGEISGALVAIALVL
                     SAVFLPMAFFGGSTGVIYRQFSVTIISAMLLSVVVALTLTPALCGSILSHTAPHKKGF
                     FGAFNRFYSKTEHGYQNKVLRALRRSGGMLVIYVLLCGAMGFAMLKLPGSFLPTEDQG
                     EIMVQYTLPAGATSTRTAEVSRQVREWFLTKEKANTNVIFTIEGFSFSGSGQNAGMAF
                     VSLKNWSERKGDENTAQAIALRATQELSTIRDATIFAMTPPAVDGLGQSNGFTFELMA
                     SGGTDRDTLLKLRNQLIGEANQDASLHAVRANDLPQMPQLQVDIDNNKAVSLGLSLSD
                     VTDTLSSAWGGTYVNDFIDRGRVKKVYIQGDSDYRAVPSDLNKWYVRGSDSTMTPFSA
                     FATTRWEYGPESLVRYNGSAAYEIQGENASGASSGTAMSKMEQLANNLPSGSTWAWSG
                     LSLQEKLASGQAMSLYALSILVVFLCLAALYESWSVPISVILVIPLGVLGAAIAASLR
                     GLNNDVYFQVALLTTIGLSSKNAILIVEFAEAKVAEGYSLTRAALRAAQTRLRPIIMT
                     SLAFIAGVTPLAIATGAGANSRVAIGTGIIGGTLAATLLAIFFVPLFFVLVKRLFSGK
                     HSNRRS"
     misc_feature    complement(53028..56123)
                     /gene="eefB"
                     /locus_tag="ECL_00054"
                     /note="AcrB/AcrD/AcrF family; Region: ACR_tran; cl26366"
                     /db_xref="CDD:331187"
     gene            complement(56126..57250)
                     /gene="eefA"
                     /locus_tag="ECL_00055"
                     /db_xref="GeneID:9122566"
     CDS             complement(56126..57250)
                     /gene="eefA"
                     /locus_tag="ECL_00055"
                     /codon_start=1
                     /transl_table=11
                     /product="multidrug efflux periplasmic linker protein
                     EefA"
                     /protein_id="YP_003610572.1"
                     /db_xref="GeneID:9122566"
                     /translation="MMKKITTSIAALLLLTGCDNAQTSAPQRPLPEVGIVTLMSQPVS
                     VVSELTGRTTAAMSAEVRPQVGGIIQKRLFTEGDTVKAGQALYQIDPSSYRAAFDEAA
                     AALKQAQALVQADCQKARRYAQLVKDDGVSRQDAEDAKSTCAQDKASVESKKAAQESA
                     RINLNWTTVTAPIAGRIGISSVTPGALVTAQQDTALATIRGLDTMYVDLTRSSADLLR
                     LRKQTLASNSDTLSVTLQLEDGSTYSEKGRLALTEVAVDESTGSVTLRAVFPNPQHQL
                     LPGMFVRARVDEGIMNDAILAPQQGITRDAKGKATALVVNASNKVEQRQLETGDTYGD
                     KWLVLSGLKAGDRLIVEGTDKVTAGQQVKAEEMKSSGGNA"
     misc_feature    complement(56144..57214)
                     /gene="eefA"
                     /locus_tag="ECL_00055"
                     /note="HlyD membrane-fusion protein of T1SS; Region: HlyD;
                     cl25633"
                     /db_xref="CDD:330454"
     gene            complement(57396..57965)
                     /locus_tag="ECL_00056"
                     /db_xref="GeneID:9122567"
     CDS             complement(57396..57965)
                     /locus_tag="ECL_00056"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="YP_003610573.1"
                     /db_xref="GeneID:9122567"
                     /translation="MSTKLEERQKQRQDEIITAARRCFRASGFHAASMSQIASEAKLS
                     VGQIYRYFSNKDAIIEEMIRRIIDSRIEGMQDKTVVEGMPQALAWRQTINEDDDALML
                     EMSAEATRNPQVAAMLTAAEARMFSNACAHLKKQFPHLSDEHIRCCVEITAVMIEGTI
                     YRRLTPLNVPSEQLEPIYQNILNMLFTAK"
     misc_feature    complement(<57549..57932)
                     /locus_tag="ECL_00056"
                     /note="transcriptional regulator BetI; Validated; Region:
                     PRK00767; cl27691"
                     /db_xref="CDD:332512"
     misc_feature    complement(57795..57920)
                     /locus_tag="ECL_00056"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:306858"
     gene            58152..58571
                     /locus_tag="ECL_00057"
                     /db_xref="GeneID:9122568"
     CDS             58152..58571
                     /locus_tag="ECL_00057"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetyltransferase GCN5"
                     /protein_id="YP_003610574.1"
                     /db_xref="GeneID:9122568"
                     /translation="MHLSITEKVTPAEKEELFVGLRAYNAQFLDMTNFSGDIGVYMRD
                     EKGVMLGGLIGVRKGEWLNIDYLWVSDTVRGTGVGSQLIKTAEEEARRKGCTHALVDT
                     ASFQARPFYEKQGYQLQMSLQDYPYPGMQRHYLTKAL"
     misc_feature    <58266..58499
                     /locus_tag="ECL_00057"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:306954"
     misc_feature    order(58350..58358,58386..58391)
                     /locus_tag="ECL_00057"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            58777..59577
                     /locus_tag="ECL_00058"
                     /db_xref="GeneID:9122569"
     CDS             58777..59577
                     /locus_tag="ECL_00058"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610575.1"
                     /db_xref="GeneID:9122569"
                     /translation="MKLRLGALVLAGLLLAGCDQSGSDAKHIKVGVINGAEQDVAEVA
                     KKVAKEKHGLDVELVGFSGSLLPNDATNQGELDANVFQHRPFLAEDNKAHNYKLVAVA
                     NTFVFPMAGYSRKIKSVSDLKDGATIAIPNDPTNLGRALLLLQKEKLITLKPDVGLLP
                     TALDITANPKKLNIMELEGAQLPRVLDDPKVDVAIISTTYIQQTGLSPVHDSVFIEDK
                     NSPYVNIVVTREDNKDAENVKEFIQSYQSPEVAKAAETIFNGGAVPGW"
     misc_feature    58828..59574
                     /locus_tag="ECL_00058"
                     /note="cytoplasmic membrane lipoprotein-28; Provisional;
                     Region: PRK09861"
                     /db_xref="CDD:182119"
     gene            complement(59590..60270)
                     /locus_tag="ECL_00059"
                     /db_xref="GeneID:9122570"
     CDS             complement(59590..60270)
                     /locus_tag="ECL_00059"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610576.1"
                     /db_xref="GeneID:9122570"
                     /translation="MYTVLPSPLLHAITGLRFQPLVDLHSGQAVAHEVLVEIHNVNLD
                     ALFASLPTRSALQIFFWQANTLLQMPDKGQYWLNLPADQLLDAKAIDLLLALRHQQRL
                     TIEIQDPLTVTRMSAAEQRGIHHALLQLKGAGWKIWLDDLTQELADDYARLALPVDGI
                     KLDRSELSSPARFDTLVHFVREKIARAVVVEGIETAQDLQRACASGARFGQGFLWPES
                     RIDASVTV"
     misc_feature    complement(59626..60225)
                     /locus_tag="ECL_00059"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2). The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cl27669"
                     /db_xref="CDD:332490"
     gene            complement(60340..60951)
                     /locus_tag="ECL_00060"
                     /db_xref="GeneID:9122571"
     CDS             complement(60340..60951)
                     /locus_tag="ECL_00060"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610577.1"
                     /db_xref="GeneID:9122571"
                     /translation="MKETIHVAVIDSCEFTMIGLQYLGNREPDAHRDVIFHGFSNIED
                     FLLSERTWDIVIYDPLNIGSFMITPNEDILRIKEKQPAARIYIYSLSVGFLKFKHVDG
                     VINKRVSLGDIKAMWQILMSQTPKALNHYNVSITTRQRPARLSNEEASVLRGYSCNLK
                     TKQIARQLGCNVRLVYFYKNNAMNKLKAVRGPSFYQSIRWILN"
     misc_feature    complement(60388..60939)
                     /locus_tag="ECL_00060"
                     /note="DNA-binding response regulator, NarL/FixJ family,
                     contains REC and HTH domains [Signal transduction
                     mechanisms, Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     gene            61069..61239
                     /locus_tag="ECL_00061"
                     /db_xref="GeneID:9122572"
     CDS             61069..61239
                     /locus_tag="ECL_00061"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610578.1"
                     /db_xref="GeneID:9122572"
                     /translation="MRKANPFYYRKIKFKKYFKVRSNIFNLLIILEIDFYPEKWRLLR
                     FDMDNTLFLWGF"
     gene            61399..62064
                     /locus_tag="ECL_00062"
                     /db_xref="GeneID:9122573"
     CDS             61399..62064
                     /locus_tag="ECL_00062"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610579.1"
                     /db_xref="GeneID:9122573"
                     /translation="MIFSEFTFRIIVFYRVNILQEMISDALRKLLPEYSLQISIVEST
                     EQLFDAISDGQVDIVMAEFSYLFNHKSWSVQTSNRLNMLCHTHHVKRVLFVPELQYGL
                     LKRVLEMKYELTLSLQDEPGELKRELQALLRAEEARPRVSSYLKGMMRAGARSRSVLS
                     AREWEVLHLLVEGYTVTEIAQLRSRSASTIATQKHNAMKKLNLTNHSELIKYLQMAGR
                     IGS"
     misc_feature    61456..62055
                     /locus_tag="ECL_00062"
                     /note="DNA-binding response regulator, NarL/FixJ family,
                     contains REC and HTH domains [Signal transduction
                     mechanisms, Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     gene            complement(62106..63170)
                     /locus_tag="ECL_00063"
                     /db_xref="GeneID:9122574"
     CDS             complement(62106..63170)
                     /locus_tag="ECL_00063"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610580.1"
                     /db_xref="GeneID:9122574"
                     /translation="MIRLLTFLFLACVSGASYATCSGGSISYGPPISVDLSDKLTPAT
                     PTWTGSFSTQYSGSFNCSTGNSEFSYTPILSTDSKYATILGFSNDKYRVRAEITSTHP
                     NKTLSASGNHTASELNTPFTVRFTLVDQSGTTLSGDTATMSDVLFVSDMSGMSFWEII
                     TWPINQLVKIVQWLFNGFKWPYDNRDMFGQPMTIKYAPKLTTCSFDNAGLTVHLPTLG
                     IPQLSASAQPGLTPFTLNMSCQNLGTNGTSDRAIEMFLSSTQLLSTDSSVLVDTSSGA
                     AQGVGLRLIQRNNPQQPVIFSTSTTSRGNATLLFNVAAGGALSKTFTLPMAASYYVWA
                     PAKVSQGKLNTTATLNIIYP"
     misc_feature    complement(62112..63167)
                     /locus_tag="ECL_00063"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:321493"
     gene            complement(63183..65678)
                     /locus_tag="ECL_00064"
                     /db_xref="GeneID:9122575"
     CDS             complement(63183..65678)
                     /locus_tag="ECL_00064"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane usher protein FimD"
                     /protein_id="YP_003610581.1"
                     /db_xref="GeneID:9122575"
                     /translation="MKMKQNRLCMLAVCSLLLSHKSGAVTFDTSLLAGASGESDLSRF
                     NENNAMPAGPQEMDIYVNGDWKGRYTVTYGEQQDDVRLAWKDALMLGINTKAIPAPAI
                     TDGQVQLHDLVQGGEVKTDTSTLSLALTVPQAAVLRTEEGYVAPQFWDEGIPALMLSW
                     NTTWYNTRTKGSAKETNDDFYAGLDSGANLLGWQFRDSSTWRKSASGDSSWQNNTRYL
                     RRPLAALKSNLTLGDFYIPGDLFDSLRVRGVSLASDMKMRPNSQQGFSPVVHGVARTN
                     ALVKVMQNGNVIYQENVPPGQFTLDSIQPTGSAGDLLVVVREADGSQQSFTVPFSAVP
                     GMLKEGVSEYSVVAGKVHQNTLEADPAFLQATLRYGFNNLMTGYTGTIVSDNYQAGLI
                     GTGWNLPFGAVSVDVTHAKTTLQDRTDSGQSFRVSYSKFIDTTATNFTLAAYRYSTKG
                     YYSFSDALYSREGYQRLKAQYDEYEDRFGVAPEMTMSTWDALRAAQPKNTFTLNLNQR
                     LPDNWGTVFVSGTQRDYWNSRQTSREYQAGYSNAIGRASYTVSASRVRNSEREEETRF
                     YLSLSLPFSLFDNNAWVTSSLTASDSHYEQSNISMSGNALASNRLSYTLSGSNARGGN
                     NTASVNTAYRANFATLGGSYSESSDYRQMGLNGRGSLVAVPWHLLASNETGSTMTIVD
                     APQAEGLMVNGDESIVTNRDGVALVPYATPYRKNAITLSETANSRGAEVLGNIANVAP
                     YDGAVNYIRFDTDQRQSWMLRATRPDGAPLPFGTEVLNERGESVGYVGQASVLYIRAE
                     QPPRELSVHLRGGNCTIAAPAWGLESPSSVCHY"
     misc_feature    complement(63261..65678)
                     /locus_tag="ECL_00064"
                     /note="Outer membrane usher protein FimD/PapC [Cell
                     motility, Extracellular structures]; Region: FimD;
                     COG3188"
                     /db_xref="CDD:225729"
     gene            complement(65694..66386)
                     /locus_tag="ECL_00065"
                     /db_xref="GeneID:9122576"
     CDS             complement(65694..66386)
                     /locus_tag="ECL_00065"
                     /codon_start=1
                     /transl_table=11
                     /product="putative pili assembly chaperone"
                     /protein_id="YP_003610582.1"
                     /db_xref="GeneID:9122576"
                     /translation="MRKIIMLASLLLSAGNAWANIVINGTRVLYPENNKEVIVQLINT
                     GDAPALVQSWIDDGDINSTPETANVPFLLSPPVVKVSEHNGQQLRIKKLPANLPGDRE
                     SVFFLNVLDIPPKPENIQNQNTVQLAIKSRIKMFYRPASLTGTLDNATGKLTLIASGK
                     QFRIVNDSPFHITVANISEGKTKLLQESPMVAPFGQLTVATKNAVKRGQTYQLMYVDD
                     LGAYKTRTLTSQ"
     misc_feature    complement(65700..66386)
                     /locus_tag="ECL_00065"
                     /note="P pilus assembly protein, chaperone PapD
                     [Extracellular structures]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     gene            complement(66439..67023)
                     /locus_tag="ECL_00066"
                     /db_xref="GeneID:9122577"
     CDS             complement(66439..67023)
                     /locus_tag="ECL_00066"
                     /codon_start=1
                     /transl_table=11
                     /product="putative fimbrial protein"
                     /protein_id="YP_003610583.1"
                     /db_xref="GeneID:9122577"
                     /translation="MFKTIMTVSVLGAAIASTHAIAADNSAGGVINFTGAITDTTCTI
                     NGGKSADMTVALSPISVKDAGTTVGLITKNKKSISLTFSGCTPAAGTTGTPLKVYFSS
                     ADNISTDGKYLLNNSVNENDASVARNVGFALVEPGKSTPVTLNQAYTTSIMGTSAAPD
                     SETLTLDVYYYKTNAAAATVGALSSNVTYTISYL"
     misc_feature    complement(66445..67023)
                     /locus_tag="ECL_00066"
                     /note="Pilin (type 1 fimbria component protein) [Cell
                     motility]; Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            67364..68332
                     /locus_tag="ECL_00067"
                     /db_xref="GeneID:9122578"
     CDS             67364..68332
                     /locus_tag="ECL_00067"
                     /codon_start=1
                     /transl_table=11
                     /product="IS903 transposase"
                     /protein_id="YP_003610584.1"
                     /db_xref="GeneID:9122578"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
     misc_feature    67463..67798
                     /locus_tag="ECL_00067"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:290455"
     misc_feature    67757..68287
                     /locus_tag="ECL_00067"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:307645"
     gene            68464..69264
                     /locus_tag="ECL_00068"
                     /db_xref="GeneID:9122579"
     CDS             68464..69264
                     /locus_tag="ECL_00068"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulatory protein"
                     /protein_id="YP_003610585.1"
                     /db_xref="GeneID:9122579"
                     /translation="MKYLIDLAMLYEVDSGVIMINGEEESSIKLSNQAARLLYELIIN
                     NGKTLDRDDLIKKVWEDRGFSGSSVSLNVAISEIRKAFRSLGRDPLLIKTIRGKGFSL
                     AAHIEHHTVRPPVAAPEKMVAETVDIVTQQRDPPEGLRRRDSGFTTLFVMALVAIMGI
                     AALLFYQNMRVADRPKESDIYRLGKIDRCTVYLIDKNMYQPQQVYLNRAKDAIARQHI
                     DCEHQAADAYYSKFKKSQLENDFLAVCYLQDGADSYKNCISYRSLTGS"
     misc_feature    68491..68868
                     /locus_tag="ECL_00068"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     misc_feature    order(68554..68556,68611..68616,68668..68670,68680..68682,
                     68704..68709,68743..68745,68758..68760)
                     /locus_tag="ECL_00068"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:294013"
     gene            69269..69754
                     /locus_tag="ECL_00069"
                     /db_xref="GeneID:9122580"
     CDS             69269..69754
                     /locus_tag="ECL_00069"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610586.1"
                     /db_xref="GeneID:9122580"
                     /translation="MSKRQMGILLGVVLLLSVIVIAVLYPKRTQEVGFGCQSDTVSRK
                     NYSTGESTALSLTTLFLFNGSDIVTVIHKGVFTRGDKRYLIDRNYVLNVEKVAGSDIY
                     YIKGKKLQKSDDDIAPDGIVNELLMDSIDFFYVTRVKGHAWLIKGLVLPIMMCVAVPT
                     S"
     misc_feature    69488..69733
                     /locus_tag="ECL_00069"
                     /note="FidL-like putative membrane protein; Region:
                     FidL_like; pfam15941"
                     /db_xref="CDD:318209"
     gene            69984..70607
                     /locus_tag="ECL_00070"
                     /db_xref="GeneID:9122581"
     CDS             69984..70607
                     /locus_tag="ECL_00070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610587.1"
                     /db_xref="GeneID:9122581"
                     /translation="MNKLNAIVLGSLLSLSALSVAHAAETTASATWQASATKDSDSDL
                     VVTPTRALNFVYSANTKAFNTDTGLFDVAIRGDHSSATSFKLEAIVDDSDNTLFSVGG
                     EATKLKVGARFGGTDLGSIGGTVGTKSTAWTTLVDSSNNTGVSSGLWNLTTSAGATAN
                     TEVTGQDKFVFYVDSAQDSTGAAKEFKDLTNSLWEGTVSVAFRATWG"
     misc_feature    70065..70601
                     /locus_tag="ECL_00070"
                     /note="Fimbrillin MatB; Region: MatB; pfam16449"
                     /db_xref="CDD:318616"
     gene            70653..71330
                     /locus_tag="ECL_00071"
                     /db_xref="GeneID:9122582"
     CDS             70653..71330
                     /locus_tag="ECL_00071"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610588.1"
                     /db_xref="GeneID:9122582"
                     /translation="MFSLKPIFFSLLFISSSALAINVGKVTTIIPADADSTAKELKNE
                     ADSVRIISISAQRISSPMDEGVVINPEQTDELLLTPTRMVMPAGTSNIVKFYYHGKAD
                     DRERYYRITFIDEGVSEDLDNGTKKNGKGMTRAVVSTILVVQPRKKNVDFVYVAGKIT
                     NKGNTAFRVNASGTCLKPNPESPTTPCVKNFYLMPGTSRAIDDINVTDSHFHLGIWDL
                     KQFIPVK"
     misc_feature    70683..>71177
                     /locus_tag="ECL_00071"
                     /note="Pili and flagellar-assembly chaperone, PapD
                     N-terminal domain; Region: PapD_N; cl21716"
                     /db_xref="CDD:328868"
     gene            71337..73931
                     /locus_tag="ECL_00072"
                     /db_xref="GeneID:9122583"
     CDS             71337..73931
                     /locus_tag="ECL_00072"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610589.1"
                     /db_xref="GeneID:9122583"
                     /translation="MVKNKLVLPVMMACTSGLLPAYAHAASSSVVIANYRFPDSLYAL
                     LEQGIKIPVYLVNTRPGAAQQAGSTGDVSEYVRIGDVTIYAEDRQLGLRDVQVQESDN
                     GIRLSKEMRTLLQSINGKQFDDHMRIPVSAGSAFELDQKKMRLLLNLSQRDYGVNIRP
                     REVDIDAPESDDLSGTLSYNLGAYHTESGYGDSWSSGYLNAKSWVSMGVDHLLVDGSG
                     YVNENSSDTQMNAVMWERDYQGMRYAAGMLNGWAMQSLASVSGISGGEVYGVSVGNQA
                     NSRKRDNTLSLTPIVVYFPTAGEARIRRDGQLIGIQRFDVGNHEIDTSALPYGIYSVE
                     VEVVSGSRTVSRSMYTVNKPFTNNVSESLRWQTWGGIYSRDKSVVNYKKYAKRKNEQD
                     NSYYYDYDTKHKDTMSLVGASFSKRSGMVDWNASGYMMREHVVSELWASLNLTGYFSV
                     NTQTMAASDGTYRANYGANVSLPWNIGSVWYSHEQLSSGKFLDIYENKGNTWGASFSL
                     PSFGLPSAGNLSLMRQEDDVYRYKRYQVDYSQGLYAGRYGTARLRVGMSRNKYEGYYE
                     EKDRYVMLDFSIPLGNTVSVGVSHNRDTGTALNVSASRQFEGDYLKSVTANVSRAFSS
                     NQDRTVSGGGSVSFDTPWNSNILSVQSGTSKGWNSTLTSDGSVGWSKEAVAAGKGTHS
                     AGVIVSTGLKSDESLTLKLNGRTERIKGDKTWLSLPAYQAYDLEVMNSETGTESYDIG
                     ANARRHITVYPGNTVVMKPQVKKIVTLFGRLVDANGNPVSATQIKNHVGLTRTENDGR
                     FVIDVDKNNPVLSIATPDDSVCEVRLDIASNRGALWLGDISCDKGDFVWQEAKGTRER
                     DDEKDIRS"
     misc_feature    72192..72374
                     /locus_tag="ECL_00072"
                     /note="Fimbrial, FimD or usher-like; Region: TcfC;
                     pfam16967"
                     /db_xref="CDD:319039"
     misc_feature    <72963..73856
                     /locus_tag="ECL_00072"
                     /note="Outer membrane usher protein; Region: Usher;
                     cl27666"
                     /db_xref="CDD:332487"
     misc_feature    73581..73850
                     /locus_tag="ECL_00072"
                     /note="Peptidase associated domain: C-terminal domain of
                     M14 N/E carboxypeptidase; putative folding, regulation, or
                     interaction domain; Region: Peptidase_M14NE-CP-C_like;
                     cl21470"
                     /db_xref="CDD:328735"
     gene            73903..75507
                     /locus_tag="ECL_00073"
                     /db_xref="GeneID:9122584"
     CDS             73903..75507
                     /locus_tag="ECL_00073"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610590.1"
                     /db_xref="GeneID:9122584"
                     /translation="MTMKKIFALNLLLISAAAQAQQMPYFAINNPDNNGTGNTAALFS
                     LNSTSTAFLHGSREWPTLSAKTNNGIATYIPDNSFNGPAGSPLTINFSVTGSSASPFF
                     KGTACSSSCGTTGYTATTSYTDTSMVVKPPVIEPGTAYGRWVLGDPFFDYLLNAAPGN
                     EVTITSTPQISSIGKVITTNTLHKVGTLTMTNSRALDLGIDPISGEVTIVDGSTGATC
                     TKYTRNTVSGVLCELLEYTFVGEDITGYNPGLALTSSRVNGVLQSHMNGGTGLAAEIT
                     FDESNWYSISGGILSDTRVLANTFLAAPQKNGGKAYLKIFLPKALILSVAQAGDGNNI
                     GNIVSLCLTPGNSSLAADFCFQPGGGLVIDPIQPGLAIVPDNPDYTLDPNGLGGSGKG
                     TIGEGPIEIPYTITYSGAQKDAAIAVTVKVTGPTQSLNGVDYCAFSGNGFTVPVPGNV
                     LLGKSQTLKAHNCKGEALSIPAPATHAEEWDKISSGVTDMWLWKTPLVLQFVMNNPVS
                     KTTYDGNTWFGEVTAQGRIDVSASWN"
     gene            75514..76167
                     /locus_tag="ECL_00074"
                     /db_xref="GeneID:9122585"
     CDS             75514..76167
                     /locus_tag="ECL_00074"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610591.1"
                     /db_xref="GeneID:9122585"
                     /translation="MTGKFLAIFAINCFISASANALIIENLNIDFLPEKEVVFQPIKN
                     DTSVRQNYTVSLIQVDVPKEHGKETEIKDGEVMFSPKQLTLESGERAGFKFYYTGPHD
                     SKERYYRVKFTETPLQARVVMSKGQRIQSDVVVSLEAILIVRPWTRHFDYTFSNGVVS
                     NTGNTWFKYVSSQGCSSQYNDSKYLPPGQRLEIDNYAQPARRMIIYGNKIIPLTRCP"
     gene            76240..76434
                     /locus_tag="ECL_00075"
                     /db_xref="GeneID:9122586"
     CDS             76240..76434
                     /locus_tag="ECL_00075"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610592.1"
                     /db_xref="GeneID:9122586"
                     /translation="MKAISFVEAKDIIGGALNPFAGLVKGAQLGYDTGASIMGMVGGV
                     VGGILGGAMGFLGALVGSYN"
     gene            76457..76642
                     /locus_tag="ECL_00076"
                     /db_xref="GeneID:9122587"
     CDS             76457..76642
                     /locus_tag="ECL_00076"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610593.1"
                     /db_xref="GeneID:9122587"
                     /translation="MQVIDFKKAQAIIGGWDPFAAALQGASAGYNAGSQMLGALGGTI
                     GGVFGLVGGFIGGFFSA"
     gene            76707..78803
                     /locus_tag="ECL_00077"
                     /db_xref="GeneID:9122588"
     CDS             76707..78803
                     /locus_tag="ECL_00077"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610594.1"
                     /db_xref="GeneID:9122588"
                     /translation="MFSLFQYKKKGKTPVIRQHEYTECGLACLAMVLGHYEHHVSVSQ
                     LRRELTVSADAGTSMAELMTLASDKNMTGRVLKGEITEIESAELPLIAFWRGNHFVVI
                     VKVDGRSVTVHDPASGVRRYSLKEAQKLFSGYVLELKPTPRFDKKSPDETLTLGRLAN
                     KSPSLFQRQVLLFVLSIFTLITMLASPTYVQLIMEEAISRNDNDLVILLTAIFAIVFI
                     FEVIGKFLKQLLEILMRNIAYDDLSQSVRRYMLRTQTGWFRSRPPGIVLAIEKSLHAC
                     AEFISNGYVQILFSSLIAFTSLLFMLLYNVKIAVLTMLLMGVFFLIRFSLIGPYQRAV
                     DDSIERTAKYESLLVETQKGIITLKANNMEQARDAVMDKSQREHIAGLMRKERLLARF
                     DVASLLVINAEQLLVVCFGAWLILEGQMSIGMLYAYISYKRYFSDAMVQVAQKLLDKN
                     ALKGPLDRVGDLLFAPSEASQFGRKIVTSPVSLAFEDVSFAYPGREATLQHINMTLKQ
                     GEEAVIVGQSGSGKTTLLRLISGMLLSTSGSLRINAIPITECDLSSLRQHIRIVHADD
                     ILFTGSILDNLSCFDSAPDKERVIAACRLAEIDHVVARLPHGYETELLPGNTFFSAGE
                     MQRLVLARALYSQPKLLLCDEVTANLDKTTAQKVLANLRGLGIGLVFVTHSPEVVGCH
                     GRLYTMENGTLRESEQ"
     misc_feature    76740..78794
                     /locus_tag="ECL_00077"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; COG2274"
                     /db_xref="CDD:225183"
     gene            78800..79549
                     /locus_tag="ECL_00078"
                     /db_xref="GeneID:9122589"
     CDS             78800..79549
                     /locus_tag="ECL_00078"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610595.1"
                     /db_xref="GeneID:9122589"
                     /translation="MMFLPRLYARLCARQAGRTLLASRITQNYSQFMRCPEADVPPDF
                     LRQNALEMSGFHFVEQIFPPALWRRNVRFDLHARVAAFTREQEFYSQPRTLLLGMRWA
                     GFGLIADALLATAPDDVRFQFVTRLPALHKLMAAHEERRAGAFFSPHRLVTVLLVDER
                     LPDAPLFITQAGDQKAWLTDVSTRFLTRYGYVIRTLLPGCSLHSAEFALESQTYAPAE
                     YRQAATATLNALRKTPTLWSAWDDLSVIYHG"
     gene            79556..80806
                     /locus_tag="ECL_00079"
                     /db_xref="GeneID:9122590"
     CDS             79556..80806
                     /locus_tag="ECL_00079"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610596.1"
                     /db_xref="GeneID:9122590"
                     /translation="MKLRNRNRQRRALIPHHFSKSYEINAPRLKGVLTLFISFFLCLL
                     VFSIVFNFSETTLARGVLIPAQGDVEVRARESGTIVDFAVRPGQYVKENDPLFTVSQD
                     YGGKQGSVVQFDRQQMEAEKKRSEQRVQTIEDSIATYRKNLAQQLDIADRQIVVSRDK
                     VKKLRALLKNSTDTYEAWKAISGKGYVSKVDLDKSHNDVLNAQLNLTLEESSILDLEA
                     RKTSLTDSTQSQIDSLSQELLYVKNRISEIDRNLSSRGSSTMAMLAPADGYVVAINFP
                     PGRAITQNSEVVVVIRKNTAASMEGYLYVPATGVGRVAKGDKVKLRFDSWPVDKYGSV
                     EATLSDFYEVNIDAHSALIPLQEGQNYYLAKVRVPSWFTDPDNKKRLLMGGMTVNADI
                     VIDRKPLINLLIAPLERVRKRFID"
     misc_feature    79634..80782
                     /locus_tag="ECL_00079"
                     /note="type I secretion membrane fusion protein, HlyD
                     family; Region: type_I_hlyD; cl25632"
                     /db_xref="CDD:330453"
     gene            80896..81675
                     /locus_tag="ECL_00080"
                     /db_xref="GeneID:9122591"
     CDS             80896..81675
                     /locus_tag="ECL_00080"
                     /codon_start=1
                     /transl_table=11
                     /product="putative beta-lactamase-like protein"
                     /protein_id="YP_003610597.1"
                     /db_xref="GeneID:9122591"
                     /translation="MNITHIRNATQLITYAGKRFLIDPMLAAKDAYPGFPGTARAEIR
                     NPMVELPVDVSTLLDADAVIVTHTHDDHWDRAAVELIAKDKPIYVQNDRDAALLRSQG
                     FHNLTVMTDETTFGDIRIAKTHGGQHGTDRAYAVPELAERLGEACGVVLRHPDEKTLY
                     IAGDTVWRDAVAADLQKHQPDVVVLNAGYAHVIGFGPIIMGEQDLLNVHFLLPQAKIV
                     AVHMEAINHCLLSRRALREYVEANQIGDAVSIPQDGETVIF"
     misc_feature    80896..81654
                     /locus_tag="ECL_00080"
                     /note="L-ascorbate metabolism protein UlaG, beta-lactamase
                     superfamily [Carbohydrate transport and metabolism];
                     Region: UlaG; COG2220"
                     /db_xref="CDD:225130"
     gene            81701..82678
                     /locus_tag="ECL_00081"
                     /db_xref="GeneID:9122592"
     CDS             81701..82678
                     /locus_tag="ECL_00081"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_003610598.1"
                     /db_xref="GeneID:9122592"
                     /translation="MPLINVAIVAVDGFSPFHYSVPCILFGDAVSGEKRFNVTICAEK
                     PGVLTSKEGFALNATQDFSAIAQADIVVVPYWQHVLDRPPQVLLDSLVQARDNGAEIV
                     GLCLGSFVLAYAGILDGKRAATHWEFEHHFQSLFPRVQLDINALYVDDDNIITSAGTA
                     AALDCCLYIIRQRFGSVVANQIARRMIVPPHREGGQAQFIAQPVPKDTRDARINCLID
                     YLQQHITEPHNLDSLAKVVSMSRRTLTRHFVNATGMTVADWLTAERLRRSQILLEAGN
                     MPVERVAELVGFNSAVTWRQQFKARFGVSPTEWRKTFRIQPSVARHDAT"
     misc_feature    81716..82642
                     /locus_tag="ECL_00081"
                     /note="Helix-turn-helix domain; Region: HTH_18; cl26291"
                     /db_xref="CDD:331112"
     gene            complement(82739..83470)
                     /locus_tag="ECL_00082"
                     /db_xref="GeneID:9122593"
     CDS             complement(82739..83470)
                     /locus_tag="ECL_00082"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="YP_003610599.1"
                     /db_xref="GeneID:9122593"
                     /translation="MKHILTASLFALSASVFAGSAPHWTYEGKSGPENWGELSDEFAT
                     CKTGKFQSPIDIRNAYNATLPPLEMNFHTAAEKLVNNGHTLQVTASDEDEFRLDDQIF
                     TLRQYHFHTPSENRINGKSFPLEAHFVHASKEGDVAVLAVMFEVGPENSALNPLLARL
                     PKEKDHEISIDKHLDLRPLFPADLHYYRFSGSLTTPPCTEGLRWLVMKNTVTLSEKQL
                     EMFKQALEHSNNRPLQPLNGRVIVQ"
     misc_feature    complement(82748..83380)
                     /locus_tag="ECL_00082"
                     /note="Carbonic anhydrase alpha, prokaryotic-like
                     subfamily. Carbonic anhydrases (CAs) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism: a nucleophilic attack of
                     a zinc-bound hydroxide ion on carbon...; Region:
                     alpha_CA_prokaryotic_like; cd03124"
                     /db_xref="CDD:239398"
     misc_feature    complement(order(82889..82891,83090..83092,83129..83131,
                     83141..83143,83147..83149,83153..83155,83222..83224))
                     /locus_tag="ECL_00082"
                     /note="active site"
                     /db_xref="CDD:239398"
     misc_feature    complement(order(83090..83092,83141..83143,83147..83149))
                     /locus_tag="ECL_00082"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:239398"
     gene            complement(83586..84674)
                     /locus_tag="ECL_00083"
                     /db_xref="GeneID:9122594"
     CDS             complement(83586..84674)
                     /locus_tag="ECL_00083"
                     /codon_start=1
                     /transl_table=11
                     /product="putative RecF protein"
                     /protein_id="YP_003610600.1"
                     /db_xref="GeneID:9122594"
                     /translation="MINTLHIQNYRSIRDMSLELEQLNIVFGPNGTGKSNIYKAIHLM
                     HSAAQGQFSQALANEGGILKVFWAGKTRSDQLRRMNLAVETETYEYELQVGFVEKLPY
                     PSQFQLDPVIKEESLWLSGQHRRPSAQLMKRRNQAVFLNNVHHEKVTHSGTLYENESV
                     FGQLGEPHLYPEVSQMRESLRNWRFYHEFSVASGSMMRAPQVGFRSPVLASDGANLAA
                     AFQTIVEIGDELLLMRILDQAFPGCVFYSDNTGGRFRMMMQREGLSRPLEPAEFSDGT
                     LRFLCLAVALLSPRPPAFIALNEPENSLHPQMLPALASLIAEASRYSQIWLTSHSPEL
                     ATLIEKHRSFSLYQLSMTEGETKMEKLG"
     misc_feature    complement(83592..84674)
                     /locus_tag="ECL_00083"
                     /note="AAA domain, putative AbiEii toxin, Type IV TA
                     system; Region: AAA_21; cl26228"
                     /db_xref="CDD:331049"
     gene            complement(84820..85701)
                     /locus_tag="ECL_00084"
                     /db_xref="GeneID:9122595"
     CDS             complement(84820..85701)
                     /locus_tag="ECL_00084"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610601.1"
                     /db_xref="GeneID:9122595"
                     /translation="MDFVMDELAQWVNFRPVCPEMAIGLPTPRPALRLIMTTGGDTQM
                     RFSHPPHDDVTQKMADFTASYLPKIGDLAGFIVCAKSPSCGMERVRVYDENGNRGRKE
                     GVGLFTAALLETWPWLPVEEDGRLHDPVLRENFVERVFALHELNTLRKNGLTRRALLD
                     FHSRYKLQLLAHHQAGYREIGPFVASLHEWDDLDAFFEAYREKLMTILKKPASRKNHT
                     NVLMHIQGYFRNQLNSRQRGELRDVILHYREGLLPILAPITLLKHYLAEYPDQYLMTQ
                     NYFDPYPDDLGLRLAVK"
     misc_feature    complement(85312..85701)
                     /locus_tag="ECL_00084"
                     /note="Uncharacterized conserved protein YbbK, DUF523
                     family [Function unknown]; Region: YbbK; COG1683"
                     /db_xref="CDD:224597"
     misc_feature    complement(84829..85311)
                     /locus_tag="ECL_00084"
                     /note="Uncharacterized conserved protein YbgA, DUF1722
                     family [Function unknown]; Region: YbgA; COG3272"
                     /db_xref="CDD:225811"
     gene            85708..85869
                     /locus_tag="ECL_00085"
                     /db_xref="GeneID:9122596"
     CDS             85708..85869
                     /locus_tag="ECL_00085"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610602.1"
                     /db_xref="GeneID:9122596"
                     /translation="MPAVKANGGPGQAAANTQHRFRCHGMFLQSQYLKLTQSCLFVQV
                     LAEVFFIAF"
     gene            complement(85882..86292)
                     /locus_tag="ECL_00086"
                     /db_xref="GeneID:9122597"
     CDS             complement(85882..86292)
                     /locus_tag="ECL_00086"
                     /codon_start=1
                     /transl_table=11
                     /product="5-hydroxyisourate hydrolase"
                     /protein_id="YP_003610603.1"
                     /db_xref="GeneID:9122597"
                     /translation="MKKTAPLLILASMAFAPAAFSAPAGTLSVHVLDQQTGMPPSDVT
                     VTLEKQQQDKWIPVASGKTDHDGRIKSLYPQEQDMQPGVYKVTFKTADYFHAKKLETF
                     FPEVPVLFTVTRTNEKLHIPLLLSQYGYSTYKGS"
     misc_feature    complement(85885..86220)
                     /locus_tag="ECL_00086"
                     /note="hydroxyisourate hydrolase; Region: hdxy_isourate;
                     TIGR02962"
                     /db_xref="CDD:274364"
     misc_feature    complement(order(85894..85896,85921..85923,85927..85929,
                     85933..85935,86089..86091,86197..86199,86203..86205))
                     /locus_tag="ECL_00086"
                     /note="active site"
                     /db_xref="CDD:100114"
     misc_feature    complement(order(85891..85911,85915..85917,85960..85968,
                     85978..85980,85984..85989,86182..86193))
                     /locus_tag="ECL_00086"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100114"
     gene            complement(86392..87123)
                     /locus_tag="ECL_00087"
                     /db_xref="GeneID:9122598"
     CDS             complement(86392..87123)
                     /locus_tag="ECL_00087"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_003610604.1"
                     /db_xref="GeneID:9122598"
                     /translation="MDMAYSIGEFARLSGITATTLRAWQRRYGLLKPQRTEGGHRQYS
                     DEDVQQALKILDWVKKGVPIGQVKPLLERPVPRRTNNWQTLQQNMLERLQGGKIESLR
                     QMIYDAGREYPRPELVTNVLRPLRSQVSANVAAAMTLRAILDGILIAYTSFCLEGDKK
                     APGDNILLSGWYLNDPCEIWLEALSRTGQGHRIDVLPTPPATLAPEIFPDRKWLLVTS
                     GKMTAARKKQVAQWQQQLSLEVIIL"
     misc_feature    complement(86419..87111)
                     /locus_tag="ECL_00087"
                     /note="transcriptional regulator MirA; Provisional;
                     Region: PRK15043"
                     /db_xref="CDD:185003"
     gene            87235..87759
                     /gene="blc"
                     /locus_tag="ECL_00088"
                     /db_xref="GeneID:9122599"
     CDS             87235..87759
                     /gene="blc"
                     /locus_tag="ECL_00088"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein Blc"
                     /protein_id="YP_003610605.1"
                     /db_xref="GeneID:9122599"
                     /translation="MKLWPVVTGVAIALTLVACKSPTPPKGVQPISGFDASRYLGKWY
                     EVARLENRFERGLEQVTATYGQRSDGGISVLNRGYDPVKNKWNESEGKAYFTGASTTA
                     ALKVSFFGPFYGGYNVIKLDDKYQYALVSGPNRDYLWILSRTPTVPDAVKQDYLNTAR
                     SLGFRVDQLVWVKH"
     misc_feature    87235..87756
                     /gene="blc"
                     /locus_tag="ECL_00088"
                     /note="outer membrane lipoprotein Blc; Provisional;
                     Region: PRK10477"
                     /db_xref="CDD:182489"
     gene            complement(87763..88776)
                     /locus_tag="ECL_00089"
                     /db_xref="GeneID:9122600"
     CDS             complement(87763..88776)
                     /locus_tag="ECL_00089"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, pilin FimA"
                     /protein_id="YP_003610606.1"
                     /db_xref="GeneID:9122600"
                     /translation="MMRLFLFISGLLLCASAQAMEWKSDITLSPQPMTYSGPADSVMP
                     GSIIGSTWSASVSVQQVFWCGFVFHCTKSTLEPSSSAISSGMTVTVDGVNYTIFETGV
                     PGVGYIIGLKDFNGTKYIPLQTGVTQSYPAEGTSTSTQDLGWSAKVTFIKTGVALKSG
                     VYQIPTINAAVLTAYNNEVKTAKVIINPTTITVTASGCTVGTKSANVDLGTIDIRTLT
                     TVGSTSPSGAFNVSLTCDANVAVSAVMTDQTTPSNTSSVVTLTGDSTASGVGVQFFYN
                     GTGPLMMGPDSSAAGTTNQFFIQSTTAAQTLSLPFQAQYIRTGELVPGSANALASITF
                     SYQ"
     misc_feature    complement(87766..88209)
                     /locus_tag="ECL_00089"
                     /note="Fimbrial protein; Region: Fimbrial; pfam00419"
                     /db_xref="CDD:306843"
     gene            complement(88773..89288)
                     /locus_tag="ECL_00090"
                     /db_xref="GeneID:9122601"
     CDS             complement(88773..89288)
                     /locus_tag="ECL_00090"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, pilin FimA"
                     /protein_id="YP_003610607.1"
                     /db_xref="GeneID:9122601"
                     /translation="MSVTLRTFSIALLIFTFPVRSYDVLVSVTGNLIGNTCVVAADSK
                     EQDVPLGTIGIKQFPRAGAVSNIKTPFTIRLEACGPTFAGVKIRFSGTPDNDNPQLVK
                     IADGGATGVAVQILDKDGGLIPLDTQTTARGTPGDDSVEMTFYARLAATGAPVNAGDV
                     SAFATWTTEYQ"
     misc_feature    complement(88776..89270)
                     /locus_tag="ECL_00090"
                     /note="Pilin (type 1 fimbria component protein) [Cell
                     motility]; Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            complement(89279..91801)
                     /locus_tag="ECL_00091"
                     /db_xref="GeneID:9122602"
     CDS             complement(89279..91801)
                     /locus_tag="ECL_00091"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, porin PapC"
                     /protein_id="YP_003610608.1"
                     /db_xref="GeneID:9122602"
                     /translation="MKRKILCATVISLVIRQAMAAESALQFNPAFLNGESANSADLAW
                     INAGSALPPGDHNLNVYINNNYAFTGNITFRTAENTGEALPCLTPEQIAALGIDSQQA
                     KGGALPLAQRCIFLTEAFADTRFDFDQQTLSLSFTVPQSAMRNLPRGYVSPESWEAGI
                     PAAWLNYVVNGSNNDYQGETRTRDQQLFASLNSGINLGAWRLRDFTTWTKDTNELTHV
                     QTWLQRDIPALNAQVYAGETYTSAQVFDAVGLRGIALKTDDNMLPASLSGYAPEVHGI
                     ARSNATVTVRQNGNIIYQTSVPPGAFVLKDLYPTSSGGDLAVTIQENDGSQTQYTLPY
                     ASVPNLVRNGQLKYALGAGKYRPMGHQDAPSFAQGELFYGWRYGLTFYGGAQFADRYN
                     GLAFGIGQNLGRFGAYSIDLTHARSQLADDQHYTGDSVRLRYSKLLNDIGTRVNFFSL
                     RYSTKRFYTLSDTTYKGMAGGSPKQIVEDDGTVTTHYDTVYNLRMSRKAKNQLLLSQP
                     MGQYGSLSLSWDQQTYWNTSKTTQSLQFAWNATFRHVSLGVSVQRSSSLYDDKKDNVL
                     AMSLSVPLGNPALSTRARFTTTHADSTGTTASTGVSGYLPGQENLFYSVNQRYSAQQH
                     YGGDATLQYEGAKGDYNLGYSYTRDSRNLSYGMSGGAVLHEDGLTLSQPLGNTNILVK
                     APGASDVAVLNHKGIKTDSRGYAVIPYATPYRVNQVALDVTTAGNDVELENAIVNKTP
                     TDGALVRATLVTRQGKKAMFVVRRGNDVLPFGTLISLNDDKTSGIVGDGGSLYLSGLT
                     EQGTLSAVWGRNSDQRCTINYALNKQSYNARTGLYSQEVVCQ"
     misc_feature    complement(89282..91801)
                     /locus_tag="ECL_00091"
                     /note="Outer membrane usher protein FimD/PapC [Cell
                     motility, Extracellular structures]; Region: FimD;
                     COG3188"
                     /db_xref="CDD:225729"
     gene            complement(91825..92502)
                     /locus_tag="ECL_00092"
                     /db_xref="GeneID:9122603"
     CDS             complement(91825..92502)
                     /locus_tag="ECL_00092"
                     /codon_start=1
                     /transl_table=11
                     /product="P pilus assembly protein, chaperone PapD"
                     /protein_id="YP_003610609.1"
                     /db_xref="GeneID:9122603"
                     /translation="MRAKAGICLAISLCSSAAYAGGVGLGATRMVYSSTTNQSMLQVR
                     NTHPDATFLIQSWMENEEGQKTNDFVITPPLFVMKPASESAVKIMFNGKALPEDRETL
                     YWMTVKAIPQQTKSGSGNSLQFASANRIKVFYRPESLGQGAGDAWKSLTGAYRGGKVT
                     LSNPTPYYLTTINLKIDGMPVQPVMVPPKSSVTLGETFSHASSVSYQTINDYGAWTPA
                     TRAALSQ"
     misc_feature    complement(91834..92493)
                     /locus_tag="ECL_00092"
                     /note="Pili assembly chaperone PapD, C-terminal domain;
                     Region: PapD_C; cl27373"
                     /db_xref="CDD:332194"
     gene            complement(92556..93140)
                     /locus_tag="ECL_00093"
                     /db_xref="GeneID:9122604"
     CDS             complement(92556..93140)
                     /locus_tag="ECL_00093"
                     /codon_start=1
                     /transl_table=11
                     /product="fimbrial protein FimI"
                     /protein_id="YP_003610610.1"
                     /db_xref="GeneID:9122604"
                     /translation="MKAQFKTKTLLAVAVAAVLPAGSAFAATTSGGTVNFSGKVVTSA
                     CAISAGSANIDVDMGEVRTATLAAAGSEASTAKAFSITLEDCEIADTSASTEDNPIAA
                     TTVAVTFTGTPDAADANSLAVGANGGANSAQHVAIRLYDEQGKVVKLGEPAAAIPLRA
                     GANTLNFSAKYYSPQGNATAGDASAVATYTVTYS"
     misc_feature    complement(92562..93080)
                     /locus_tag="ECL_00093"
                     /note="Pilin (type 1 fimbria component protein) [Cell
                     motility]; Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            complement(93193..93795)
                     /locus_tag="ECL_00094"
                     /db_xref="GeneID:9122605"
     CDS             complement(93193..93795)
                     /locus_tag="ECL_00094"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component system, NarL family, response
                     regulator, fimbrial Z"
                     /protein_id="YP_003610611.1"
                     /db_xref="GeneID:9122605"
                     /translation="MANKTGNKRHLTTALLGGDHFSRQGIAAVLKNMVPEMQVIASSD
                     DYSLMETVFLTTPVDVIFLSGTEKYHAGFDCLKYIKNIKSRQPDVLICMYSAPANSWL
                     WIRGDIDAYISLQEPLYHWRASLLKMVDSRYRPKKKPTALSLTPGEWRVLKDLRKGLD
                     MRYIAETEQLSYRRVSALKSSAIRKLGLRNKTDLLVFLTS"
     misc_feature    complement(93205..93741)
                     /locus_tag="ECL_00094"
                     /note="DNA-binding response regulator, NarL/FixJ family,
                     contains REC and HTH domains [Signal transduction
                     mechanisms, Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     gene            94506..95297
                     /locus_tag="ECL_00095"
                     /db_xref="GeneID:9122606"
     CDS             94506..95297
                     /locus_tag="ECL_00095"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulatory protein"
                     /protein_id="YP_003610612.1"
                     /db_xref="GeneID:9122606"
                     /translation="MHKYYIINGIVEFHPAASTLRDLNNPEQVVVLNSPAGRCLLLLI
                     ERAGSIVTQQECMDIVWQRRGMMVSPNTYYQNISILRKGLKKAGFETDPIVTIPRIGL
                     TLASDTQITIKEAQLPLAEPEAPVQTVQEEAGVPQPVASVTPVAPVAKRRFWLVGALL
                     ALLLIVSVSVISYSRPHDSYFVDGYRFTTMMGECRLYFARDIETPQDREKALAYAAPF
                     KDECSSYPWIYISGYSLLPRASVIRCDRAMTEPNRCMSDYFIQDH"
     misc_feature    94515..94949
                     /locus_tag="ECL_00095"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     misc_feature    order(94659..94664,94719..94721,94728..94730,94752..94757,
                     94791..94793,94806..94808)
                     /locus_tag="ECL_00095"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:294013"
     gene            95299..95781
                     /locus_tag="ECL_00096"
                     /db_xref="GeneID:9122607"
     CDS             95299..95781
                     /locus_tag="ECL_00096"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610613.1"
                     /db_xref="GeneID:9122607"
                     /translation="MARYRQTLLTLCLCLLVGALAAGYYLWQRYYIHPFACQVNFIQH
                     HPEETLTLWLNYTVDGNNGTLSMNGRVKSDPGKTFNRKIFFQVERKDNVYYMRSVRNI
                     KFPDDDVSDSWLEKYEPLFFIYPNESIYMRIKKQQNDNYLFILGTLPTYVCHPSKTEG
                     "
     gene            96020..96907
                     /locus_tag="ECL_00097"
                     /db_xref="GeneID:9122608"
     CDS             96020..96907
                     /locus_tag="ECL_00097"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator containing an
                     amidase domain and an AraC-type DNA-binding HTH domain"
                     /protein_id="YP_003610614.1"
                     /db_xref="GeneID:9122608"
                     /translation="MEALRTASCVQKTRQKIAFKLSLISTRAELPITSNAGISVQPEA
                     AHLTPGEYDYIAVIGGSLEDLDKGLPDDRAFLAEAHHNAIPLIGIGTGSFILAEEGIL
                     NERRASIHPYHHDVFTQRFPQVYAEQGLDFIDEGDVLTCPGGISTLTLTTALIRAHAG
                     DDIAATTSRRLSLSPHAVTTPRPANIALIPDSRLRRAVMIIEQYLTRPLSAAGLAQDV
                     KLSERQLNRLFHAEFGKTAREFIRSARLRYACWLLKNSQQSVTDIARRMGFSDCAHFI
                     RHFQLEYGCTPGVWRTSQS"
     misc_feature    96023..96892
                     /locus_tag="ECL_00097"
                     /note="Helix-turn-helix domain; Region: HTH_18; cl26291"
                     /db_xref="CDD:331112"
     gene            96993..97991
                     /locus_tag="ECL_00098"
                     /db_xref="GeneID:9122609"
     CDS             96993..97991
                     /locus_tag="ECL_00098"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610615.1"
                     /db_xref="GeneID:9122609"
                     /translation="MNWQPFRGSAPGNMTIFSASFPDVSDQWPMKDETAREINALNQA
                     LKADPALRPPLIEYEEGGHAVLVPQNRYSEQAFRNRPALLAWRARLVPTALALFVVQN
                     PLEERLPEGTKMDSDSRQWFIHANDAIGVRSRAKVLAALVEKYIHNESENNWVSLASG
                     AAIPVLEALRNAKLDGQQVYLTLVDKDPVALSWAETMAAQEGLVVGEQLTLLRRNLLH
                     TLVRNDDLLLELGEHQAELVDALGIFEYFNDTDAVTFLQRALRLVKPGGAVIVSNMLT
                     SSPQIDFVLRGIGWEDIHPRSLQQLQDIHLAAGVPVENVTVVVPKDGVYAVMEVKV"
     misc_feature    97494..97793
                     /locus_tag="ECL_00098"
                     /note="Methyltransferase domain; Region: Methyltransf_25;
                     pfam13649"
                     /db_xref="CDD:316196"
     gene            98522..98962
                     /locus_tag="ECL_00099"
                     /db_xref="GeneID:9122610"
     CDS             98522..98962
                     /locus_tag="ECL_00099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610616.1"
                     /db_xref="GeneID:9122610"
                     /translation="MKIETAHSSHFERLVAIWESSVRATHHFLQESDIAALRPLLLNA
                     YLPNLTVVMARDDAGVIHGFLGVDENRIEMLFVDDASRGKGVGKLLLHYAIAEFGVNE
                     VDVNEQNPQGVAFYRHMGFVQVGRSEVDGQGNPFPLLHMRLNRD"
     misc_feature    98555..98947
                     /locus_tag="ECL_00099"
                     /note="N-Acyltransferase superfamily: Various enyzmes that
                     characteristicly catalyze the transfer of an acyl group to
                     a substrate; Region: NAT_SF; cl17182"
                     /db_xref="CDD:327402"
     misc_feature    order(98744..98752,98780..98785)
                     /locus_tag="ECL_00099"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(98959..99330)
                     /locus_tag="ECL_00100"
                     /db_xref="GeneID:9122611"
     CDS             complement(98959..99330)
                     /locus_tag="ECL_00100"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="YP_003610617.1"
                     /db_xref="GeneID:9122611"
                     /translation="MGLTSYKGEEVRKSDVTTAKNYLSQDEVSELNRVVNMWLDFAED
                     QAKRRKQVFLRDWQTKLDQFLQFNDRDVLEGAGKISKKAADEKACSEYIEYEKKQRLL
                     KEAEGEKDIVGLLKWDKQAKR"
     misc_feature    complement(98962..>99330)
                     /locus_tag="ECL_00100"
                     /note="Virulence protein RhuM family; Region:
                     Virulence_RhuM; cl19850"
                     /db_xref="CDD:303035"
     gene            complement(99427..99987)
                     /locus_tag="ECL_00101"
                     /db_xref="GeneID:9122612"
     CDS             complement(99427..99987)
                     /locus_tag="ECL_00101"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="YP_003610618.1"
                     /db_xref="GeneID:9122612"
                     /translation="MTYEELINSPADEFVMFASKDGKVRIECRFESDTLWLSQATICE
                     LYGKAKATISGHIKNIFDEGELVENSVVRFYRTTANDGKVYNVQYFSLPVILAIGYRV
                     RSTRGTQFRQWATQTLQEYLVKGFVMDDERLKNPPVGSSAVPDYFDEMLERIRDIRAS
                     ERRVYLRVREIFALAADYQPSLKETT"
     misc_feature    complement(<99430..99951)
                     /locus_tag="ECL_00101"
                     /note="Virulence protein RhuM family; Region:
                     Virulence_RhuM; cl19850"
                     /db_xref="CDD:303035"
     gene            complement(100046..100387)
                     /locus_tag="ECL_00102"
                     /db_xref="GeneID:9122613"
     CDS             complement(100046..100387)
                     /locus_tag="ECL_00102"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610619.1"
                     /db_xref="GeneID:9122613"
                     /translation="MADSHSTPDTDQSGTERSLIVGYRPNVFDKSTPNIILSGKWLRT
                     AGFETGHQVTVKVMKGCIVLVAYNEQEQRLQDDYKRTKAKLIEIENALTAIQTPRAGK
                     RLAKTNTNHLA"
     misc_feature    complement(<100190..100387)
                     /locus_tag="ECL_00102"
                     /note="Toxin SymE, type I toxin-antitoxin system; Region:
                     SymE_toxin; cl07446"
                     /db_xref="CDD:323948"
     gene            complement(100747..101040)
                     /locus_tag="ECL_00103"
                     /db_xref="GeneID:9122614"
     CDS             complement(100747..101040)
                     /locus_tag="ECL_00103"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610620.1"
                     /db_xref="GeneID:9122614"
                     /translation="MQNFYHLDQLIHGYFNQDYDLINDGEDTIEGIIGLFKKTAPGWL
                     LKELAEEIDTFIECYGDKLDDEFKSRYGFDFSPELWETTSYDFLMTVRRLALA"
     gene            complement(101748..101838)
                     /locus_tag="ECL_tRNA001"
                     /db_xref="GeneID:9122615"
     tRNA            complement(101748..101838)
                     /locus_tag="ECL_tRNA001"
                     /product="tRNA-Sec"
                     /db_xref="GeneID:9122615"
     gene            102167..104485
                     /locus_tag="ECL_00104"
                     /db_xref="GeneID:9127669"
     CDS             102167..104485
                     /locus_tag="ECL_00104"
                     /codon_start=1
                     /transl_table=11
                     /product="alpha-xylosidase"
                     /protein_id="YP_003610621.1"
                     /db_xref="GeneID:9127669"
                     /translation="MKISDGNWLIQPGLTVTYPVQVFDVEQQGNDLVVYVAPRDVRER
                     AWQLDTLMFTVRLFAPQEGIVGVRIEHFQGAQDKGPHYPLNVLKDVRVETVNNAEYAE
                     LKSGNLSVRVTKGEFWALDFLRNGQRITGSELKNNGYVQDSNTNRNYLFERLDLGVGE
                     TVYGLGERFTALVRNGQQVDTWNRDGGTSTEQSYKNIPFYLTNRGYGVLVNHPENVSF
                     EIGSEKVSKVQFSVEGEYLEYFVIDGPTPKAVLDRYTQFTGRPALPPAWSFGLWLTTS
                     FTTNYDEATVNSFIDGMAERDLPLHVFHFDCFWMKAFQWCDFEWDPVTFPDPEGMIRR
                     LKEKGLKVCVWINPYIGQKSPVFNELKEKGYLLKRPDGSVWQWDKWQPGLAIYDFTNP
                     DACRWYADKLKGLVEIGVDCFKTDFGERIPTDVQWFDGSDPQKMHNHYAFIYNALVWN
                     VLKETVGEEEAVLFARSASVGAQQFPVHWGGDCYANYESMAESLRGGLSIGLSGFGFW
                     SHDIGGFENTAPAHVYKRWCAFGLFSSHSRLHGSKSYRVPWAYDDESCDVVRHFTQLK
                     CQLMPYLYRQAALARECGTPMLRAMMLEFPDDPACDYLDRQYMLGDALMVAPVFSEAG
                     EVQFYLPEGRWTHLWHNDEVQGCRWHKQQHDFMSLPVYVRDNTLLALGNNKHKPDYAW
                     NEGTAFQLFNLDEGATAVSEVPAADGSVAFTLKASRKGDTVTLTGAGDARNWSVCLRN
                     VQKVSGVKGGSYAGSEWGVVVDAEGDEVVVHL"
     misc_feature    102167..104164
                     /locus_tag="ECL_00104"
                     /note="putative alpha-glucosidase; Provisional; Region:
                     PRK10658"
                     /db_xref="CDD:236731"
     gene            complement(104534..106237)
                     /locus_tag="ECL_00105"
                     /db_xref="GeneID:9122616"
     CDS             complement(104534..106237)
                     /locus_tag="ECL_00105"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610622.1"
                     /db_xref="GeneID:9122616"
                     /translation="MKFIGKLLVYLLVALLLVLLALYFLLQTRWGASQVSSWVTVNTD
                     YELSFDLMDHRFSSPSHILLENVTFGRDGQPATLVAKKVDIGLGSRQLTDPLHMDTIT
                     LVDGTLNLSPQTAPMPFQADRLQLNNMAFNSPNTEWDLSAQKVTGGVSPWQPEAGNVL
                     GKNAQIQMSAGSLTLNGVPATNVLIQGQLNGKEVVLNTIGADMARGSLTGSALRNADG
                     SWVIDTMRLNEIRLQSDKTLLDFFSPLNTIPSLQIGRLEVTDARLQGPDWAVTDLDLS
                     LRNLTLSKGDWQSLDGRLSMNASEFIYGSLHLFDPILNAEFSPQGVALRQFTSRWEGG
                     MVRTSGNWLRDGKALVLDDVAVAGLEYTLPQNWKTLWMDPLPEWLNSVTLKKFGLSRN
                     LVIDIDPAFPWQITSLDGYGANLQLAQDHKWGVWGGSATLNGAAATFNRVDVRRPSLA
                     LNANAATVNITDLSAFTEKGILEATATVSQLAQRQTTVSLNGRGVPLNILQQWGWPAL
                     PVSGDGNIQLTASGSVQANTPLKPTVNGKLSAVNMDKQQVQQTMTGGVVSTPPSPQPS
                     P"
     misc_feature    complement(104618..106057)
                     /locus_tag="ECL_00105"
                     /note="AsmA family; Region: AsmA; cl25878"
                     /db_xref="CDD:330699"
     gene            complement(106357..107748)
                     /locus_tag="ECL_00106"
                     /db_xref="GeneID:9122617"
     CDS             complement(106357..107748)
                     /locus_tag="ECL_00106"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil-xanthine permease"
                     /protein_id="YP_003610623.1"
                     /db_xref="GeneID:9122617"
                     /translation="MSVNSIESPDAQPIAQKQNSELIYRLEDRPPLPQTLFAACQHLL
                     AMFVAVITPALLICQALGLPAQDTQHIISMSLFASGVASIIQIKAWGPVGSGLLSIQG
                     TSFNFVAPLIMGGTALKTGGADVPTMMAALFGTLMLASCTEMVISRVLHLARRVITPL
                     VSGVVVMIIGLSLIQVGLTSIGGGYAAMSDHTFGAPKNLLLAGVVLAIIILLNRQRNP
                     YLRVASLVIAMAAGYLLAWALGMLPENTAPTNSALITVPTPLYYGLGIDWGLLLPLML
                     VFMITSLETIGDITATSDVSEQPVSGPLYMKRLKGGVLANGLNSFVSAVFNTFPNSCF
                     GQNNGVIQLTGVASRYVGFVVALMLIILGLFPAVSGFVQHIPEPVLGGATLVMFGTIA
                     ASGVRIVSREPLNRRAIMIIALSLAVGLGVSQQPLILQFAPDWVKNLLSSGIAAGGIT
                     AIVLNLVFPPEKN"
     misc_feature    complement(106363..107694)
                     /locus_tag="ECL_00106"
                     /note="Xanthine/uracil permease [Nucleotide transport and
                     metabolism]; Region: UraA; COG2233"
                     /db_xref="CDD:225142"
     gene            107974..109176
                     /locus_tag="ECL_00107"
                     /db_xref="GeneID:9122618"
     CDS             107974..109176
                     /locus_tag="ECL_00107"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate transporter"
                     /protein_id="YP_003610624.1"
                     /db_xref="GeneID:9122618"
                     /translation="MIHLDTLSTLVAATLVLLLGRKLVHSVSFLKKYTIPEPVAGGLL
                     VALALLVLKKSMGWEIDFDMSLKDPLMLAFFATIGLNANLASLRSGGKVLGVFLIVVV
                     GLLLMQNAIGIGMASLLGLDPLMGLLAGSITLSGGHGTGAAWSKLFIERYGFENATEV
                     AMACATFGLVLGGLIGGPVARYLVKHSTTPDGRPDDELVPTAFEKPDVGRTITSLVMI
                     ETIAMIAICLTLGKVVAQWLAGTAFELPTFVCVLFIGVILSNGLALMGFYRVFERAVS
                     VLGNVCLSLFLAMALMSLKLWELASLALPMVAILAVQALFMALYAMFVTWRMMGKNYD
                     AAVLAAGHCGFGLGATPTAIANMQAITERFGPSHMAFLVVPMVGAFFIDIVNALVIKL
                     YLMLPMFA"
     misc_feature    107977..109164
                     /locus_tag="ECL_00107"
                     /note="Sodium/glutamate symporter; Region: Glt_symporter;
                     cl19414"
                     /db_xref="CDD:327550"
     gene            complement(109179..111260)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /db_xref="GeneID:9122619"
     CDS             complement(109179..111260)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA helicase"
                     /protein_id="YP_003610625.1"
                     /db_xref="GeneID:9122619"
                     /translation="MKGRLLDAIPLNSLTGVGAAQSSKLGKIGLHTVQDLLLHLPLRY
                     EDRTQLYKIGDLLPAIYATVEGEVLNCNITFGGRRMMTCQISDGTGILTMRFFNFNAA
                     MKNSLATGRRVLAYGEAKRGKYGAEMIHPEYRVQGDLSTPELQETLTPVYPTTEGIKQ
                     ATLRKLTDQALELLDTCAITELLAPELAQGMMSLPEALRTLHRPPPTLQLSDLESGKH
                     PAQRRLILEELLAHNLSMLALRAGAQHFHAQPLSPRDELKDKLLASLPFKPTGAQARV
                     TAEIERDMALDVPMMRLVQGDVGSGKTLVAALAALRAIAHGKQVALMAPTELLAEQHA
                     NNFRAWFAPLGIEVGWLAGKQKGKARLAQQDAIARGEVQMIVGTHAIFQEQVQFNGLA
                     LVIIDEQHRFGVHQRLALWEKGLQQGFHPHQLIMTATPIPRTLAMTAYADLDTSTIDE
                     LPPGRTPVTTVAIPDTRRSDIIDRVRNACTHEGRQAYWVCTLIEESDLLEAQAAEATW
                     EELKLALPELKVGLVHGRMKPAEKQAVMQSFKQGELHLLVATTVIEVGVDVPNSSLMI
                     IENPERLGLAQLHQLRGRVGRGAVASHCVLLYKAPLSKTAQMRLQVLRDSNDGFVIAQ
                     KDLEIRGPGELLGTRQTGNAEFKVADLLRDQAMIPEVQRLARHIHERYPEQAAALIER
                     WMPETERYSNA"
     misc_feature    complement(109182..111260)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="ATP-dependent DNA helicase RecG; Provisional;
                     Region: PRK10917"
                     /db_xref="CDD:236794"
     misc_feature    complement(110856..111074)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="RecG_wedge_OBF: A subfamily of OB folds
                     corresponding to the OB fold found in the N-terminal
                     (wedge) domain of Escherichia coli RecG. RecG is a
                     branched-DNA-specific helicase, which catalyzes the
                     interconversion of a DNA replication fork to a...; Region:
                     RecG_wedge_OBF; cd04488"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(110856..110858,110913..110915,
                     110919..110921,110925..110927,111072..111074))
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="generic binding surface II; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(order(110877..110879,110955..110957,
                     110970..110972,111021..111023))
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="ssDNA binding site; other site"
                     /db_xref="CDD:239934"
     misc_feature    complement(109971..110387)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="DEAD-like helicases superfamily. A diverse family
                     of proteins involved in ATP-dependent RNA or DNA
                     unwinding. This domain contains the ATP-binding region;
                     Region: DEXDc; cd00046"
                     /db_xref="CDD:238005"
     misc_feature    complement(110352..110366)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238005"
     misc_feature    complement(110061..110072)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="putative Mg++ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238005"
     misc_feature    complement(109470..109871)
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="Helicase superfamily c-terminal domain; associated
                     with DEXDc-, DEAD-, and DEAH-box proteins, yeast
                     initiation factor 4A, Ski2p, and Hepatitis C virus NS3
                     helicases; this domain is found in a wide variety of
                     helicases and helicase related proteins; may...; Region:
                     HELICc; cd00079"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(109605..109613,109686..109691,
                     109779..109790))
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="nucleotide binding region [chemical binding]; other
                     site"
                     /db_xref="CDD:238034"
     misc_feature    complement(order(109500..109502,109509..109511,
                     109521..109523,109587..109589))
                     /gene="recG"
                     /locus_tag="ECL_00108"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238034"
     gene            complement(111264..111884)
                     /locus_tag="ECL_00109"
                     /db_xref="GeneID:9122620"
     CDS             complement(111264..111884)
                     /locus_tag="ECL_00109"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA guanosine-2'-O-methyltransferase"
                     /protein_id="YP_003610626.1"
                     /db_xref="GeneID:9122620"
                     /translation="MEQVHKPHNVSAIVRTADAVGVHEVHAVWPGARMRTMASTAAGS
                     NSWVSVKTHQTIGEAVSHLKGRGMQILATNLSAKAVDFREIDYTRPTCILMGQEKTGI
                     TQEALDLADQDIIIPMIGMVQSLNVSVASALILYEAQRQRQNAGMYERSNSMLPEDEQ
                     QRLLFEGGYPVLARVAKQKKLPYPHVNAQGEIEADAGWWATMQYAG"
     misc_feature    complement(111270..111884)
                     /locus_tag="ECL_00109"
                     /note="tRNA guanosine-2'-O-methyltransferase; Provisional;
                     Region: PRK11081"
                     /db_xref="CDD:236837"
     misc_feature    complement(111477..111884)
                     /locus_tag="ECL_00109"
                     /note="SpoU rRNA Methylase family; Region: SpoU_methylase;
                     pfam00588"
                     /db_xref="CDD:278985"
     misc_feature    complement(111300..111467)
                     /locus_tag="ECL_00109"
                     /note="SpoU, rRNA methylase, C-terminal; Region:
                     SpoU_methylas_C; pfam12105"
                     /db_xref="CDD:288922"
     gene            111861..111977
                     /locus_tag="ECL_00110"
                     /db_xref="GeneID:9122621"
     CDS             111861..111977
                     /locus_tag="ECL_00110"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610627.1"
                     /db_xref="GeneID:9122621"
                     /translation="MRFMDLLHADRQIRLTPGEHFADTCITLCIHKTSFGFG"
     gene            complement(111958..114072)
                     /locus_tag="ECL_00111"
                     /db_xref="GeneID:9122622"
     CDS             complement(111958..114072)
                     /locus_tag="ECL_00111"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610628.1"
                     /db_xref="GeneID:9122622"
                     /translation="MYLFESLNQLIQTYLPEDQIKRLQQAYLVARDAHEGQTRSSGEP
                     YITHPVAVACILAEMKLDYETLMAALLHDVIEDTPATYQDMEQLFGKSVAELVEGVSK
                     LDKLNFRDKKEAQAENFRKMIMAMVQDIRVILIKLADRTHNMRTLGSLRPDKRRRIAR
                     ETLEIYSPLAHRLGIHHIKTELEELGFEALYPNRYRVIKEVVKAARGNRKEMIQKILS
                     EIEGRLQEAGIPCRVSGREKHLYSIYCKMVLKEQRFHSIMDIYAFRVIVHDADTCYRV
                     LGQMHSLYKPRPGRMKDYIAIPKANGYQSLHTSMIGPHGVPVEVQIRTEDMDQMAEMG
                     VAAHWAYKEHGGESSTTAQIRAQRWMQSLLELQQSAGSSFEFIESVKSDLFPDEIYVF
                     TPEGRIVELPAGATPVDFAYAVHTDIGHACVGARVDRQPYPLSQPLASGQTVEIITAP
                     GARPNAAWLNFVVSSKARAKIRQLLKNLKRDDSVSLGRRLLNHALGGSRKLAEIPPEH
                     IQRELDRMKLTSLDDLLAEIGLGNAMSVVVAKNLQQGEAIPSAPGASGHAHLPIKGAD
                     GVLITFAKCCRPIPGDPIIAHVSPGKGLVIHHESCRNIRGYQKEAEKFMAVEWDKETA
                     QEFITEIKVDMFNHQGALANLTAAINTASSNIQSLNTEEKDGRVYSAFIRLTARDRVH
                     LANIMRKIRVMPDVIKVTRNRN"
     misc_feature    complement(111961..114072)
                     /locus_tag="ECL_00111"
                     /note="bifunctional (p)ppGpp synthetase II/
                     guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase;
                     Provisional; Region: PRK11092"
                     /db_xref="CDD:236843"
     gene            complement(114092..114367)
                     /locus_tag="ECL_00112"
                     /db_xref="GeneID:9122623"
     CDS             complement(114092..114367)
                     /locus_tag="ECL_00112"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit omega"
                     /protein_id="YP_003610629.1"
                     /db_xref="GeneID:9122623"
                     /translation="MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEEND
                     KTTVIALREIEEGLINNQILDVRERQEQQEQEAAELQAVTAIAEGRR"
     misc_feature    complement(114188..114367)
                     /locus_tag="ECL_00112"
                     /note="DNA-directed RNA polymerase, omega subunit; Region:
                     rpoZ; TIGR00690"
                     /db_xref="CDD:188073"
     gene            complement(114422..115045)
                     /locus_tag="ECL_00113"
                     /db_xref="GeneID:9122624"
     CDS             complement(114422..115045)
                     /locus_tag="ECL_00113"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate kinase"
                     /protein_id="YP_003610630.1"
                     /db_xref="GeneID:9122624"
                     /translation="MAQGTLYIVSAPSGAGKSSLIQALLKTQPLYDTQVSVSHTTRKP
                     RPGEVHGEHYFFVDHDEFKAMIGRDAFLEHAEVFGNYYGTSRETIEQVLATGVNVFLD
                     IDWQGAQQIRKKMPDSRSIFILPPSKDELDRRLRGRGQDSEEVIAKRMEQAVAEMSHY
                     AEYDYLIVNDDFDAALSDLKTILRAERLRMSRQKQRHDALITKLLAD"
     misc_feature    complement(114428..115045)
                     /locus_tag="ECL_00113"
                     /note="guanylate kinase; Provisional; Region: gmk;
                     PRK00300"
                     /db_xref="CDD:234719"
     misc_feature    complement(order(114800..114802,114815..114817,
                     114884..114886,114911..114913,114920..114922,
                     114941..114943,114995..114997,115013..115015))
                     /locus_tag="ECL_00113"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238026"
     misc_feature    complement(order(114995..114997,115013..115015))
                     /locus_tag="ECL_00113"
                     /note="G-X2-G-X-G-K; other site"
                     /db_xref="CDD:238026"
     gene            115160..115294
                     /locus_tag="ECL_00114"
                     /db_xref="GeneID:9122625"
     CDS             115160..115294
                     /locus_tag="ECL_00114"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610631.1"
                     /db_xref="GeneID:9122625"
                     /translation="MSFSGFTCVLQQHKFTLDSASQSAMLPLAWFSSPGYTSSNVKEG
                     "
     gene            115297..116967
                     /gene="ligB"
                     /locus_tag="ECL_00115"
                     /db_xref="GeneID:9122626"
     CDS             115297..116967
                     /gene="ligB"
                     /locus_tag="ECL_00115"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent DNA ligase"
                     /protein_id="YP_003610632.1"
                     /db_xref="GeneID:9122626"
                     /translation="MWRWISGFMLLWCGSAAAVCPVWSQARAEKEIATLSAQIKRWDD
                     AYWQQGISEVNDEVYDQLNGRLKQWQHCFGHASPDAALPALTGRIKHPVAHTGVHKVS
                     SKEELGQWMHARRNLWMQPKVDGVAVTLVYRGGTLAQAISRGDGLKGEDWTSQVRLIP
                     SVPQHLYGALANSVLQGELFWQRENHIQQQMGGMNARAKVAGAMMRQQDNAFLREVGV
                     FIWAWPDGPKEMKTALAELSDAGFTLTARYTLPVEHIEAVEKQRSAWHTAALPFATDG
                     IVVRSADELPGENWLPGEGSWVVAWKYPPVAQVAEVRDIHFTVGRTGKIAVVAGLEPV
                     RLDDKQVQRVSLGSVGRWQRLDIAPGDQIQVSLAGQGIPRFDKVVWRGTDRQKPEPPV
                     PQYHSLSCFYASPECMEQFFARLTWLSSKQGLDIAGLGESGWRALWQAHRFEHIFSWL
                     LLTQAQLQTTPGFSAARGLALWHQFNLVRERPFIRWIMAMGVPLAQATLKAAGELSWQ
                     TMHQRSAMDWQTLPGTGEEKARQIVNWLHAPEVDVLAKWLAEQHIKGF"
     misc_feature    115297..116964
                     /gene="ligB"
                     /locus_tag="ECL_00115"
                     /note="NAD-dependent DNA ligase LigB; Reviewed; Region:
                     ligB; PRK08097"
                     /db_xref="CDD:236150"
     misc_feature    order(115588..115590,115654..115656,115660..115662,
                     115723..115725,115828..115830,115957..115959,
                     116128..116130,116134..116136)
                     /gene="ligB"
                     /locus_tag="ECL_00115"
                     /note="nucleotide binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238062"
     misc_feature    order(115660..115662,115666..115671)
                     /gene="ligB"
                     /locus_tag="ECL_00115"
                     /note="K-X-D-G motif; other site"
                     /db_xref="CDD:238062"
     misc_feature    115660..115662
                     /gene="ligB"
                     /locus_tag="ECL_00115"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238062"
     gene            complement(116970..117587)
                     /locus_tag="ECL_00116"
                     /db_xref="GeneID:9122627"
     CDS             complement(116970..117587)
                     /locus_tag="ECL_00116"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610633.1"
                     /db_xref="GeneID:9122627"
                     /translation="MLLHTLYLIGITAEAMTGALAAGRRRMDTFGVIIIATATALGGG
                     SVRDILLGHYPLGWVKNPEYVIIVATAAVVTTIVAPVMTHLRRLFLVLDALGLIVFSI
                     IGAQIALDMGEGPVIATIAAVVTGVFGGVLRDMFCKRIPLVFQKELYAGISFAAAVLY
                     IALQHYVSNHDVVVISTLLFGFTARMLALRLKLGLPVFHYKHSAH"
     misc_feature    complement(116973..117587)
                     /locus_tag="ECL_00116"
                     /note="Uncharacterized membrane protein YeiH [Function
                     unknown]; Region: YadS; COG2860"
                     /db_xref="CDD:225415"
     gene            complement(117793..118656)
                     /locus_tag="ECL_00117"
                     /db_xref="GeneID:9122628"
     CDS             complement(117793..118656)
                     /locus_tag="ECL_00117"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610634.1"
                     /db_xref="GeneID:9122628"
                     /translation="MIRSMTAYARREIKGSWGSATWEMRSVNQRYLETYFRMPEQFRS
                     LEPVVRERIRTRLTRGKVECNLRFEPDASAQGELILNEKLAKQLVNAANWVKMQSDEG
                     EINPVDILRWPGVMAAGEQDLDAIAAEILAALDSTLDDFIVARETEGQALKAMIEQRL
                     EGVSAEVAKVRTHMPEVLQWQRERLVAKLEEAEVQLENNRLEQELVLMAQRVDVAEEL
                     DRLEAHVKETYNILKKKEAVGRRLDFMMQEFNRESNTLASKSINADVTNSAIELKVLI
                     EQMREQIQNIE"
     misc_feature    complement(117796..118656)
                     /locus_tag="ECL_00117"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11820"
                     /db_xref="CDD:236993"
     gene            118782..119498
                     /locus_tag="ECL_00118"
                     /db_xref="GeneID:9122629"
     CDS             118782..119498
                     /locus_tag="ECL_00118"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease PH"
                     /protein_id="YP_003610635.1"
                     /db_xref="GeneID:9122629"
                     /translation="MRPAGRSANQVRPVTLTRNYTKHAEGSVLVEFGDTKVLCTASIE
                     EGVPRFLKGQGQGWITAEYGMLPRATHTRNAREAAKGKQGGRTMEIQRLIARALRAAV
                     DLKTLGEFTITLDCDVIQADGGTRTASITGACVALADALNKLVAAGKLKTNPMKGMVA
                     AVSVGIVNGEALCDLEYVEDSAAETDMNVVMTEDGRIIEVQGTAEGEPFTHEELLTLL
                     ALARGGIESIVTTQKAALEN"
     misc_feature    118782..119492
                     /locus_tag="ECL_00118"
                     /note="ribonuclease PH; Reviewed; Region: rph; PRK00173"
                     /db_xref="CDD:178914"
     misc_feature    order(118839..118853,118881..118883,118887..118889,
                     118893..118895,118899..118901,118905..118907,
                     118965..118967,118971..118973,118977..118994,
                     118998..119000,119007..119012,119034..119039,
                     119043..119048,119055..119057,119067..119069,
                     119076..119078,119118..119120,119124..119126,
                     119130..119132,119136..119144,119367..119381,
                     119385..119387,119391..119408,119412..119414,
                     119421..119426,119433..119438,119445..119447)
                     /locus_tag="ECL_00118"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:206767"
     misc_feature    order(118974..118976,119037..119039,119142..119159,
                     119319..119321,119337..119339)
                     /locus_tag="ECL_00118"
                     /note="active site"
                     /db_xref="CDD:206767"
     gene            119566..120207
                     /locus_tag="ECL_00119"
                     /db_xref="GeneID:9122630"
     CDS             119566..120207
                     /locus_tag="ECL_00119"
                     /codon_start=1
                     /transl_table=11
                     /product="orotate phosphoribosyltransferase"
                     /protein_id="YP_003610636.1"
                     /db_xref="GeneID:9122630"
                     /translation="MKPYQRQFIEFALNKQVLKFGEFTLKSGRKSPYFFNAGLFNTGR
                     DLALLGRFYAEALVDSGIDFDLLFGPAYKGIPIATTTAVALAEHHDRDVPYCFNRKEA
                     KTHGEGGNLVGSPLQGRVMLVDDVITAGTAIRESMEIIQANGATLAGVLISLDRQERG
                     RGEISAIQEVERDYSCKVTSIINLKDLIAYLEEKPEMADHLAAVRAYREEFGV"
     misc_feature    119566..120204
                     /locus_tag="ECL_00119"
                     /note="orotate phosphoribosyltransferase; Validated;
                     Region: pyrE; PRK00455"
                     /db_xref="CDD:234771"
     misc_feature    order(119776..119778,119782..119784,119935..119943,
                     119947..119961,120031..120033)
                     /locus_tag="ECL_00119"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(120291..120887)
                     /locus_tag="ECL_00120"
                     /db_xref="GeneID:9122631"
     CDS             complement(120291..120887)
                     /locus_tag="ECL_00120"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610637.1"
                     /db_xref="GeneID:9122631"
                     /translation="MAEKQTAKRNRREEILQSLALMLESSDGSQRITTAKLAASVGVS
                     EAALYRHFPSKTRMFDSLIEFIEDSLITRINLILKDEKDTTARLRLIVQLILGFGERN
                     PGLTRILTGHALMFEQDRLQGRINQLFERIEAQLRQVLREKKMREGEGYSTDETLLAS
                     QILAFCEGMLSRFVRSEFKYSPTDDFDARWPLVAAQLQ"
     misc_feature    complement(120303..120887)
                     /locus_tag="ECL_00120"
                     /note="division inhibitor protein; Provisional; Region:
                     slmA; PRK09480"
                     /db_xref="CDD:181894"
     gene            complement(121008..121463)
                     /locus_tag="ECL_00121"
                     /db_xref="GeneID:9122632"
     CDS             complement(121008..121463)
                     /locus_tag="ECL_00121"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyuridine 5'-triphosphate
                     nucleotidohydrolase"
                     /protein_id="YP_003610638.1"
                     /db_xref="GeneID:9122632"
                     /translation="MKKIDVKILDPRVGEQFPLPTYATSGSAGLDLRACLDDAVELAP
                     GATTLIPTGLAIHIADPSLAAVILPRSGLGHKHGVVLGNLVGLIDSDYQGQLMVSVWN
                     RGQDSFTIEPGERIAQMVFVPVVQAEFNLVADFDATDRGEGGFGHSGRK"
     misc_feature    complement(121011..121463)
                     /locus_tag="ECL_00121"
                     /note="deoxyuridine 5'-triphosphate nucleotidohydrolase;
                     Provisional; Region: dut; PRK00601"
                     /db_xref="CDD:234802"
     misc_feature    complement(order(121110..121112,121122..121124,
                     121131..121145,121155..121157,121161..121163,
                     121167..121169,121173..121175,121194..121196,
                     121203..121205,121221..121229,121245..121262,
                     121266..121268,121317..121319,121323..121328,
                     121341..121343,121377..121382))
                     /locus_tag="ECL_00121"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143638"
     misc_feature    complement(order(121173..121178,121188..121190,
                     121197..121205,121248..121256))
                     /locus_tag="ECL_00121"
                     /note="active site"
                     /db_xref="CDD:143638"
     gene            complement(121444..122658)
                     /locus_tag="ECL_00122"
                     /db_xref="GeneID:9122633"
     CDS             complement(121444..122658)
                     /locus_tag="ECL_00122"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase"
                     /protein_id="YP_003610639.1"
                     /db_xref="GeneID:9122633"
                     /translation="MMSLAGKKIVLGVSGGIAAYKTPELVRRLRERGADVRVAITEGG
                     KAFITPLSLQAVSGYPVSDSLLDPAAEAAMGHIELGKWADLVILAPATADLIARVAAG
                     MANDLVSTICLATPAPVAVVPAMNQQMYRNAATQHNLQTLTSRGLLIWGPDSGSQACG
                     DVGPGRMLDPLTIVDMAAAHFSPVNDLQHLNIMITAGPTREPLDPVRYITNHSSGKMG
                     FAIAAAAAKRGANVTLVSGPVSLPTPPFVQRIDVTTALEMEAAVQARAQNQQIFIGCA
                     AVADYRAETISDAKIKKQGDELTLKMVKNPDIVAGVAALKTHRPYVVGFAAETNNVEE
                     YARQKRTRKNLDLICANDVSLATQGFNSDSNALHLFWQDGDKILPLERKELLGQQLLD
                     EIVTRYDEKNRR"
     misc_feature    complement(121459..122658)
                     /locus_tag="ECL_00122"
                     /note="bifunctional phosphopantothenoylcysteine
                     decarboxylase/phosphopantothenate synthase; Validated;
                     Region: PRK05579"
                     /db_xref="CDD:235513"
     gene            122828..123496
                     /gene="radC"
                     /locus_tag="ECL_00123"
                     /db_xref="GeneID:9122634"
     CDS             122828..123496
                     /gene="radC"
                     /locus_tag="ECL_00123"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadC"
                     /protein_id="YP_003610640.1"
                     /db_xref="GeneID:9122634"
                     /translation="MEDEDELLLPREKLLRYGVTLLKDEELLALFLRTGTPGKTVFTL
                     AKDLIGHFGSLYGLMTAELAEFAHVEGIGVAKYAQLKGIAELARRFQCVRMQEEDPIL
                     TPAMTREFLQSQLTDIEREIFMVIFLDNRNRVLKHSHLFSGTLSHVEVHPREIVREAI
                     KLNAAGVILAHNHPSGCAEPSRADKEITDRIVKCCQFMDIRVLDHLIIGRGEYLSFAE
                     HGWI"
     misc_feature    122828..123493
                     /gene="radC"
                     /locus_tag="ECL_00123"
                     /note="hypothetical protein; Reviewed; Region: PRK00024"
                     /db_xref="CDD:178801"
     gene            123750..123950
                     /locus_tag="ECL_00124"
                     /db_xref="GeneID:9122635"
     CDS             123750..123950
                     /locus_tag="ECL_00124"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L28"
                     /protein_id="YP_003610641.1"
                     /db_xref="GeneID:9122635"
                     /translation="MTGNNRSHALNATKRRFLPNLHSHRFWVESEKRFVTLRVSAKGM
                     RVIDKKGIDTVLSELRARGEKY"
     misc_feature    123750..123941
                     /locus_tag="ECL_00124"
                     /note="50S ribosomal protein L28; Reviewed; Region: rpmB;
                     PRK00359"
                     /db_xref="CDD:234736"
     gene            123973..124140
                     /locus_tag="ECL_00125"
                     /db_xref="GeneID:9122636"
     CDS             123973..124140
                     /locus_tag="ECL_00125"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L33"
                     /protein_id="YP_003610642.1"
                     /db_xref="GeneID:9122636"
                     /translation="MAKGIREKIKLVSSAGTGHFYTTTKNKRTKPEKLELKKFDPVVR
                     QHVMYKEAKIK"
     misc_feature    123973..124131
                     /locus_tag="ECL_00125"
                     /note="50S ribosomal protein L33; Validated; Region: rpmG;
                     PRK00595"
                     /db_xref="CDD:179075"
     gene            124215..125024
                     /locus_tag="ECL_00126"
                     /db_xref="GeneID:9122637"
     CDS             124215..125024
                     /locus_tag="ECL_00126"
                     /codon_start=1
                     /transl_table=11
                     /product="formamidopyrimidine-DNA glycosylase"
                     /protein_id="YP_003610643.1"
                     /db_xref="GeneID:9122637"
                     /translation="MPELPEVETSRRGIEPHLVGATILHATVRNGRLRWPVSDEIHAL
                     SDKPILSVQRRAKYLLLELPDGWIIIHLGMSGSLRILTEELPAEKHDHVDLVMSNGKV
                     LRYTDPRRFGAWLWTKELEGHSVLAHLGPEPLSEAFNAEYLKAKCAKKKTPIKPWLMD
                     NKLVVGVGNIYASESLFAAGIHPDRLASSLSAQECELLVRVIKAVLLRSIEQGGTTLK
                     DFLQSDGKPGYFAQELQVYGRKGEPCRVCGTPIIATKHAQRATFYCRQCQK"
     misc_feature    124215..125021
                     /locus_tag="ECL_00126"
                     /note="formamidopyrimidine/5-formyluracil/
                     5-hydroxymethyluracil DNA glycosylase; Validated; Region:
                     PRK01103"
                     /db_xref="CDD:234899"
     gene            complement(125027..125506)
                     /locus_tag="ECL_00127"
                     /db_xref="GeneID:9122638"
     CDS             complement(125027..125506)
                     /locus_tag="ECL_00127"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopantetheine adenylyltransferase"
                     /protein_id="YP_003610644.1"
                     /db_xref="GeneID:9122638"
                     /translation="MSTKAIYPGTFDPITNGHLDIITRAACMFDKVILAIAASPSKKP
                     MFDLNERVALATEAIAHLPNVEVVGFSDLMANFARAQQATILIRGLRAVADFEYEMQL
                     AHMNRHLMPELESVFLMPSKEWSFISSTLVKEVARHHGDVTHFLPVNVHQALMDKLK"
     misc_feature    complement(125030..125500)
                     /locus_tag="ECL_00127"
                     /note="phosphopantetheine adenylyltransferase;
                     Provisional; Region: coaD; PRK00168"
                     /db_xref="CDD:234674"
     misc_feature    complement(order(125126..125128,125135..125137,
                     125147..125149,125189..125191,125201..125203,
                     125210..125215,125234..125236,125240..125245,
                     125285..125293,125381..125383,125396..125398,
                     125444..125446,125453..125458,125474..125488))
                     /locus_tag="ECL_00127"
                     /note="active site"
                     /db_xref="CDD:173914"
     misc_feature    complement(125453..125464)
                     /locus_tag="ECL_00127"
                     /note="(T/H)XGH motif; other site"
                     /db_xref="CDD:173914"
     gene            complement(125510..126280)
                     /locus_tag="ECL_00128"
                     /db_xref="GeneID:9122639"
     CDS             complement(125510..126280)
                     /locus_tag="ECL_00128"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_003610645.1"
                     /db_xref="GeneID:9122639"
                     /translation="MSTRLSVVLIAKNAADLTPDCLASVAWADEIILLDSGSEDNTAD
                     VARAAGAKVYTNTDWQGYGIQRQRAQGYATGDYVLMLDTDERITPELRQAIQAVLAAP
                     TPGTVYSIARRNYFLGRFMRHSGWYPDRVTRLYERERYQYNDNLVHESLACDSAPVVP
                     LTGDLLHLTCRDFASFQRKQLNYATAWAQERHQRGKKATLTGIFTHTLGAFLKTLLLR
                     GGVLDGKQGWLLAVVNAQYTFNKYTELWALSRGYSEKT"
     misc_feature    complement(125588..126271)
                     /locus_tag="ECL_00128"
                     /note="UDP-glucose LOS-beta-1,4 glucosyltransferase is
                     required for biosynthesis of lipooligosaccharide; Region:
                     Beta4Glucosyltransferase; cd02511"
                     /db_xref="CDD:133005"
     misc_feature    complement(order(126029..126031,126035..126037))
                     /locus_tag="ECL_00128"
                     /note="putative metal binding site; other site"
                     /db_xref="CDD:133005"
     gene            complement(126280..127554)
                     /locus_tag="ECL_00129"
                     /db_xref="GeneID:9122640"
     CDS             complement(126280..127554)
                     /locus_tag="ECL_00129"
                     /codon_start=1
                     /transl_table=11
                     /product="3-deoxy-D-manno-octulosonic acid transferase"
                     /protein_id="YP_003610646.1"
                     /db_xref="GeneID:9122640"
                     /translation="MELLYTALLYIIQPLVWLRLLLRSRKAPAYRKRWAERYGFCRNK
                     VAPDGILLHSVSVGETLAAIPLVRALRHRYPSLPITVTTMTPTGSERVMSAFGKDVHH
                     VYLPYDLPCAMNRFLETVRPKLVIVMETELWPNMISALHARKIPLVIANARLSERSAK
                     GYGKLGKFMRRLLSKITLIAAQNEEDAARFISLGLKRNQLAVTGSLKFDISVTPELAA
                     RAITLRRQWAPRRQVWIATSTHDGEEAIILQAHRKLLEKFPDLLLILVPRHPERFKDA
                     REMVQKGGFSFTLRSSGEIPSTSTQVVIGDTMGELMLLYGIADLAFVGGSLVERGGHN
                     PLEPAAHAIPVLMGPHTFNFKDICAKLQQAEGLITVTDADSVVKEVSTLLTDEDYRLW
                     YGRHAVEVLHQNQGALTRLLQLLQPYLPQRSH"
     misc_feature    complement(126325..127554)
                     /locus_tag="ECL_00129"
                     /note="3-deoxy-D-manno-octulosonic-acid transferase;
                     Reviewed; Region: PRK05749"
                     /db_xref="CDD:235589"
     gene            complement(127621..128610)
                     /locus_tag="ECL_00130"
                     /db_xref="GeneID:9122641"
     CDS             complement(127621..128610)
                     /locus_tag="ECL_00130"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_003610647.1"
                     /db_xref="GeneID:9122641"
                     /translation="MQNSAPLLSVVVAVYNGEAFLDQFFTCLVDQRIDSMEVIIVNDG
                     STDRSMQIVENWREKLPQMQVIEQQNQGVSIARNTGLAVATGQYLSFPDIDDVFKPGM
                     YQHLLDMAVTQRLDVATCNGNYVWENNKKPSRPIFPEDKLASTGVMSGPAWLKMALDS
                     RKFLHVTWLNIYRHDFIREHGFHFEPGLRHQDIPWTTEVLLAAERVQYTSERYYDYYI
                     HSASVSHMPDNDDTLIRSARHYMKILQMLDAINQRYPDKVKGIPACHWQIAKEGLGII
                     HTFDNMKDEQKKAFIIKEFFDKGIWKLIWKNAKSPRLRWRLGRRYFRLKRYVA"
     misc_feature    complement(127624..128610)
                     /locus_tag="ECL_00130"
                     /note="putative glycosyl transferase; Provisional; Region:
                     PRK10073"
                     /db_xref="CDD:182223"
     gene            complement(128622..129710)
                     /locus_tag="ECL_00131"
                     /db_xref="GeneID:9122642"
     CDS             complement(128622..129710)
                     /locus_tag="ECL_00131"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipopolysaccharide glycosyltransferase"
                     /protein_id="YP_003610648.1"
                     /db_xref="GeneID:9122642"
                     /translation="MIIDGLPGGGAEKTVLTLSSGLTEMGHQVSLFSLRKVCDYAIPE
                     GIDYQVVQDTCKKPWRKLTEIPRRARLLDQAIERAERSGKFDVVFSHLHKTDRIVAHC
                     RALERDKVWFCVHGMFSFSYLRHRRGLSRWFKHTKIRHTYEKRNVVAVSGAVLKDLSE
                     TLALNLRRTAVIHNPFDIPEIQRLADAPFEMQGKDYIIHVGRFHEHKRHDRLLRAFAL
                     SQLNTTLVMMGNGSEAKIQKLKLLARELGIEDKTVFRPFEPNPYPWIKGARLLVLSSD
                     CEGFGNVLVESIICQTPPVSTHCPGGPAEILKGDLSRGLAEMNDESLAKTLADIYTSP
                     PVVDRATIASFGIKAICQQYIALVDNQK"
     misc_feature    complement(128643..129707)
                     /locus_tag="ECL_00131"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. WabH in Klebsiella
                     pneumoniae has been shown to transfer a GlcNAc residue
                     from UDP-GlcNAc onto the acceptor GalUA residue in the
                     cellular outer core; Region: GT1_WabH_like; cd03811"
                     /db_xref="CDD:99982"
     misc_feature    complement(order(128862..128864,128928..128930,
                     129105..129113,129681..129683))
                     /locus_tag="ECL_00131"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99982"
     gene            complement(129725..130852)
                     /locus_tag="ECL_00132"
                     /db_xref="GeneID:9122643"
     CDS             complement(129725..130852)
                     /locus_tag="ECL_00132"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyltransferase family 1 protein"
                     /protein_id="YP_003610649.1"
                     /db_xref="GeneID:9122643"
                     /translation="MKHHRLAIVRQKYRPDGGAERFVSRALTALSNQNLELNVITREW
                     QGEKQDDWHIHICDPRKWGRISRERGFAHAARALWQQQQFDIVQSHERIPGCDIYRAG
                     DGVHRRWLLQRARILPAWRAKLLMHDRYHRYVMNAEREMYQAPELKAVICNAEMIKRE
                     IVEDFDIDAKKIHVIYNSIDSTRFVPAEEAQRIALRQQFGLPTDAVIFCFVGSGFERK
                     GLASAIRAVAGTAAWLIVVGQDKAERRYRDLARSLGCEGQIRFLGMQKETLPFYQLSD
                     GLLLPTLYDPFPNVILEAMACGLPVITSESCGGAEFIQQGQNGFYCDALDISTLKEAV
                     AATPSLEKNNDMGRAARERVKDATPEKLSSQLISLYQKLLD"
     misc_feature    complement(129740..130840)
                     /locus_tag="ECL_00132"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases and named after YqgM in
                     Bacillus licheniformis about which little is known.
                     Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to...; Region:
                     GT1_YqgM_like; cd03801"
                     /db_xref="CDD:99974"
     gene            complement(130849..131919)
                     /locus_tag="ECL_00133"
                     /db_xref="GeneID:9122644"
     CDS             complement(130849..131919)
                     /locus_tag="ECL_00133"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipopolysaccharide heptosyltransferase
                     III"
                     /protein_id="YP_003610650.1"
                     /db_xref="GeneID:9122644"
                     /translation="MMMNNLPDTPDLRILLIKLRHHGDMLLTTPVIDSLRQKWPQAQI
                     DVLLYEETRDMLAAHPAIGTVYGIDRKWKQLGTLKHLQKEWQLLCALRKQHYHLVINL
                     ADQWRSAIVTRFTGAPVRLGFAFNKRNNAFWRFCHSDLVSVAGHNALHTVEQNLSILS
                     PLPVTAQPAVTMAYHAEDWHEAHQKLMQNGVGDNYIVIQPTSRWFFKCWDEGKMAQTI
                     TALQQDGHTVVLTAGPDKKELAMIDRILAASPETGVVSLAGQLTLRQLASLIDHASLF
                     IGVDSVPMHMAAALQTPCVALFGPSKLTFWSPWQVNGEVIWAGDYGPLPDPDAIDTKT
                     KERYLDAIPVDAVVSAARRYLS"
     misc_feature    complement(130852..131883)
                     /locus_tag="ECL_00133"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:324558"
     misc_feature    complement(order(131062..131064,131071..131076,
                     131083..131085,131119..131124,131227..131229,
                     131323..131328))
                     /locus_tag="ECL_00133"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            132070..133026
                     /locus_tag="ECL_00134"
                     /db_xref="GeneID:9122645"
     CDS             132070..133026
                     /locus_tag="ECL_00134"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein WalW"
                     /protein_id="YP_003610651.1"
                     /db_xref="GeneID:9122645"
                     /translation="MKKPAFIITIDTEGDNLWQNHRVIKTENARYLARFQTLCERFGF
                     KPVWLTNYEMAIEPVFIEFAKDVIARGQGEVGMHLHAWNSPPEHDLTGDDWRWQPYLI
                     EFSDEVMREKVLFMTRLLEETFQTKMLSHRAGRWAFDSRYARLLIELGYQVDCSVTPR
                     VNWRNAKGAPQGNGGTNYQHFPDHAYFIDTDDISRAGNSPLLEVPMSIQYKHPAWLNT
                     VKQGYDRLRGKYRSPSVNWLRPSGGNASQMIQVAQQCLSQGHDYVEFMLHSSEFMPGG
                     SPTFKDEAAIEGLYQDLEVLFSWLSDKTVGMTLAEFYQYKKN"
     misc_feature    132082..132969
                     /locus_tag="ECL_00134"
                     /note="Putative catalytic domain of lipopolysaccharide
                     biosynthesis protein WalW and its bacterial homologs;
                     Region: CE4_WalW; cd10935"
                     /db_xref="CDD:200561"
     misc_feature    order(132100..132105,132301..132303,132469..132477,
                     132871..132873)
                     /locus_tag="ECL_00134"
                     /note="putative active site [active]"
                     /db_xref="CDD:200561"
     misc_feature    order(132100..132102,132871..132873)
                     /locus_tag="ECL_00134"
                     /note="putative catalytic site [active]"
                     /db_xref="CDD:200561"
     gene            complement(133050..134261)
                     /locus_tag="ECL_00135"
                     /db_xref="GeneID:9122646"
     CDS             complement(133050..134261)
                     /locus_tag="ECL_00135"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610652.1"
                     /db_xref="GeneID:9122646"
                     /translation="MEKVKLRLYQLTLTLSLVSLALVLVSSGKQREFFYIAIYASILG
                     LAVEYKKITWRPFSIAYPVLLVGILNLIWYFSYEFHNEGLNAYSDYLGASKKLILASF
                     LIFYLDRFKSHVTKQNFQKYFLIATSVGFVLATGYGLFQAIQGIDRVEMAINRPTIAA
                     YIYSVLSLAFVYSLYLQQNVKLYLLAGFVVLLSYFVILLTATRAAMGLYLILAIVLTL
                     YQFRKIHLKSLMIFLCIVAGIIIVSYKPLISPKIQQTQNEITKYQKGHDATSLGARFS
                     MWNVGIMTGLAHPLGQSIESREIWAKQYVKEGHAHVAAALGYMRIHLHNEFIEKYSLQ
                     GIPGLAVLLFFYVSMIVYAMTNRNGLLLTAMLLLLLYGLTDVMLLSSEALIFFMTLFA
                     LSTSFSQTKRQ"
     misc_feature    complement(133083..134165)
                     /locus_tag="ECL_00135"
                     /note="O-antigen ligase [Cell wall/membrane/envelope
                     biogenesis]; Region: RfaL; COG3307"
                     /db_xref="CDD:225844"
     gene            complement(134249..135157)
                     /locus_tag="ECL_00136"
                     /db_xref="GeneID:9122647"
     CDS             complement(134249..135157)
                     /locus_tag="ECL_00136"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610653.1"
                     /db_xref="GeneID:9122647"
                     /translation="MAFLSIIIAAHNAEDTLHTTLESLHNAIDNAGDDVEVIIFNDSS
                     DDSTQDIIETWLPAFPNVHSRHVQFRNVGLVRNSAFSLASGDYITMLDSDDRLKPGSI
                     RDAVAFLKTERPDMLLTRLLEIRDIKKITPNWQGFSPVALSQREAIKRFLLHKDFQAH
                     LIGQFIHRKLYESNPIPSMVCYEDFAVFPGMLMQSSKIAYQRRGHYYYIKRSDSLSSK
                     LDASKIKTLVECTLLMEKTFQQPFQHLINCHWFDIYSNHRQHLTDQHFQLVKQRVKAL
                     YSLSFFLSSDVRFSYKKRVIEALWKK"
     misc_feature    complement(134642..135145)
                     /locus_tag="ECL_00136"
                     /note="Glycosyl transferase family 2; Region:
                     Glycos_transf_2; pfam00535"
                     /db_xref="CDD:278936"
     misc_feature    complement(order(134876..134878,134882..134884,
                     135038..135040,135125..135127,135131..135133))
                     /locus_tag="ECL_00136"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            complement(135163..136272)
                     /locus_tag="ECL_00137"
                     /db_xref="GeneID:9122648"
     CDS             complement(135163..136272)
                     /locus_tag="ECL_00137"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610654.1"
                     /db_xref="GeneID:9122648"
                     /translation="MSYVFLLILLLPVKLIRKLFRKDTGKNLVIQTAKIGDFVNATPL
                     LAYLQKSDVLISRSVGALAKHDETIEEIFFIEQHKRSLWRKLSFACRIMNRYDNVYLL
                     QPNSVNLFFAAVCNAKNKQFLSIYTRRWYHGIFYLTADGTVEHGKKTLSVTNYLKLAD
                     RSLTWQDSPKHATKPLFKPATYPAILDKPDVIRIGISIAAGNKAKTVPPVIWKRIIDR
                     LADLPCEFYVFGAPDEQSWLDDITRAYGDIPNVVNLIGKIPLEDLPWAISRMDCYIAS
                     DSGNVYIADAVDVPVVLLFGPCCHYEQRPLGNVMLIGNDDNICSYVFETKYYFSQDRE
                     ELFAVTDESLNELERFICALPKATATPYTFDALGN"
     misc_feature    complement(135349..136191)
                     /locus_tag="ECL_00137"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:324558"
     gene            complement(136276..137259)
                     /locus_tag="ECL_00138"
                     /db_xref="GeneID:9122649"
     CDS             complement(136276..137259)
                     /locus_tag="ECL_00138"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose--LPS heptosyltransferase"
                     /protein_id="YP_003610655.1"
                     /db_xref="GeneID:9122649"
                     /translation="MRVLIVKTSSMGDVLHTLPSLTDAMRAIPGIRFDWVVEEGFAQI
                     PTWHEAVDRVIPVAIRRWRKAWFSTPIKAERKAFRDAVQAQRYDSIIDAQGLVKSAAL
                     VTRLAHGVKHGMDWQTAREPLASLFYNRRHHIAKQQHAVERTRELFAKSLGYTKPETQ
                     GDYAISQHFLRDAEKPAQPWLVFLHATTRDDKHWPETHWRRLIELMQPAGIHIKLPWG
                     AEHERQRAERLAAGFSHVEVLPKLTLAQVAAELAGAKAVVSVDTGLSHLTAALDRPNI
                     TIFGPTDPGLIGGYGKNQHQMVSPTQQTRDISADAIFSFLQDSHWLSDRDI"
     misc_feature    complement(136294..137259)
                     /locus_tag="ECL_00138"
                     /note="ADP-heptose:LPS heptosyl transferase I;
                     Provisional; Region: PRK10964"
                     /db_xref="CDD:236809"
     misc_feature    complement(order(136459..136461,136468..136473,
                     136480..136482,136516..136521,136612..136614,
                     136708..136713))
                     /locus_tag="ECL_00138"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            complement(137263..138309)
                     /locus_tag="ECL_00139"
                     /db_xref="GeneID:9122650"
     CDS             complement(137263..138309)
                     /locus_tag="ECL_00139"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-heptose--LPS heptosyltransferase"
                     /protein_id="YP_003610656.1"
                     /db_xref="GeneID:9122650"
                     /translation="MRILVIGPSWVGDMMMSQSLYRTLKARYPQAIIDVMAPAWCRPL
                     LSRMPEVNEAIPMPLGHGALEIGERRKLGHSLREKRYDRAYVLPNSFKSALVPFFAGV
                     PHRTGWRGEMRYGLLNDARVLDKEAWPLMVERYVALAYDKGVMRSAKDLPQPLLWPQL
                     QVSEGEKSQTCNAFGLSSERPMIGFCPGAEFGPAKRWPHYHYAELAKQLIDEGYQIVL
                     FGSAKDHEAGNEILAALSTEQQAWCRNLAGETQLEQAVILLAACKAVVTNDSGLMHVA
                     AALNRPLVALYGPSSPDFTPPLSNKARVIRLITGYHKVRKGDAAQGYHQSLIDITPQR
                     VLEELNELLLSEEG"
     misc_feature    complement(137305..138309)
                     /locus_tag="ECL_00139"
                     /note="ADP-heptose:LPS heptosyltransferase II;
                     Provisional; Region: PRK10916"
                     /db_xref="CDD:182835"
     misc_feature    complement(order(137485..137487,137494..137499,
                     137506..137508,137542..137547,137653..137655,
                     137752..137757))
                     /locus_tag="ECL_00139"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            complement(138312..139244)
                     /locus_tag="ECL_00140"
                     /db_xref="GeneID:9122651"
     CDS             complement(138312..139244)
                     /locus_tag="ECL_00140"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-glyceromanno-heptose 6-epimerase"
                     /protein_id="YP_003610657.1"
                     /db_xref="GeneID:9122651"
                     /translation="MIIVTGGAGFIGSNIVKALNDKGITDILVVDNLKDGTKFVNLVD
                     LNIADYMDKEDFLIQIMAGEEFGEIEAIFHEGACSSTTEWDGKYMMDNNYQYSKELLH
                     YCLEREIPFLYASSAATYGGRTSDFIESREYEQPLNVYGYSKFLFDEYVRQVLPEANS
                     QIVGFRYFNVYGPREGHKGSMASVAFHLNTQLNNGESPKLFEGSDGFKRDFVYVGDVA
                     AVNLWFWENGVSGIFNLGTGRAESFQAVADATLAYHKKGSIEYIPFPDKLKGRYQAFT
                     QADLTNLRAAGYDKPFKTVAEGVTEYMAWLNRDA"
     misc_feature    complement(138321..139244)
                     /locus_tag="ECL_00140"
                     /note="ADP-L-glycero-D-mannoheptose-6-epimerase;
                     Provisional; Region: rfaD; PRK11150"
                     /db_xref="CDD:182998"
     misc_feature    complement(order(138711..138716,138735..138737,
                     138741..138746,138813..138815,138825..138827,
                     138897..138905,138957..138959,138969..138971,
                     138981..138983,139008..139010,139014..139022,
                     139086..139088,139131..139133,139149..139157,
                     139212..139220,139227..139232))
                     /locus_tag="ECL_00140"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187559"
     misc_feature    complement(order(138786..138788,138795..138800,
                     138807..138809,138819..138821,138828..138842,
                     138852..138854,138951..138953,138963..138965,
                     138975..138977,138984..138995,139089..139091,
                     139095..139112,139116..139121,139128..139130,
                     139134..139139,139143..139148))
                     /locus_tag="ECL_00140"
                     /note="homopentamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187559"
     misc_feature    complement(order(138516..138518,138618..138620,
                     138684..138686,138693..138695,138699..138707,
                     138738..138740,139002..139004))
                     /locus_tag="ECL_00140"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187559"
     misc_feature    complement(order(138813..138815,138825..138827,
                     138897..138899,138966..138968))
                     /locus_tag="ECL_00140"
                     /note="active site"
                     /db_xref="CDD:187559"
     gene            139460..140656
                     /locus_tag="ECL_00141"
                     /db_xref="GeneID:9122652"
     CDS             139460..140656
                     /locus_tag="ECL_00141"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-3-ketobutyrate CoA ligase"
                     /protein_id="YP_003610658.1"
                     /db_xref="GeneID:9122652"
                     /translation="MRGDFYKQLNSDLETARAEGLFKEERIITSAQQADITVADGSHV
                     INFCANNYLGLANHPELIAAAKSGMDTHGFGMASVRFICGTQDSHKQLEKKLANFLGM
                     EDAILYSSCFDANGGLFETLLGAEDAIISDALNHASIIDGVRLCKAKRFRYANNDMVE
                     LEARLKEAREAGARHVLIATDGVFSMDGVIANLKGVCDLADKYDALVMVDDSHAVGFV
                     GENGRGSHEYCDVMGRVDIITGTLGKALGGASGGYTAARKEVVEWLRQRSRPYLFSNS
                     LAPAIVAASIKVLEMVESGAELRDRLWSNARLFREKMSAAGFTLAGADHAIIPVMLGD
                     AVVAQNFARELQKEGIYVTGFFFPVVPKGQARIRTQMSAAHSPEQIERAVEAFTRIGK
                     QLGVIA"
     misc_feature    139460..140650
                     /locus_tag="ECL_00141"
                     /note="2-amino-3-ketobutyrate coenzyme A ligase;
                     Provisional; Region: PRK06939"
                     /db_xref="CDD:235893"
     misc_feature    order(139607..139609,139787..139795,139865..139867,
                     140000..140002,140012..140017,140087..140089,
                     140093..140098,140180..140182,140189..140191,
                     140561..140563)
                     /locus_tag="ECL_00141"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    order(139787..139795,139865..139867,140000..140002,
                     140012..140014,140087..140089,140093..140098,
                     140180..140182,140189..140191)
                     /locus_tag="ECL_00141"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    140189..140191
                     /locus_tag="ECL_00141"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            140666..141694
                     /locus_tag="ECL_00142"
                     /db_xref="GeneID:9122653"
     CDS             140666..141694
                     /locus_tag="ECL_00142"
                     /codon_start=1
                     /transl_table=11
                     /product="L-threonine 3-dehydrogenase"
                     /protein_id="YP_003610659.1"
                     /db_xref="GeneID:9122653"
                     /translation="MKALSKLKAEEGIWMTDVPEPEVGHNDLLIKIRKTAICGTDVHI
                     YNWDQWSQKTIPVPMVVGHEYVGEVVGIGQEVKGFNIGDRVSGEGHITCGHCRNCRGG
                     RTHLCRNTIGVGVNRPGCFAEYLVIPAFNAFKIPDNISDDLASIFDPFGNAVHTALSF
                     DLVGEDVLVSGAGPIGIMAAAVAKHVGARNVVITDVNEYRLSLARKMGVTRAVDVSKE
                     SLADVMEELGMTEGFDVGLEMSGAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWNKV
                     IFKGLFIKGIYGREMFETWYKMAALIQSGLDLSPIITHRFSVDDFQKGFDAMRSGQSG
                     KVILSWDK"
     misc_feature    140666..141688
                     /locus_tag="ECL_00142"
                     /note="L-threonine 3-dehydrogenase; Validated; Region:
                     tdh; PRK05396"
                     /db_xref="CDD:180054"
     gene            complement(141723..142382)
                     /locus_tag="ECL_00143"
                     /db_xref="GeneID:9122654"
     CDS             complement(141723..142382)
                     /locus_tag="ECL_00143"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610660.1"
                     /db_xref="GeneID:9122654"
                     /translation="MTLSLPVREENYRYKQIYLSRLMKLNAPLQARGEGVLMIDSDLN
                     LLKMPEIKIADMHLYSSFRQGKMIAKLDGAPVEKVPAYYKDMVRPYLVDHVNSAFLAA
                     TKKTWRRICPLWLALFQDTWELMDDSQPPTDQLPLTALLDMLDLKTVNLGDWVNWPVS
                     KKIGGQEAVIPKEVIGAHGGFPLSEWQKYIKSADNKLLFKGQDYTRKVRYLTDEEKKN
                     Q"
     gene            complement(142501..143316)
                     /locus_tag="ECL_00144"
                     /db_xref="GeneID:9122655"
     CDS             complement(142501..143316)
                     /locus_tag="ECL_00144"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610661.1"
                     /db_xref="GeneID:9122655"
                     /translation="MSRAQLSLRINRSADWQDRRCNRRNEEADAEILSAILNIISDMP
                     SYGYRRVWGILRKQRRTEGQPPVNAKRLYRIMSEHNLLLLHHKPERPKREHKGKIAVA
                     ESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAIDWAASTGGYDSSTVQDVMLRSVE
                     KRFGDRLPDTAVQWLTDNGSAYTAHETRRFAKELNLEPCTTAVSSPQSNGMAERFVKT
                     MKEDYIAFMPKPDVRTALRNLAAAFTHYNENHPHSALGYHSPREYRRQRASLT"
     misc_feature    complement(142513..143250)
                     /locus_tag="ECL_00144"
                     /note="insertion element IS2 transposase InsD;
                     Provisional; Region: PRK14702"
                     /db_xref="CDD:237792"
     misc_feature    complement(143053..143232)
                     /locus_tag="ECL_00144"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:290016"
     misc_feature    complement(142651..142998)
                     /locus_tag="ECL_00144"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:279057"
     misc_feature    complement(142537..142716)
                     /locus_tag="ECL_00144"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:290406"
     gene            complement(143341..143736)
                     /locus_tag="ECL_00145"
                     /db_xref="GeneID:9122656"
     CDS             complement(143341..143736)
                     /locus_tag="ECL_00145"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610662.1"
                     /db_xref="GeneID:9122656"
                     /translation="MSNTNTNFEMTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSH
                     VARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTM
                     EVEILKEAVEYGQSRKWIAHAPLLPKDGE"
     misc_feature    complement(143344..143697)
                     /locus_tag="ECL_00145"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     gene            complement(143798..143989)
                     /locus_tag="ECL_00146"
                     /db_xref="GeneID:9122657"
     CDS             complement(143798..143989)
                     /locus_tag="ECL_00146"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610663.1"
                     /db_xref="GeneID:9122657"
                     /translation="MFKFLNTRYRHITGRHNIPYSSLHLTGELATVDSIVIPCTGADF
                     VEEALLSATFAERYATGIS"
     gene            complement(144005..145222)
                     /locus_tag="ECL_00147"
                     /db_xref="GeneID:9122658"
     CDS             complement(144005..145222)
                     /locus_tag="ECL_00147"
                     /codon_start=1
                     /transl_table=11
                     /product="group 1 glycosyl transferase"
                     /protein_id="YP_003610664.1"
                     /db_xref="GeneID:9122658"
                     /translation="MDSDMPQKRKILLLDTGKEWGGGTNSMLELLKRIDRDKFDITCC
                     FYNDYSRAGGQTIGQVLNSIGIPLIVIPQHKQPAWAKLLKEAGRGLLFFSRNARKAFT
                     RHVDTLWRIRPNVSKIETLFSHGGFDTLYMNNQPGSNEEGYLAAAKLQARLIQHCRIE
                     PVLSPPLVKLVNAHATKIIAVSHGVEQVLLQHGIRPDLCTTVNNAIDIYQPLPDRRAM
                     RQRLGIDDETFVFGSIGSLIPRKANHHTLEALAQFSLKHPEAKWKMVLVGEGPERDAL
                     AAQAQNLGIASHVIFTGFQNTPFDYLATFDAFILASKSEGLPRVVLEAMLLNIPVIGS
                     QVTGTAELIDHASTGLLFPWSDVSQLAQHLDSIWTDADLRARLATAARQNVCRNYAIE
                     KYVSGVEAVLGAQ"
     misc_feature    complement(144050..145195)
                     /locus_tag="ECL_00147"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. WabH in Klebsiella
                     pneumoniae has been shown to transfer a GlcNAc residue
                     from UDP-GlcNAc onto the acceptor GalUA residue in the
                     cellular outer core; Region: GT1_WabH_like; cd03811"
                     /db_xref="CDD:99982"
     misc_feature    complement(order(144263..144265,144329..144331,
                     144515..144523,145157..145159))
                     /locus_tag="ECL_00147"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99982"
     gene            complement(145398..145514)
                     /locus_tag="ECL_00148"
                     /db_xref="GeneID:9122659"
     CDS             complement(145398..145514)
                     /locus_tag="ECL_00148"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610665.1"
                     /db_xref="GeneID:9122659"
                     /translation="MTISSAIFKRGGITSRNNLSELKVNKQTVILNIFPLTQ"
     gene            146023..146217
                     /locus_tag="ECL_00149"
                     /db_xref="GeneID:9122660"
     CDS             146023..146217
                     /locus_tag="ECL_00149"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610666.1"
                     /db_xref="GeneID:9122660"
                     /translation="MISAIGAFFKWYLFSGAWRQGRVGAATGLYATAYSFLKYFKAWY
                     QYQERKEPVTKEHTDSHITE"
     gene            complement(146229..147161)
                     /locus_tag="ECL_00150"
                     /db_xref="GeneID:9122661"
     CDS             complement(146229..147161)
                     /locus_tag="ECL_00150"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610667.1"
                     /db_xref="GeneID:9122661"
                     /translation="MLQFRRIVLSVASALALVAPVYAGKLAIVIDDFGYRPHYENQVL
                     AMPAAISVAVLPNAPHAREMATKAHNSGHQVLIHLPMAPISKQPLEKDTLRPEMSSDE
                     IDRIIRDAYNKVPYAVGLNNHMGSAMTSSLYGMLKVMQALERYNLYFLDSMTIGNSQA
                     MRAAQGTGVKVIKRKVFLDDTQNEADIRVQFNRAVQLARRNGSAIAIGHPHPSTVRVL
                     QQMLPTLPSDITLVRPSDLLNEPQVDTSTPNQGKPGSSTPRNPFRGVKRCVPKHAPEP
                     VYATRFFSVIGESMSQSTLVQYFQHQWQGWGKKA"
     misc_feature    complement(146436..147161)
                     /locus_tag="ECL_00150"
                     /note="Uncharacterized conserved protein YibQ, putative
                     polysaccharide deacetylase 2 family [Carbohydrate
                     transport and metabolism]; Region: YibQ; COG2861"
                     /db_xref="CDD:225416"
     gene            complement(147165..148448)
                     /locus_tag="ECL_00151"
                     /db_xref="GeneID:9122662"
     CDS             complement(147165..148448)
                     /locus_tag="ECL_00151"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610668.1"
                     /db_xref="GeneID:9122662"
                     /translation="MRGKAIFSITWVVKPLRLSVRPLFYASALSAGVLLCAASAHADD
                     RDQLKSIQADIAAKERAVRQQQQQRASLLAQLKQQEEAISAAARELRETQNTLSQLNK
                     QIDEMNASIAKLERQRDAQERNLAAQLDAAFRQGEHTGLQLILSGEESQRGQRLQAYF
                     GYLNQARQETIAQLKQTREEVTTQKAELEEKQSQQQTLLYEQQAQQAKLEQARNERKK
                     TLSGLESSIQAGQSQLSEMRANESKLRNSIARAEAAAKARAEKEAREAQAVRDKQQEA
                     SRKGTTYKPSESERSLMSRTGGLGSPRGQAYWPVRGTILHRYGEQLQGELRWKGIVIG
                     ASEGSEVKAIADGRVILADWLQGYGLVVVVEHGKGDMSLYGYNQSALVSVGTQVRAGQ
                     PIALVGSSGGQGRPSLYFEIRRQGQAVNPQPWLGR"
     misc_feature    complement(147168..148448)
                     /locus_tag="ECL_00151"
                     /note="AmiB activator; Provisional; Region: PRK11637"
                     /db_xref="CDD:236942"
     gene            complement(148458..150002)
                     /locus_tag="ECL_00152"
                     /db_xref="GeneID:9122663"
     CDS             complement(148458..150002)
                     /locus_tag="ECL_00152"
                     /codon_start=1
                     /transl_table=11
                     /product="2,3-bisphosphoglycerate-independent
                     phosphoglycerate mutase"
                     /protein_id="YP_003610669.1"
                     /db_xref="GeneID:9122663"
                     /translation="MSVSKKPMVLVILDGYGYREDQQDNAIFNAKTPVMDALWAKRPH
                     TLIDASGLEVGLPDRQMGNSEVGHVNLGAGRIVYQDLTRLDVEIKERTFFANPVLCGA
                     VDKAVAAGKAVHIMGLLSAGGVHSHEDHIMAMVELAAERGAEKIYLHAFLDGRDTPPR
                     SAKGSLEAFEEKFAALGKGRVASIIGRYYAMDRDNRWDRVEQAYDLMTLAKGEFQFAT
                     AVEGLEAAYARDENDEFVKATVIRAEGQADAAMEDGDALIFMNFRADRAREITRAFVN
                     SDFDGFARKKAVNINFIQLTEYAADIDAPCAYPPASLANTFGEWMAKNDKTQLRISET
                     EKYAHVTFFFNGGVEEPFKGEDRILINSPKVATYDLQPEMSSAELTEKLVAAIVSGKY
                     DTIICNYPNGDMVGHTGVMEAAIKAVEALDHCVEQVAKAVESVGGQLLITADHGNAEQ
                     MRDPATGQAHTAHTNLPVPLIYVGDKALKAVEGGKLSDVAPTMLSLMGMPIPEEMTGK
                     PLFIVE"
     misc_feature    complement(148467..149999)
                     /locus_tag="ECL_00152"
                     /note="phosphoglyceromutase; Provisional; Region:
                     PRK05434"
                     /db_xref="CDD:235463"
     gene            150251..150682
                     /locus_tag="ECL_00153"
                     /db_xref="GeneID:9122664"
     CDS             150251..150682
                     /locus_tag="ECL_00153"
                     /codon_start=1
                     /transl_table=11
                     /product="rhodanese domain-containing protein"
                     /protein_id="YP_003610670.1"
                     /db_xref="GeneID:9122664"
                     /translation="MQEIMQFVSRHPVLSIAWIGLLAAVLFTTFKGLTSKIKVITRGE
                     ATRLINKEDAVVVDLRQRDDFRKGHIAGAINLLPAEIKANNVGELEKHKAQPIIVVDG
                     TGMQAQESASLLHKAGFENVSVLKEGISGWSGENLPLVRGK"
     misc_feature    150380..150646
                     /locus_tag="ECL_00153"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cd00158"
                     /db_xref="CDD:238089"
     misc_feature    150551..150553
                     /locus_tag="ECL_00153"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            150694..150945
                     /locus_tag="ECL_00154"
                     /db_xref="GeneID:9122665"
     CDS             150694..150945
                     /locus_tag="ECL_00154"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610671.1"
                     /db_xref="GeneID:9122665"
                     /translation="MANIEIYTKATCPFCHRAKALLNSKGVTFQELPIDGDAIKREEM
                     IQRSGRTTVPQIFIDAQHIGGCDDLYALDARGGLDPLLS"
     misc_feature    150694..150942
                     /locus_tag="ECL_00154"
                     /note="glutaredoxin 3; Provisional; Region: PRK10638"
                     /db_xref="CDD:182607"
     misc_feature    order(150718..150720,150727..150735,150847..150852)
                     /locus_tag="ECL_00154"
                     /note="GSH binding site [chemical binding]; other site"
                     /db_xref="CDD:239510"
     misc_feature    order(150727..150729,150736..150738)
                     /locus_tag="ECL_00154"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239510"
     gene            150979..151446
                     /gene="secB"
                     /locus_tag="ECL_00155"
                     /db_xref="GeneID:9122666"
     CDS             150979..151446
                     /gene="secB"
                     /locus_tag="ECL_00155"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecB"
                     /protein_id="YP_003610672.1"
                     /db_xref="GeneID:9122666"
                     /translation="MSEQNNTEMTFQIQRIYTKDVSFEAPNAPHVFQKDWQPEVKLDL
                     DTASTQLADDVYEVVLRVTVTASLGEETAFLCEVQQGGIFSIGGIEGNQMAHCLGAYC
                     PNILFPYARECITSLVSRGTFPQLNLAPVNFDALFMNYLQQQAGEGAEQHQDA"
     misc_feature    150979..151431
                     /gene="secB"
                     /locus_tag="ECL_00155"
                     /note="preprotein translocase subunit SecB; Validated;
                     Region: PRK05751"
                     /db_xref="CDD:180234"
     misc_feature    order(151036..151038,151048..151050,151201..151203,
                     151207..151209)
                     /gene="secB"
                     /locus_tag="ECL_00155"
                     /note="SecA binding site; other site"
                     /db_xref="CDD:238312"
     misc_feature    order(151198..151200,151204..151206,151210..151212,
                     151216..151218)
                     /gene="secB"
                     /locus_tag="ECL_00155"
                     /note="Preprotein binding site; other site"
                     /db_xref="CDD:238312"
     gene            151446..152465
                     /locus_tag="ECL_00156"
                     /db_xref="GeneID:9122667"
     CDS             151446..152465
                     /locus_tag="ECL_00156"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase"
                     /protein_id="YP_003610673.1"
                     /db_xref="GeneID:9122667"
                     /translation="MSTVNASMTVIGAGSYGTALAITLARNGHEVVLWGHDPKHIATL
                     QHDRCNVAFLPDVPFPDSLHLESDLATALAASRNILIVVPSHVFGDVLQQIKPLMRPD
                     ARIVWATKGLEAETGRLLQDVAREVLGTEIPLAVISGPTFAKELAAGLPTAISLASTD
                     QAFSDDLQQLLHCGKSFRVYSNPDFIGVQLGGAVKNVIAIGAGMSDGIGFGANARTAL
                     ITRGLTEMSRLGAALGADPATFMGMAGLGDLVLTCTDNQSRNRRFGMMLGQGMDVKGA
                     QEKIGQVVEGYRNTKEVRELAHRFGVEMPITEEIYQVLYCGKNAREAALTLLGRARKD
                     ERSSN"
     misc_feature    151461..152435
                     /locus_tag="ECL_00156"
                     /note="NAD(P)H-dependent glycerol-3-phosphate
                     dehydrogenase; Validated; Region: gpsA; PRK00094"
                     /db_xref="CDD:234629"
     gene            152541..153362
                     /locus_tag="ECL_00157"
                     /db_xref="GeneID:9122668"
     CDS             152541..153362
                     /locus_tag="ECL_00157"
                     /codon_start=1
                     /transl_table=11
                     /product="serine acetyltransferase"
                     /protein_id="YP_003610674.1"
                     /db_xref="GeneID:9122668"
                     /translation="MPCEELDIVWNNIKAEARALADCEPMLASFYHATLLKHENLGSA
                     LSYMLANKLASSIMPAIAIREVVEEAYAADPEMIASAACDIQAVRTRDPAVDKYSTPL
                     LYLKGFHALQAYRIGHWLWKEGRRALAIFLQNQVSVTFQVDIHPAAKIGRGIMLDHAT
                     GIVVGETAVIEDDVSILQSVTLGGTGKTSGDRHPKIREGVMIGAGAKILGNIEVGRGA
                     KIGAGSVVLQPVPPHTTAAGVPARIVGKPDSDKPSMDMDQHFNGIHHTFEYGDGI"
     misc_feature    152541..153359
                     /locus_tag="ECL_00157"
                     /note="serine acetyltransferase; Provisional; Region:
                     cysE; PRK11132"
                     /db_xref="CDD:182987"
     gene            complement(153359..153832)
                     /locus_tag="ECL_00158"
                     /db_xref="GeneID:9122669"
     CDS             complement(153359..153832)
                     /locus_tag="ECL_00158"
                     /codon_start=1
                     /transl_table=11
                     /product="putative tRNA/rRNA methyltransferase"
                     /protein_id="YP_003610675.1"
                     /db_xref="GeneID:9122669"
                     /translation="MLNIVLFEPEIPPNTGNIIRLCANTGFRLHIIEPMGFTWDDKRL
                     RRAGLDYHEFTAVVRHHDYAAFLESEKPERMFALTTKGTPAHSAVSYQAGDYLMFGPE
                     TRGLPATILDALPAEQKIRIPMMPDSRSMNLSNAVSVVVYEAWRQLGYPGAILRS"
     misc_feature    complement(153362..153832)
                     /locus_tag="ECL_00158"
                     /note="putative rRNA methylase; Provisional; Region:
                     PRK10358"
                     /db_xref="CDD:182406"
     gene            complement(153878..155218)
                     /locus_tag="ECL_00159"
                     /db_xref="GeneID:9122670"
     CDS             complement(153878..155218)
                     /locus_tag="ECL_00159"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_003610676.1"
                     /db_xref="GeneID:9122670"
                     /translation="MAYSGKVDIQQVIDDSSFSWFHWLLIVLGFLVLAIDGFDTAAMG
                     YIAPTLSAEWGIHKQDLGPVLSAALLGLSLGALIAGPVSDRMGRKRVLVFSCLFFGLA
                     SLGAAWAQTLNTLTLWRFLTGLGLGAAMPNAITLISEFAPKRCRAMAINTMYCGFPLG
                     AAGGGAISSWLIPHHGWRSVLLTGAIAPLILTLLLALFLPESVKFLVQRGRDMMQIRR
                     IASRFARDTLDGVTGFFLAEERVASKKGSVAQLFSMPWLPGTLMLWVTYFMGLVIYYV
                     LLSWMPTLMLGMGYPLAESAWLTSLFTFGGTAGILLAGWMMDRWEAHRVVAGGFMLTM
                     ALILLLGMEHNHIALFGGLIFLMGIAMNGAQSGMQTLAATFYPTECRATGIAWMQGIG
                     RFGGVAGTMTSAQLLSMQWQADSILMILSLPALVAAGATVYKMLRCRPQEPGVA"
     misc_feature    complement(153998..155197)
                     /locus_tag="ECL_00159"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     cl26865"
                     /db_xref="CDD:331686"
     gene            complement(155400..156587)
                     /locus_tag="ECL_00160"
                     /db_xref="GeneID:9122671"
     CDS             complement(155400..156587)
                     /locus_tag="ECL_00160"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate dehydrogenase"
                     /protein_id="YP_003610677.1"
                     /db_xref="GeneID:9122671"
                     /translation="MIISAASDYRAAAQRILPPFLFHYIDGGAYAEYTLRRNVEDLSE
                     VALRQRVLKNMSDLSLETKLFNETLSMPVALAPVGLCGMYARRGEVQAAAAADAKGIP
                     FTLSTVSVCPIEEVAPTIKRPMWFQLYVLRDRGFMRNALERAKAAGCSTLVFTVDMPT
                     PGARYRDAHSGMSGPNAAMRRYWQAVTHPQWAWDVGLNGRPHDLGNISAYLGKPTGLE
                     DYIGWLANNFDPSISWKDLEWIREFWDGPMVIKGILDPDDARDAVRFGADGIVVSNHG
                     GRQLDGVLSSARALPAIADAVKGDIAILADSGIRNGLDVVRMIALGADSVLLGRAYLY
                     ALATSGQAGVANLLNLIEKEMKVAMTLTGAKTIGEISKDSLVQELSKIPAALAPLTHG
                     DAA"
     misc_feature    complement(155451..156587)
                     /locus_tag="ECL_00160"
                     /note="L-lactate dehydrogenase; Provisional; Region: lldD;
                     PRK11197"
                     /db_xref="CDD:183033"
     gene            complement(156584..157348)
                     /locus_tag="ECL_00161"
                     /db_xref="GeneID:9122672"
     CDS             complement(156584..157348)
                     /locus_tag="ECL_00161"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional repressor LldR"
                     /protein_id="YP_003610678.1"
                     /db_xref="GeneID:9122672"
                     /translation="MPRRLSDEIASRVRALIEEQQLEAGMKLPAERQLAAQLGVSRNS
                     LREALATLVSEGVLVSRRGGGTFVRWQHDDWSEQNIVQPLKTLMENDPDYSFDILEAR
                     HAIETSTAWHAAMRATEADKEKLRACFDATQSSDPDIASQADVRFHLAIAEASHNVVL
                     LQTMRGFFDLLQSSVKQSRQRMYLVPPVFAQLTEQHEAVLNAILAGDAEAARKAMMAH
                     LGFVHTTIKRFDEDQARQARITRLPGDSDISRENKA"
     misc_feature    complement(156587..157342)
                     /locus_tag="ECL_00161"
                     /note="DNA-binding transcriptional repressor LldR;
                     Provisional; Region: PRK10421"
                     /db_xref="CDD:236690"
     gene            complement(157354..159009)
                     /locus_tag="ECL_00162"
                     /db_xref="GeneID:9122673"
     CDS             complement(157354..159009)
                     /locus_tag="ECL_00162"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lactate permease"
                     /protein_id="YP_003610679.1"
                     /db_xref="GeneID:9122673"
                     /translation="MSLWQQNYDPAGNIWLSSLIASLPILFFFFALIKLKLKGYLAAT
                     YTVAIALLVALFFYKMPIDRALASVVYGFFYGLWPIAWIIIAAVFVYKISVKTGQFDI
                     IRSSILSITPDQRLQMLIVGFSFGAFLEGAAGFGAPVAITAALLVGLGFNPLYAAGLC
                     LIVNTAPVAFGAMGIPILVAGQVTGLDSFEIGQMVGRQLPFLTIIVLFWIMAIMDGWR
                     GVKETWPAVMVAGGSFAIAQYLSSNFLGPELPDIISSLVSLVCLTLFLKRWQPVRIFR
                     FADMGASHVDQTLARTGYTAGQIVRAWSPFLFLTATVTLWSIPPFKALFAPGGALYDM
                     VINISVPFLDKMVARMPPVVHDATPYAAVFKFDWFSATGTAILFAALLSVVWLRMKSA
                     AAVQTFAATIKELMLPIYSIGMVLAFAFISNYSGLSSTLALALAHTGHAFTFFSPFLG
                     WLGVFLTGSDTSSNALFAALQATAAQQIGVSDVLLVAANTTGGVTGKMISPQSIAIAC
                     AAVGLVGKESDLFRFTVKHSLIFTCMVGVITTLQAYVLTWMIP"
     misc_feature    complement(157357..159009)
                     /locus_tag="ECL_00162"
                     /note="L-lactate permease; Provisional; Region: PRK10420"
                     /db_xref="CDD:182445"
     gene            complement(159287..160738)
                     /locus_tag="ECL_00163"
                     /db_xref="GeneID:9122674"
     CDS             complement(159287..160738)
                     /locus_tag="ECL_00163"
                     /codon_start=1
                     /transl_table=11
                     /product="putative superfamily I DNA and RNA helicase
                     protein"
                     /protein_id="YP_003610680.1"
                     /db_xref="GeneID:9122674"
                     /translation="MGAGQGVATFSVSQRKAIQDELEILRRLNPQYEDFFNSHPAEPF
                     FIKNLENIQGDERDVIMISVGYARNKQGYLAMRFGPLGSQGGERRLNVLISRAKRRCE
                     VFASITDEDIDLERAKGVGVLAFKLFLQYARTGRLSMSTVSGRPMDSVFEEQVASALQ
                     KRGYQVHPQVGIAGFFIDLAIADPDLPGRYLLGIECDGSAYHSSRSARERDRLRQAVL
                     EDHGWIIHRIWSTDWFQRPEEQLQKVIYAIENAKRELNNRAEHTYGRSRAVPVDIVTV
                     EREDVVEIGLDRTDSANDQSIIYEEAQPEANLSYALHETPTGILADMVEKIVFTESPI
                     HLNEVITRLRSAWGLQRAGARIESVVSQAAQIACKRGKIYKEQEFFIHKEVAIRIRNR
                     QHVLSAGVRKPELIAPIEIASGVFDIVSASLGATEDEIITSVSRMLGFKSTSSLLRKV
                     ISEVIEQEIKDNRLKQQDGLIVIGDASSAQKAI"
     misc_feature    complement(160421..>160723)
                     /locus_tag="ECL_00163"
                     /note="Superfamily I DNA and/or RNA helicase [Replication,
                     recombination and repair]; Region: DNA2; COG1112"
                     /db_xref="CDD:224037"
     misc_feature    complement(160040..160324)
                     /locus_tag="ECL_00163"
                     /note="Superfamily of nucleases including Short Patch
                     Repair (Vsr) Endonucleases, archaeal Holliday junction
                     resolvases, MutH methy-directed DNA mismatch-repair
                     endonucleases, and catalytic domains of many restriction
                     endonucleases, such as EcoRI, BamHI, and...; Region:
                     Restriction_endonuclease_like; cl00516"
                     /db_xref="CDD:321016"
     misc_feature    complement(order(160148..160150,160154..160156,
                     160205..160207,160283..160285))
                     /locus_tag="ECL_00163"
                     /note="putative active site [active]"
                     /db_xref="CDD:238508"
     misc_feature    complement(159665..159799)
                     /locus_tag="ECL_00163"
                     /note="Protein of unknown function (DUF3320); Region:
                     DUF3320; pfam11784"
                     /db_xref="CDD:314621"
     gene            complement(160754..161587)
                     /locus_tag="ECL_00164"
                     /db_xref="GeneID:9122675"
     CDS             complement(160754..161587)
                     /locus_tag="ECL_00164"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610681.1"
                     /db_xref="GeneID:9122675"
                     /translation="MMLMCDATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRIT
                     ELALERRRFGYRRIWQLLRREGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLL
                     RPAAPNLTWSMDFVMDALSTGRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSI
                     ALFRGYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDE
                     CLNEHWFSDIVHARKIINDWRQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVT
                     N"
     misc_feature    complement(161339..161464)
                     /locus_tag="ECL_00164"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:315857"
     misc_feature    complement(160931..161269)
                     /locus_tag="ECL_00164"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:307008"
     misc_feature    complement(160820..161020)
                     /locus_tag="ECL_00164"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:316225"
     gene            complement(161611..161874)
                     /locus_tag="ECL_00165"
                     /db_xref="GeneID:9122676"
     CDS             complement(161611..161874)
                     /locus_tag="ECL_00165"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3/IS911 family transposase"
                     /protein_id="YP_003610682.1"
                     /db_xref="GeneID:9122676"
                     /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKY
                     GSMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKY"
     misc_feature    complement(161665..161871)
                     /locus_tag="ECL_00165"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:307599"
     gene            complement(162035..162235)
                     /locus_tag="ECL_00166"
                     /db_xref="GeneID:9122677"
     CDS             complement(162035..162235)
                     /locus_tag="ECL_00166"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610683.1"
                     /db_xref="GeneID:9122677"
                     /translation="MKSQKLSKEAQKLMNMPHRRAITKKEQADMGKLKKSVRGLVVVH
                     PMTELGREMGLKEMTGFCKTAF"
     misc_feature    complement(162038..>162235)
                     /locus_tag="ECL_00166"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11020"
                     /db_xref="CDD:182904"
     gene            complement(162260..162397)
                     /locus_tag="ECL_00167"
                     /db_xref="GeneID:9122678"
     CDS             complement(162260..162397)
                     /locus_tag="ECL_00167"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610684.1"
                     /db_xref="GeneID:9122678"
                     /translation="MKEVEKNEIKRLSDRLDLIRHQMAGLSLVDSAEKYAELEKETAK
                     L"
     misc_feature    complement(<162263..162391)
                     /locus_tag="ECL_00167"
                     /note="hypothetical protein; Provisional; Region:
                     PRK11020"
                     /db_xref="CDD:182904"
     gene            complement(162456..163046)
                     /locus_tag="ECL_00168"
                     /db_xref="GeneID:9122679"
     CDS             complement(162456..163046)
                     /locus_tag="ECL_00168"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol repressor protein"
                     /protein_id="YP_003610685.1"
                     /db_xref="GeneID:9122679"
                     /translation="MMHSEAQVILRPDYRLSDMQAIMEQTQAFENRVLERLNAGKTVR
                     SFLITAVELLTEAVNILVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGV
                     LNRQEYEDAELLMALREELNHDGNEYTFTDDEILGPFGELHCVTALPPAPHFDNSDPE
                     LYAMQKLRYQQVVRSTMVLSLTELISRISLKKAFQK"
     misc_feature    complement(162465..162968)
                     /locus_tag="ECL_00168"
                     /note="mannitol repressor protein; Provisional; Region:
                     mtlR; PRK11001"
                     /db_xref="CDD:236817"
     gene            complement(163043..164191)
                     /locus_tag="ECL_00169"
                     /db_xref="GeneID:9122680"
     CDS             complement(163043..164191)
                     /locus_tag="ECL_00169"
                     /codon_start=1
                     /transl_table=11
                     /product="mannitol-1-phosphate 5-dehydrogenase"
                     /protein_id="YP_003610686.1"
                     /db_xref="GeneID:9122680"
                     /translation="MKALHFGAGNIGRGFIGKLLADAGITLTFADVNQVVLDALNARH
                     SYQVHVVGENEQVETVSGVNAVSSIGDDVIDLIASVDLVTTAVGPVVLERIAPAVAKG
                     LAKRKAQGIDTPLNIIACENMVRGTTQLKGHVLAAVADEDKAWVEAHVGFVDSAVDRI
                     VPPSESATNDPLEVTVETFSEWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNT
                     GHAITAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQK
                     ILGRFENPYLKDDVERVGRQPLRKLSAGDRLIKPLLGTLEYGLPHANLVKGIAAAMHY
                     RSEQDPQAQELAQLIDDQGAQAALAQISGLDANSDVVAEAVNAYNATK"
     misc_feature    complement(163046..164191)
                     /locus_tag="ECL_00169"
                     /note="mannitol-1-phosphate 5-dehydrogenase; Provisional;
                     Region: PRK02318"
                     /db_xref="CDD:235031"
     gene            complement(164292..166199)
                     /locus_tag="ECL_00170"
                     /db_xref="GeneID:9122681"
     CDS             complement(164292..166199)
                     /locus_tag="ECL_00170"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system mannitol-specific transporter subunit
                     IIC"
                     /protein_id="YP_003610687.1"
                     /db_xref="GeneID:9122681"
                     /translation="MSSDFKIKVQSFGRFLSNMVMPNIGAFIAWGIITALFIPTGWLP
                     NETLAKLVGPMITYLLPLLIGYTGGRLVGGDRGGVVGAITTMGVIVGADMPMFLGAMI
                     AGPLGGWAIKKFDVWVDGKIKSGFEMLVNNFSAGIIGMILAILAFLGIGPAVEVLSKI
                     LAAGVNFMVAHDMLPLASIFVEPAKILFLNNAINHGIFSPLGIQQSHDLGKSIFFLIE
                     ANPGPGMGVLLAYMFFGRGSAKQSAGGAAIIHFLGGIHEIYFPYVLMNPRLILAVILG
                     GMTGVFTLSVLNGGLVSPASPGSILAVLAMTPKGAYFANIAAICAAMAVSFVVASILL
                     KTSKVKEDDDIEAATRRMHDMKAESKGATPLSAGDVSNDLSHVRKIIVACDAGMGSSA
                     MGAGVLRKKVQDAGLTNISVTNSAINSLPPDVDLVITHRDLTERAMRQVPQAQHISLT
                     NFLDSGLYTSLTERLVAAQRHEDNEVKVRTSLQDSFDESNAHLFKLGAENIFLGRTAS
                     TKEEAIRFAGEQLVKGGYVQPEYVDAMLEREKLTPTYLGESIAVPHGTVEAKDRVLKT
                     GVVFCQYPDGVRFGEEEDDIARLVIGIAARNNEHIQVITSLTNALDDESVIERLAQTE
                     SVEEVLALLNK"
     misc_feature    complement(164298..166199)
                     /locus_tag="ECL_00170"
                     /note="PTS system mannitol-specific transporter subunit
                     IICBA; Provisional; Region: PRK15083"
                     /db_xref="CDD:237905"
     gene            166545..166673
                     /locus_tag="ECL_00171"
                     /db_xref="GeneID:9122682"
     CDS             166545..166673
                     /locus_tag="ECL_00171"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610688.1"
                     /db_xref="GeneID:9122682"
                     /translation="MIGGKFCLTNERHDGSGQHAKLKNHFSCVVWRKAKTWITLIM"
     gene            166859..167215
                     /locus_tag="ECL_00172"
                     /db_xref="GeneID:9122683"
     CDS             166859..167215
                     /locus_tag="ECL_00172"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610689.1"
                     /db_xref="GeneID:9122683"
                     /translation="MFLNYFALGVLIFVFLVLFYGIIAIHDIPYNMAKKRNHPHADAI
                     HTAGWISLFTLHAIWPFLWIWATLYREDRGWGMQNHITKPDEVPGMDALAKRVAELEQ
                     KLAAVQPTADTKTLER"
     misc_feature    166865..167095
                     /locus_tag="ECL_00172"
                     /note="Protein of unknown function (DUF3302); Region:
                     DUF3302; pfam11742"
                     /db_xref="CDD:314583"
     gene            167218..168354
                     /locus_tag="ECL_00173"
                     /db_xref="GeneID:9122684"
     CDS             167218..168354
                     /locus_tag="ECL_00173"
                     /codon_start=1
                     /transl_table=11
                     /product="secretion protein HlyD family protein"
                     /protein_id="YP_003610690.1"
                     /db_xref="GeneID:9122684"
                     /translation="MDLLIILTYVAFAWAIFKIFRIPVNQWTLATATLGGVFIVAGLI
                     LLMNYNHPYTFTAQKAVISIPITPQVTGVVSEVTDKNNQLIKKGEVLFKLDPGRYQAR
                     VDRLQADLVTATHNIDVLKAQLSEAVANTTRVSAERDRLYKDYQRYLKGSQAKVNPFS
                     ESDIDNARQNYLAQDALVKGSVAEQTQIKSQLDSMVNGEQSQIASLRAQLAEAKYNLD
                     QTVVRAPSNGYITQVLIRPGTYAAALPLRPVMVFIPEQKRQIVAQFRQNSLLRLKPGD
                     EAEVVFNALPGQVFSGKLTSILPVVPGGSYQAQGALQSLTVTPGTDGVQALIELEPNA
                     DVDALPDGIYAQVAVYSDHFAHVSVMRKVLLRMTSWMHYLYLDH"
     misc_feature    167230..168285
                     /locus_tag="ECL_00173"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     gene            168444..169052
                     /locus_tag="ECL_00174"
                     /db_xref="GeneID:9122685"
     CDS             168444..169052
                     /locus_tag="ECL_00174"
                     /codon_start=1
                     /transl_table=11
                     /product="putative glutathione S-transferase"
                     /protein_id="YP_003610691.1"
                     /db_xref="GeneID:9122685"
                     /translation="MKLIGSYTSPFVRKISILLLEKGIEFEFVNEQPYNAENGVAQYN
                     PLGKVPALVTDEGEYWFDSPIIAEYIELLGVAPAMLPADPKAALAVKQIEALADGIMD
                     AALTSVREQARPVAQQSETELLRQREKISRSLDRCEQLIQEGKIATDSLNLATIAIAC
                     AIGYLNFRRVSPGWCVDRPLLVKLAETLFQRESFARTEPPKA"
     misc_feature    168444..169049
                     /locus_tag="ECL_00174"
                     /note="putative glutathione S-transferase; Provisional;
                     Region: PRK10357"
                     /db_xref="CDD:182405"
     gene            169156..170541
                     /locus_tag="ECL_00175"
                     /db_xref="GeneID:9122686"
     CDS             169156..170541
                     /locus_tag="ECL_00175"
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine synthase"
                     /protein_id="YP_003610692.1"
                     /db_xref="GeneID:9122686"
                     /translation="MTTHHSLYSQIPATDRLLREPLIHSAVERFGHTATVEMLRLLQD
                     EARRHIQAENALPGWCVAWEQELEQRLVDKGQSALRPVINLTGTVLHTNLGRAQQAEE
                     AVDAVTQAMRSPVTLEYDLDGAGRGHRDRALADLLCQLTGAEDACIVNNNAAAVLLML
                     AATASGKEVVVSRGELVEIGGAFRIPDVMRQAGCTLHEVGTTNRTHAKDYRAAVNENT
                     ALLMKVHTSNYHIEGFTKAVEEAELAAIGQELNVPVVADLGSGSLVDLSQYGLPKEPM
                     VQEMIAAGVSLVSFSGDKLLGGPQAGIIVGKRELIAKLQQHPLKRALRADKMTLAALD
                     ATLRLYLHPEKLAERLPTLRLLTRDAASIRAQAELLLPNVASHYADFDVRIESCQSQI
                     GSGSLPVDRLPSAALTFTPRDGRGSRLDALSTRWRALPTPVIGRIYDGRMWLDLRCLE
                     DEERFLEMLLK"
     misc_feature    169159..170538
                     /locus_tag="ECL_00175"
                     /note="selenocysteine synthase; Provisional; Region:
                     PRK04311"
                     /db_xref="CDD:235278"
     gene            170538..172385
                     /locus_tag="ECL_00176"
                     /db_xref="GeneID:9122687"
     CDS             170538..172385
                     /locus_tag="ECL_00176"
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteinyl-tRNA-specific translation
                     factor"
                     /protein_id="YP_003610693.1"
                     /db_xref="GeneID:9122687"
                     /translation="MIIATAGHVDHGKTTLLQAITGVNADRLPEEKKRGMTIDLGYAY
                     WPQPDGRVLGFIDVPGHEKFLSNMLAGVGGIDHALLVVACDDGVMAQTREHLAILQLT
                     GNPQLTVALTKADRVDATRINEVREAVQATLREYGFTDAALFETVATEGRGIDALRHH
                     LQQLSSREHASHHRFRLAIDRAFTVKGAGLVVTGTALSGEVKVGDTVWLTGINKPMRV
                     RGLHAQNQPVDHAHAGQRIALNIAGDAEKAQLNRGDWLLSEAPPEPSERVIVSLQTHI
                     PLSQWQPLHIHHAASHITGRVSLLENDLAELVFDTPLWLADNDRLVLRDISARETLAG
                     ARVVTLNPPRRGKRKPEYLQWLSALAQASNDKAALEVHLERGAVNLTDFAWARQLSNE
                     GLLPLTQQPGFIQAGNNLLNAPVAACWQRKVLNTLATYHEQHQDEPGPGRERLRRMAL
                     PMEDDALVLLLIENMRESGVIKSHHGWLHLPDHKAGFTAEQEAIWQKAAPLFGDEPWW
                     VRDLARETNTDEQVMRQVLRHAAQQGLIVAIVKDRYYRNDRIVAFASLIRELDQARGS
                     TCAADFRDRLNVGRKLAIQILEYFNRIGFTRRRGNDHLLRDSLLFPETA"
     misc_feature    170538..172379
                     /locus_tag="ECL_00176"
                     /note="selenocysteinyl-tRNA-specific translation factor;
                     Provisional; Region: PRK10512"
                     /db_xref="CDD:182508"
     gene            172472..174010
                     /locus_tag="ECL_00177"
                     /db_xref="GeneID:9122688"
     CDS             172472..174010
                     /locus_tag="ECL_00177"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde dehydrogenase B"
                     /protein_id="YP_003610694.1"
                     /db_xref="GeneID:9122688"
                     /translation="MTNNPPSSRIQPGEYGFPLKLKPRYDNFIGGDWVAPVDGEYYSN
                     LTPVTGQPLCEIASSGKRDIDLALDAAHKAKDKWGQTSVQDRAAILFKIADRMEQNLE
                     LLATAETWDNGKPIRETMAADVPLAIDHFRYFASCIRAQEGGISEVDSDTVAYHFHEP
                     LGVVGQIIPWNFPLLMASWKMAPALAAGNCIVLKPARLTPLSVLLLMDIIGDLLPPGV
                     INVVNGAGGEIGEYLATSKRIAKVAFTGSTEVGQQIMQYATQNIIPVTLELGGKSPNI
                     FFEDVMAEEDAFFDKALEGFALFAFNQGEVCTCPSRALVQESIYERFMERAIRRVESI
                     RSGNPLDNVTQMGAQVSHGQLETILNYIDIGKKEGADVLTGGRRKVLGGDLQEGYYLE
                     PTILSGKNNMRVFQEEIFGPVLAVTTFKTLEEALEIANDTPYGLGAGVWSRNGNLAYK
                     MGRGIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRETHKMMLEHYQQTKCLLVSYSDKP
                     LGLF"
     misc_feature    172544..173983
                     /locus_tag="ECL_00177"
                     /note="Ralstonia eutrophus NAD+-dependent acetaldehyde
                     dehydrogenase II and Staphylococcus aureus AldA1
                     (SACOL0154)-like; Region: ALDH_ACDHII_AcoD-like; cd07559"
                     /db_xref="CDD:143471"
     misc_feature    order(172970..172984,173006..173008,173051..173053,
                     173057..173062,173201..173212,173219..173221,
                     173228..173233,173273..173281,173390..173392,
                     173693..173695,173699..173701,173777..173779,
                     173891..173893)
                     /locus_tag="ECL_00177"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143471"
     misc_feature    order(172982..172984,173273..173275,173381..173383,
                     173390..173392)
                     /locus_tag="ECL_00177"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143471"
     gene            complement(174007..174972)
                     /locus_tag="ECL_00178"
                     /db_xref="GeneID:9122689"
     CDS             complement(174007..174972)
                     /locus_tag="ECL_00178"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003610695.1"
                     /db_xref="GeneID:9122689"
                     /translation="MMNKLQLKPRELKIISVIAATHSIGDAAALLGMAQANVSKYLSD
                     FETRVGLKVFERTTRQLALTQFGEALLPYVNATLDKNSQLINFIADYKHEKRGKVTIY
                     APTGIVTYLSRHVIHQIKDIGDIRISLKTYNLDRNEFSEGVTFPDDCDILITYAQPKD
                     ESLVASVLTQYSVTAFATEEYLNQHPLNGPEDLIHHSCILIDSMLVDDANIWRFRVHG
                     SDDVQDYRVTGNYISDNTQTALELARNNLGIVFAPKESLRKELKNGSLVPCFPHQEEW
                     WLDLTAIFRKREYQPWRVQYVLDGVLNNLRQQIAQAAHGRPELDD"
     misc_feature    complement(174052..174945)
                     /locus_tag="ECL_00178"
                     /note="DNA-binding transcriptional regulator, LysR family
                     [Transcription]; Region: LysR; COG0583"
                     /db_xref="CDD:223656"
     gene            175090..175830
                     /locus_tag="ECL_00179"
                     /db_xref="GeneID:9122690"
     CDS             175090..175830
                     /locus_tag="ECL_00179"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610696.1"
                     /db_xref="GeneID:9122690"
                     /translation="MTIKNNLLIAATLFATSSAMAGDFSLGAGAVFNESPYKGYNENT
                     TAVPLISYEGDRFYVRQTTGGWILWKDEKNEFSLTASWMPLHFDPDDNDDPQMKHLDE
                     RKASAFLGGAYYRHENWGSLKVAVSGDAMDESGGVVGEISYFRPIRMERLTLTPSVGI
                     FYSDESYNDYYYGVSGSESRRSGLNEYAAGDSWTPYVGLAAKYQLTQNLFLNASAVYT
                     VLPDDVKNSPMIDRDDSFALMTGLSWRF"
     misc_feature    175108..175827
                     /locus_tag="ECL_00179"
                     /note="Outer membrane scaffolding protein for murein
                     synthesis, MipA/OmpV family [Cell wall/membrane/envelope
                     biogenesis]; Region: OmpV; COG3713"
                     /db_xref="CDD:226236"
     gene            176241..176645
                     /locus_tag="ECL_00180"
                     /db_xref="GeneID:9122691"
     CDS             176241..176645
                     /locus_tag="ECL_00180"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610697.1"
                     /db_xref="GeneID:9122691"
                     /translation="MFYPAYIHSDPDGSASGFFPDVPGCFFAGNSLDDAFQDARDALT
                     AHFEALFEMDEELPLPGNVEAHLEATPGDFIGGQWLLVDINMKQFDGKAERINITLPR
                     RLLVKIDSFVNEHPQFSNRSAFLAEAARRVLP"
     misc_feature    176247..176627
                     /locus_tag="ECL_00180"
                     /note="HicB_like antitoxin of bacterial toxin-antitoxin
                     system; Region: HicB_lk_antitox; pfam15919"
                     /db_xref="CDD:318191"
     gene            complement(176699..178654)
                     /locus_tag="ECL_00181"
                     /db_xref="GeneID:9122692"
     CDS             complement(176699..178654)
                     /locus_tag="ECL_00181"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610698.1"
                     /db_xref="GeneID:9122692"
                     /translation="MSIMEADLHNLKINDPFLGQYQRLVRDVVIPYQWDALNDRVAEA
                     EPSHAITNFRIAAGLEEGEFYGMVFQDSDVAKWLEAVAWSLCQKPDAELEKTADEVIE
                     LIAAAQCEDGYLNTYFTVKAPDERWTNLAECHELYCAGHMIEAGVAYFQGTGKRRLLE
                     VVCKLADHIDTVFGPREGQLHGYPGHPEIELALMRLYDVTEEPRYLNLVKYFIEARGT
                     QPHFYDIEYEKRGRTSYWHTYGPAWMVKDKAYSQAHQPLAEQQTAIGHAVRFVYLMAG
                     MAHLARLSKDDAKRQDCLRLWSNMAQRQLYITGGIGSQSSGEAFSSDYDLPNDTVYAE
                     SCASIGLMMFARRMLEMEADSRYADVMERALYNTVLGGMALDGKHFFYVNPLEVHPRT
                     LAFNHIYDHVKPVRQRWFGCACCPPNIARVLTSLGHYIYTVRPDALFINLYVGNEVTI
                     PVGDETLKLRISGNYPWQEEVNIEIASPVPVTHTLALRLPDWCANPHVSLNGEGMTGE
                     VSRGYLHLTRRWQEGDTLTLTLPMPVRRVYGHPQVRQQAGKVALQRGPLVYCLEEADN
                     GANLHNLALPADSEFRVFEGKGIFAHKMLIQAEGVTHDAAEAGSEALWQYDRPAVQRQ
                     PKTLTFIPWFSWANRGEGEMRIWVDED"
     misc_feature    complement(176702..178654)
                     /locus_tag="ECL_00181"
                     /note="Uncharacterized conserved protein, DUF1680 family
                     [Function unknown]; Region: COG3533"
                     /db_xref="CDD:226063"
     gene            complement(178665..180017)
                     /locus_tag="ECL_00182"
                     /db_xref="GeneID:9122693"
     CDS             complement(178665..180017)
                     /locus_tag="ECL_00182"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610699.1"
                     /db_xref="GeneID:9122693"
                     /translation="MTSTPITESDVAQRVREERLSVREKIGYGLGDAGGTVITCLIMN
                     FLTFFYTDIFGLTPALVGTLFIADRTQSRWGRFRPWQLWVAFPIGIIGVLTFTVPEAS
                     MGVKIAWAFGTYLLLSVGYTAINVPYCALINTMTTRHSEVISCQSWRFVLCGVAGFLV
                     SVGLPWLVAALGQGNAARGYQLGVGVLCTLAVVMFLCCFFWVRERVPLALMGKFTLRE
                     HLAGLRKNDQLLLMLVMSFLLINVFNIRGGGYMYFITYVLQGSTAYTSLFFTMVTFAA
                     ILGAVIVSPLSRRVDTVKLYYYTNLVLAAIAAGMWFLPGGPAHQTLWLIVILSNGVIL
                     GFTLPLHFSLMAFADDYGEWKTGVRSSGMNFAFNLFFIKLAWASSAGIISLVFIAVAY
                     QPGAGNQTPASLQGITAMETLLPALFHLLLAVSIRWCRLNNPMMSRIATDLRQRHVPS
                     "
     misc_feature    complement(178677..179969)
                     /locus_tag="ECL_00182"
                     /note="Na+/melibiose symporter or related transporter
                     [Carbohydrate transport and metabolism]; Region: MelB;
                     COG2211"
                     /db_xref="CDD:225121"
     gene            180242..181060
                     /locus_tag="ECL_00183"
                     /db_xref="GeneID:9122694"
     CDS             180242..181060
                     /locus_tag="ECL_00183"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_003610700.1"
                     /db_xref="GeneID:9122694"
                     /translation="MLELSIVLPIKVQNGGLFISRGVGRHPARKLTSWEIIFVEKGTL
                     TIQEENRLFEVKAGESLLLWPKRRHVGTEDFPADLRFYWLHFEVKPGPSALPEASPLT
                     IEQHCCVRDVPSVIALFRQFLSEQEKLQRSVALEMLLLLILQKISLSAGYEDRPDEAG
                     AALAWKAKQLIRTQFHLPLSTSLLAKSLHCNADYLGRVFRRTFHLTLTEAIHRQRVRA
                     AEKMLLNDSASLTEVATRCGFNDVGYFRQIFSKHTGLTPAVWKRRYCKEHINSG"
     misc_feature    180341..180643
                     /locus_tag="ECL_00183"
                     /note="Conserved domain found in cupin and related
                     proteins; Region: cupin_like; cl21464"
                     /db_xref="CDD:328732"
     misc_feature    <180737..181033
                     /locus_tag="ECL_00183"
                     /note="Two-component response regulator, YesN/AraC family,
                     consists of REC and AraC-type DNA-binding domains [Signal
                     transduction mechanisms, Transcription]; Region: YesN;
                     cl26036"
                     /db_xref="CDD:330857"
     gene            complement(181061..181756)
                     /locus_tag="ECL_00184"
                     /db_xref="GeneID:9122695"
     CDS             complement(181061..181756)
                     /locus_tag="ECL_00184"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610701.1"
                     /db_xref="GeneID:9122695"
                     /translation="MLEQLKAEVLAANLALPAHQLVTFTWGNVSAVDRDSGLMVIKPS
                     GVEYDVMTADDMVVVNIATGEVVEGSMKPSSDTPTHLALYRRYPEIGGIVHTHSRHAT
                     IWSQAGQDLPAWGTTHADYFYGAIPCTRRMTTAEIAGDYEYQTGEVIIKTFEERDISP
                     MQIPAVLVHSHGPFAWGKDAADAVHNAVVLEECAYMGLFSRQLAPQLPVMQQELLDKH
                     YLRKHGAHAYYGQ"
     misc_feature    complement(181064..181756)
                     /locus_tag="ECL_00184"
                     /note="L-ribulose-5-phosphate 4-epimerase; Reviewed;
                     Region: sgbE; PRK12347"
                     /db_xref="CDD:183459"
     misc_feature    complement(order(181100..181102,181160..181162,
                     181181..181183,181193..181195,181214..181216,
                     181247..181249,181364..181366,181406..181411,
                     181415..181417,181436..181444,181457..181462,
                     181466..181468,181607..181612,181616..181618,
                     181688..181690,181712..181714,181724..181726))
                     /locus_tag="ECL_00184"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(181244..181246,181466..181468,
                     181472..181474,181529..181537,181622..181627,
                     181673..181675))
                     /locus_tag="ECL_00184"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    complement(order(181244..181246,181466..181468,
                     181472..181474))
                     /locus_tag="ECL_00184"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(181750..182610)
                     /locus_tag="ECL_00185"
                     /db_xref="GeneID:9122696"
     CDS             complement(181750..182610)
                     /locus_tag="ECL_00185"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hexulose-6-phosphate isomerase"
                     /protein_id="YP_003610702.1"
                     /db_xref="GeneID:9122696"
                     /translation="MRQHPLGIYEKALPKSLTWPERLVLAKSCGFDFVEMSVDETDER
                     LSRLAWSTTQRASLVEAMLETGVSIPSMCLSAHRRFPFGSRDETVRARAREIMSSAIK
                     LARDLGIRTIQLAGYDVYYEEHDEGTRQRFAEGLAWAVEQAAAAQVMVAVEIMDTAFM
                     NSISKWKKWDEMLASPWFSVYPDVGNLSAWGNNVAAELTLGIDRIAAIHLKDTQPVTA
                     QSPGQFRDVPFGEGCVDFVGVFNTLNKLNYRGAFLIEMWTEKAKEPVLEIIQARRWIE
                     ARMQEGGMTC"
     misc_feature    complement(181756..182607)
                     /locus_tag="ECL_00185"
                     /note="putative L-xylulose 5-phosphate 3-epimerase;
                     Reviewed; Region: PRK13210"
                     /db_xref="CDD:237308"
     gene            complement(182613..183266)
                     /locus_tag="ECL_00186"
                     /db_xref="GeneID:9122697"
     CDS             complement(182613..183266)
                     /locus_tag="ECL_00186"
                     /codon_start=1
                     /transl_table=11
                     /product="3-keto-L-gulonate-6-phosphate decarboxylase"
                     /protein_id="YP_003610703.1"
                     /db_xref="GeneID:9122697"
                     /translation="MSRPLLQLALDHTSLQAAQRDVARLSDHVDIIEAGTILCLTEGL
                     NAVRALREQCPGKTLVADWKVADAGETLAEQAFGAGANWMTIICAAPLATVEKGHAVA
                     LRCGGEIQMELFGYWTLDDARAWHRIGVKQAIYHRGRDAQASGQQWGEADLARMKALS
                     DIGLQLSVTGGITPADLPLFKQINVKAFIAGRALADAANPPQVAEAFHSQIRDIWGA"
     misc_feature    complement(182616..183266)
                     /locus_tag="ECL_00186"
                     /note="3-keto-L-gulonate-6-phosphate decarboxylase;
                     Provisional; Region: sgbH; PRK13305"
                     /db_xref="CDD:183962"
     gene            complement(183263..184768)
                     /locus_tag="ECL_00187"
                     /db_xref="GeneID:9122698"
     CDS             complement(183263..184768)
                     /locus_tag="ECL_00187"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610704.1"
                     /db_xref="GeneID:9122698"
                     /translation="MSEKEPFWLGIDCGGTYLKAGLYTREGKEVCIERRTVATLSPRA
                     GYAERDMNQLWQQCHTTVALLLNNARVSGEQIKGVGISAQGKGLFLLDKQDRPLGNAM
                     LSSDRRALDIVQRWQQDGIPEKLYPHTRQTLWTGHPASLLRWVKENEPQRYQQIGCVM
                     MAHDYLRWCLTGVKGCEESNISESNLYNMNTGQYDPQLTRWLGISEIDNALPPVVGSA
                     EICGEITAQAAALTGLATGTPVVGGLFDVVSTAICAGLHDEHTLNAVMGTWAVTSGIA
                     NALRDNEPHPYVYGRYVHPQQYIVHEASPTSSGNLEWLTAQWGEMSFSEINRAVASLP
                     KAESDLLFLPFLYGSNAGLEMTSGFYGMQALHTRAHLLQAVYEGVVFSHMTHLNRMLE
                     RFTYVQALRVTGGPTHSDVWMQMLADVSGLAIALPQVEETGCSGAALAALVGTGVYPD
                     FYAAQHALRHDIRVIEPDMHAHAAYQRKYQRYQLLISALQGYHARVKEHDL"
     misc_feature    complement(183431..184750)
                     /locus_tag="ECL_00187"
                     /note="L-xylulose kinases; a subfamily of the FGGY family
                     of carbohydrate kinases; Region: FGGY_L-XK; cd07802"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(183446..183451,183455..183460,
                     183464..183472,183833..183835,183857..183859,
                     183863..183865,183872..183874,183887..183904,
                     183917..183925,183956..183958,183965..183967,
                     184022..184033,184043..184054,184109..184114,
                     184118..184123,184193..184195,184202..184204,
                     184208..184210,184223..184225,184232..184240,
                     184358..184363,184439..184441,184457..184459,
                     184517..184540,184673..184675,184682..184690,
                     184697..184702,184706..184708,184712..184714,
                     184721..184729,184733..184750))
                     /locus_tag="ECL_00187"
                     /note="putative N- and C-terminal domain interface
                     [polypeptide binding]; other site"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(183470..183472,183542..183544,
                     183548..183556,183803..183805,183833..183835,
                     183845..183847,183956..183958,183965..183973,
                     184028..184033,184457..184459,184511..184513,
                     184517..184519,184712..184714,184718..184729,
                     184733..184735))
                     /locus_tag="ECL_00187"
                     /note="putative active site [active]"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(183542..183544,183548..183556,
                     183794..183796,183800..183805,183833..183838,
                     183842..183847,183965..183973,184031..184033,
                     184712..184714,184718..184729,184733..184735))
                     /locus_tag="ECL_00187"
                     /note="MgATP binding site [chemical binding]; other site"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(184031..184033,184724..184726,
                     184733..184735))
                     /locus_tag="ECL_00187"
                     /note="catalytic site [active]"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(184031..184033,184733..184735))
                     /locus_tag="ECL_00187"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:212666"
     misc_feature    complement(order(183863..183865,184028..184033,
                     184457..184459,184511..184513,184517..184519))
                     /locus_tag="ECL_00187"
                     /note="putative xylulose binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212666"
     gene            complement(184905..186224)
                     /locus_tag="ECL_00188"
                     /db_xref="GeneID:9122699"
     CDS             complement(184905..186224)
                     /locus_tag="ECL_00188"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator family transporter"
                     /protein_id="YP_003610705.1"
                     /db_xref="GeneID:9122699"
                     /translation="MNTSTQALHADIPRQRWLRIIPPILIACIISYMDRVNIAFAMPG
                     GMDEELGISATMAGLAGGIFFIGYLFLQVPGGKIAVHGSGKKFIGWSLVAWAVISVLT
                     GLVTSQYQLLVLRFLLGVAEGGMLPVVLTMISNWFPDAERGRANAIVIMFVPIAGIIT
                     APLSGWIITALDWRWLFIIEGLMSIVVLVLWAFTVYDRPQEARWISEAEKNYLVKTLA
                     AEQQAIAGKEVKNASLSAVLSDKTMWQLIALNFFYQTGIYGYTLWLPTILKELTHTSI
                     GQVGVLAILPYIGAIAGMFLFSSLSDRTGKRKLFVSLPLIGFALCMFLSVALKEHTWL
                     AYAALVGCGFFLQSAAGVFWTIPARLFSAEMAGGARGVINALGNLGGFCGPYAVGVLI
                     TLYSKDAGVYCLAVSLALASLLALLLPAKCDAGAEPNPTVNSHKRAA"
     misc_feature    complement(185019..186149)
                     /locus_tag="ECL_00188"
                     /note="Sugar phosphate permease [Carbohydrate transport
                     and metabolism]; Region: UhpC; cl27298"
                     /db_xref="CDD:332119"
     gene            complement(186270..187196)
                     /locus_tag="ECL_00189"
                     /db_xref="GeneID:9122700"
     CDS             complement(186270..187196)
                     /locus_tag="ECL_00189"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610706.1"
                     /db_xref="GeneID:9122700"
                     /translation="MTNTGFIIGAYPCAPSFHQKGEQEEQTFWRELSDTPHIRGLEQP
                     CLEHLHPYGDEWLFRHTPGEWQIVVTAVMETMRRRGTNGAFGLASADEDQRKASVEFY
                     RHLCQKIAAVNARFPGKVIALEMQAAPQAGNASVEQAIEAFARSIREIAGWDWSCDLV
                     LEHCDAMTGPAPRKGFLPLEQVLEVIKETDISICINWARSAIEGRNTTLPVEHVQTAL
                     QAGKLAALMFSGTTIRGEYGEWQDLHAPFSSYCADSLMTTEHAKALFTAASAATLKFS
                     GIKLLEINANADISHRIAILRDGISQMKKATQ"
     misc_feature    complement(186312..187178)
                     /locus_tag="ECL_00189"
                     /note="Domain of unknown function (DUF4862); Region:
                     DUF4862; pfam16154"
                     /db_xref="CDD:318399"
     gene            complement(187348..187815)
                     /locus_tag="ECL_00190"
                     /db_xref="GeneID:9122701"
     CDS             complement(187348..187815)
                     /locus_tag="ECL_00190"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610707.1"
                     /db_xref="GeneID:9122701"
                     /translation="MIFGHISQPNPCRLPRAIEKALDFLRTTDFSMLKPGVVEIEGRN
                     LFAQILDLTTKEPHENRPEVHRHYLDIQFLAWGEEKIGIAIDTGNNNISESLLEQRDI
                     IFYHNSENESFIEMVPGSYAIFFPQDVHRPACIKNKETAIRKIVVKVALSELD"
     misc_feature    complement(187405..187815)
                     /locus_tag="ECL_00190"
                     /note="Domain of unknown function (DUF386); Region:
                     DUF386; cl01047"
                     /db_xref="CDD:321314"
     gene            complement(187826..188824)
                     /locus_tag="ECL_00191"
                     /db_xref="GeneID:9122702"
     CDS             complement(187826..188824)
                     /locus_tag="ECL_00191"
                     /codon_start=1
                     /transl_table=11
                     /product="3-dehydro-L-gulonate 2-dehydrogenase"
                     /protein_id="YP_003610708.1"
                     /db_xref="GeneID:9122702"
                     /translation="MKVTFEELKAAFNRVLLDRGVKAETADACAEMFARTTESGVYSH
                     GVNRFPRFIQQLDAGDIIPDAQPKRVTTLGAIEQWDAQRAIGNLTAKKMMDRATELAS
                     DHGIGLVALRNANHWMRGGSYGWQAAEKGYIGICWTNSIAVMPAWGSKECCIGTNPLI
                     VAIPSSPITMVDMSMSMFSYGMLEVNRLAGRTLPVDGGFDDEGNLTKEPGVIEKNRRI
                     LPMGYWKGSGLSIVLDMIATLLSNGSSVAEVTQDNSDEYGVSQIFIAIEVDRLIDGPT
                     RDAKLQRIMDFITTAERADENVAVRLPGHEFTRLLEENRRNGITIDDSVWAKIQAL"
     misc_feature    complement(187829..188824)
                     /locus_tag="ECL_00191"
                     /note="2,3-diketo-L-gulonate reductase; Provisional;
                     Region: PRK13260"
                     /db_xref="CDD:183926"
     gene            189050..189868
                     /locus_tag="ECL_00192"
                     /db_xref="GeneID:9122703"
     CDS             189050..189868
                     /locus_tag="ECL_00192"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610709.1"
                     /db_xref="GeneID:9122703"
                     /translation="MSMKESDMTQEKERPAGSQSLFRGLMLIEILSNYPNGCPLAHLS
                     ELAGLNKSTVHRLLQGLQSCGYVTPAPAAGSYRLTTKFIAVGQKALSSLNIIHVAAPH
                     LESLNIATGETVNFSSREDDHAILIYKLEPTTGMLRTRAYIGQHMPLYCSAMGKIYMA
                     FGHQDYVASYWESHQDQIQPLTRNTITELSAMYDELAEIREHSMAMDKEENELGVSCI
                     AVPVFDIHGRVPYAISISLSTSRMKQIGEKNLLTPLRETADAISRELGFNVREG"
     misc_feature    189104..189847
                     /locus_tag="ECL_00192"
                     /note="DNA-binding transcriptional regulator, IclR family
                     [Transcription]; Region: IclR; COG1414"
                     /db_xref="CDD:224332"
     gene            189872..190327
                     /locus_tag="ECL_00193"
                     /db_xref="GeneID:9122704"
     CDS             189872..190327
                     /locus_tag="ECL_00193"
                     /codon_start=1
                     /transl_table=11
                     /product="putative hydrogenase, 4Fe-4S ferredoxin-type
                     component"
                     /protein_id="YP_003610710.1"
                     /db_xref="GeneID:9122704"
                     /translation="MNRFIMADSAKCIGCRTCEVACVVSHQDAISTDAFTPRIRVVKG
                     DAFTTAVGCHQCEDAPCANVCPTQAIRRGEGAWQVEQARCIGCKRCMVACPFGAMQVQ
                     WAGDTLQALKCDLCAHRADGPACVEACPTHALSCVDPARLRTERLRHLA"
     misc_feature    189872..190324
                     /locus_tag="ECL_00193"
                     /note="Fe-S-cluster-containing hydrogenase component 2
                     [Energy production and conversion]; Region: HycB; COG1142"
                     /db_xref="CDD:224065"
     gene            complement(190332..191588)
                     /locus_tag="ECL_00194"
                     /db_xref="GeneID:9122705"
     CDS             complement(190332..191588)
                     /locus_tag="ECL_00194"
                     /codon_start=1
                     /transl_table=11
                     /product="valine--pyruvate transaminase"
                     /protein_id="YP_003610711.1"
                     /db_xref="GeneID:9122705"
                     /translation="MTFSLFGDKFTRHSGITRLMEDLNDGLRTPGAIMLGGGNPAQIP
                     EMNTYFQTLLAQMLENGKATDALCNYDGPQGKTELLKLLADMLREELGWDIEPQNIAL
                     TNGSQSAFFYLFNLFAGRRADGTTKKVLFPLAPEYIGYADSGLEEDLFVSARPNIELL
                     PEGQFKYHVDFEHLHIGEETGMICVSRPTNPTGNVITDDELMKLDALANQHGIPLVID
                     NAYGVPFPGIIFSEARPLWNPNIVLCMSLSKLGLPGSRCGIIVANEKIITAITNMNGI
                     ISLSPGGIGPAMMCEMIKRNDLLRLSNDVIKPFYYQRVQETIAILRRYLPEERCLIHK
                     PEGAIFLWLWFKDLPITTELLYQRLKKRGVLMVPGDYFFPGLDKPWPHTHQCMRMNYV
                     PDPEKIEAGVKILAEEIEFAWREDVQ"
     misc_feature    complement(190344..191588)
                     /locus_tag="ECL_00194"
                     /note="valine--pyruvate transaminase; Provisional; Region:
                     avtA; PRK09440"
                     /db_xref="CDD:236517"
     gene            complement(191683..193812)
                     /locus_tag="ECL_00195"
                     /db_xref="GeneID:9122706"
     CDS             complement(191683..193812)
                     /locus_tag="ECL_00195"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic alpha-amylase"
                     /protein_id="YP_003610712.1"
                     /db_xref="GeneID:9122706"
                     /translation="MKRTAVAFLMLPALAHADWSSPGFNAFSAEGTGMFTSQAKLAKG
                     TRPLTVSFDNTCWQPTEAIKLNEMLSLKPCDGTPPQWRLFRDGEYQMRVDTRSGTPTL
                     MLTIKSAAEQPVANVIRQCPKWDGKPLTLEVGNTFPEGSVVRDFYSKQTATVQQGKIT
                     LQPAANSNGLLLLERAETDKPAPFSWQNATVYFVLTDRFVNGDPTNDNSYGRHKDGMQ
                     EIGTFHGGDLKGLASKLDYLQQLGVNALWISSPLEQIHGWVGGGTKGDFPHYAYHGYY
                     TQDWTRLDANMGTEDDLRHLVDEAHKRGIRILFDIVMNHVGYATLADMQEYQFGALYL
                     QGDELKKTLGARWTDWKPGTGQSWHSFNDYINFSDKAAWEKWWGNKWIRTDIGDYDNP
                     GFDDLTMSLAFLPDLKTESTTPSGLPNFYQHKPDTQAKAIPGYTPRDYLTHWLSQWVR
                     EYGIDGFRVDTAKHVELAAWQQLKDQASQALAAWKGAHPDKKLDNAPFWMTGESWGHG
                     VMQSDYYRHGFDAMINFDYQEQAAKAVNCLADIDLTWQQMAEKLQSFNVLSYLSSHDT
                     RLFREGGQRAAELLLLAPGSVQIYYGDESERPFGPTGSDPLQGTRSDMNWQDVTGKQA
                     LTVAHWQTLGQFRARHPAIGEGKQTTLSLKEGYGFVREHDGDKVMVVWAGTNSPLIAV
                     FSLSHGERAGVRGTHQNYSLQKSTPAT"
     misc_feature    complement(191791..193812)
                     /locus_tag="ECL_00195"
                     /note="alpha-amylase; Reviewed; Region: malS; PRK09505"
                     /db_xref="CDD:236543"
     misc_feature    complement(191893..193245)
                     /locus_tag="ECL_00195"
                     /note="Alpha amylase catalytic domain family; Region:
                     AmyAc_family; cl07893"
                     /db_xref="CDD:298606"
     misc_feature    complement(order(192118..192123,192304..192306,
                     192433..192435,192439..192441,192868..192870))
                     /locus_tag="ECL_00195"
                     /note="active site"
                     /db_xref="CDD:200451"
     misc_feature    complement(order(192118..192120,192304..192306,
                     192433..192435))
                     /locus_tag="ECL_00195"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200451"
     gene            194379..194951
                     /locus_tag="ECL_00196"
                     /db_xref="GeneID:9122707"
     CDS             194379..194951
                     /locus_tag="ECL_00196"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610713.1"
                     /db_xref="GeneID:9122707"
                     /translation="MPYITSQNAAITADRNWLIAKQYDSRWTPSERARLKDIAKRYKV
                     SWNGNTRRVPWNSLLERVDIIPGSMVATMAAAESGWGTSKLARNNNNLFGMKCVKGRC
                     KNAPGKVKGYSQFESVKDSVNAYVVNLNTHPAYSSFRKSRAQLRKADQEVTASTMIHK
                     LKGYSTQGQRYNNYLFAMYQDNQRLIAAHM"
     misc_feature    <194379..194948
                     /locus_tag="ECL_00196"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10356"
                     /db_xref="CDD:182404"
     misc_feature    194505..194894
                     /locus_tag="ECL_00196"
                     /note="Mannosyl-glycoprotein
                     endo-beta-N-acetylglucosaminidase; Region:
                     Glucosaminidase; cl23834"
                     /db_xref="CDD:304991"
     gene            complement(194989..196167)
                     /locus_tag="ECL_00197"
                     /db_xref="GeneID:9122708"
     CDS             complement(194989..196167)
                     /locus_tag="ECL_00197"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_003610714.1"
                     /db_xref="GeneID:9122708"
                     /translation="MFEKRHRITLLFNANKAYDRQVVEGVGEYLQASQSEWDIFIKED
                     FRTRLENIKDWLGDGVIADYDDPVIEQLLTDVDVPIVGVGGSYHSPEHYPPVHYIATD
                     NHALVESAFLHLKEKGVHRFAFYGLPASSGKRWAVEREHAFCQLVAQEKYRGVVYQGL
                     ETAPENWQHAQNRLADWLQTLPPQTGIIAVTDARARHVLQVCEHLHIPVPEKLCVIGI
                     DNEELTRYLSRVALSSVAQGTRQMGYQAAKLLHRLLDNESLPLQRLLVPPVRVVERRS
                     TDYRSLNDPAVIQAMHFIRNHACKGIKVDQVLDSVGISRSNLEKRFKEEVGETIHAVI
                     HAEKLEKARSLLISTSLSINEISQMCGYPSLQYFYSVFRKEYDNTPKEYRERHSEVMM
                     "
     misc_feature    complement(195337..196149)
                     /locus_tag="ECL_00197"
                     /note="Ligand-binding domain of DNA transcription
                     repressor specific for xylose (XylR); Region: PBP1_XylR;
                     cd01543"
                     /db_xref="CDD:107256"
     misc_feature    complement(order(195556..195561,195568..195570,
                     195580..195582,195664..195666,196000..196008,
                     196015..196017,196024..196026,196039..196041,
                     196045..196059,196084..196089,196093..196098,
                     196105..196113,196147..196149))
                     /locus_tag="ECL_00197"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107256"
     misc_feature    complement(order(195457..195459,195511..195513,
                     195673..195675,195751..195753,195865..195867,
                     195916..195918,195979..195981,196102..196104,
                     196111..196116))
                     /locus_tag="ECL_00197"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107256"
     misc_feature    complement(194992..195387)
                     /locus_tag="ECL_00197"
                     /note="AraC-type DNA-binding domain and AraC-containing
                     proteins [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     gene            complement(196201..197382)
                     /locus_tag="ECL_00198"
                     /db_xref="GeneID:9122709"
     CDS             complement(196201..197382)
                     /locus_tag="ECL_00198"
                     /codon_start=1
                     /transl_table=11
                     /product="inner-membrane translocator"
                     /protein_id="YP_003610715.1"
                     /db_xref="GeneID:9122709"
                     /translation="MSKSNPSDIKVAVQTPGAFAGLKALNLQVFVMIAAIIAIMLFFT
                     WMTDGSYLSARNVSNLLRQTAITGILAVGMVFVIISAEIDLSVGSMMGLLGGVAAIFD
                     VWLGWPLPLTVAVTLVLGLVLGAWNGWWVAYRKVPSFIVTLAGMLAFRGVLIGITNGT
                     TVSPTSAAMSQIGQSYLSDSMGFTIGVVGLLAFVVWQWRGRMRRQSLGLASSPSTSVV
                     GRQALTAVIVLGAIWLLNDYRGVPTPVLLLALLLLGGMFMATRTAFGRRIYAIGGNLE
                     AARLSGINVERTKLAVFAINGLMVAIAGLILSSRLGAGSPSAGNIAELDAIAACVIGG
                     TSLAGGVGSVAGAVMGAFIMASLDNGMSMMDVPTFWQYIVKGAILLLAVWMDSATKRR
                     T"
     misc_feature    complement(196207..197343)
                     /locus_tag="ECL_00198"
                     /note="ABC-type xylose transport system, permease
                     component [Carbohydrate transport and metabolism]; Region:
                     XylH; COG4214"
                     /db_xref="CDD:226669"
     gene            complement(197360..198901)
                     /locus_tag="ECL_00199"
                     /db_xref="GeneID:9122710"
     CDS             complement(197360..198901)
                     /locus_tag="ECL_00199"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose transporter ATP-binding subunit"
                     /protein_id="YP_003610716.1"
                     /db_xref="GeneID:9122710"
                     /translation="MPYLLEMKSITKRFGAVKAVDNVSLRLNPGEVVSLCGENGSGKS
                     TLMKVLCGIYPHGSYEGEIVFAGEVIQATHIRDTERKGIAIIHQELALVKHLTVLENI
                     FLGAEISRHGVLDYDTMTLRCEKLLAQVSLAISPDTRVGDLGLGQQQLVEIAKALNKQ
                     VRLLILDEPTASLTEQETAVLLDIIRDLQNHGIACIYISHKLNEVKAISDTICVIRDG
                     QHIGTREAEGMSEDDIITMMVGRELTALYPNEPHTTGDEVLRVENLTAWHPVNRHIKR
                     VNNISFSLHRGEILGVAGLVGAGRTEAVQCLFGVWPGRWEGTVYIDGKPVKIDNCQQA
                     IAHGIAMVPEDRKKDGIVPVMAVGKNITLAALDQFSGALSSLDDAAEQQCILQSLARL
                     KVKTSSPELAIGRLSGGNQQKAILARCLLLNPRILILDEPTRGIDIGAKYEIYKLINQ
                     LVQQGIAVIVISSELPEVLGLSDRVLVMHEGKLKANLINQNLTQEQVMEAALRSERHV
                     EKQSV"
     misc_feature    complement(197384..198901)
                     /locus_tag="ECL_00199"
                     /note="xylose transporter ATP-binding subunit;
                     Provisional; Region: PRK13549"
                     /db_xref="CDD:184134"
     gene            complement(198974..199966)
                     /locus_tag="ECL_00200"
                     /db_xref="GeneID:9122711"
     CDS             complement(198974..199966)
                     /locus_tag="ECL_00200"
                     /codon_start=1
                     /transl_table=11
                     /product="D-xylose transporter subunit XylF"
                     /protein_id="YP_003610717.1"
                     /db_xref="GeneID:9122711"
                     /translation="MKIKNLTLTLCTTLLLASFAGHAKEVKIGMAIDDLRLERWQKDR
                     DIFVKKAESLGASVFVQSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEA
                     KQEGIKVLAYDRMINNADIDYYISFDNEKVGELQAKSLVDKVPQGNYFLMGGSPVDNN
                     AKLFREGQMKVLKPYIDSGKIKVVGDQWADGWLPENALKIMENALTANNNKIDAVVAS
                     NDATAGGAIQALSAQGLAGKVAISGQDADLAGVKRIIAGTQTMTVYKPITELANTAAE
                     IAVELGNGKQPKADATLNNGLKDVPARLLTPIEVNKENIDATVIKDGFHKKSEL"
     misc_feature    complement(198977..199966)
                     /locus_tag="ECL_00200"
                     /note="D-xylose transporter subunit XylF; Provisional;
                     Region: xylF; PRK10355"
                     /db_xref="CDD:182403"
     misc_feature    complement(order(199172..199174,199232..199234,
                     199475..199477,199628..199630,199850..199852))
                     /locus_tag="ECL_00200"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107251"
     gene            200274..201659
                     /locus_tag="ECL_00201"
                     /db_xref="GeneID:9122712"
     CDS             200274..201659
                     /locus_tag="ECL_00201"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase"
                     /protein_id="YP_003610718.1"
                     /db_xref="GeneID:9122712"
                     /translation="MSIHYYSCINDSPHTLIMELNMQAYFDQLDRVRYEGPKTTNPLA
                     FRHYNPDELVLGKRMEDHLRFAACYWHTFCWNGADMFGVGSFDRPWQQPGEAIELAKR
                     KADVAFEFFHKLNVPYYCFHDVDVSPEGASLKEYLNNFAQMVDVLAAKQQQSGVKLLW
                     GTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMNATHQLGGENYVLWGGREGYETL
                     LNTDLRQEREQIGRFMQMVVEHKHKIGFRGTLLIEPKPQEPTKHQYDYDVATVYGFLK
                     QFGLEKEIKVNIEANHATLAGHSFHHEIASAIALGIFGSVDANRGDAQLGWDTDQFPN
                     SVEENALVMYEIIKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAMDTMALALKVAA
                     RMIEDGELDKRVAKRYSGWNSELGQQILKGQLSLAEIAKYAEQHQLAPQHQSGHQELL
                     ENLVNHYLFDK"
     misc_feature    200343..201653
                     /locus_tag="ECL_00201"
                     /note="xylose isomerase; Provisional; Region: PRK05474"
                     /db_xref="CDD:235487"
     gene            201719..203173
                     /locus_tag="ECL_00202"
                     /db_xref="GeneID:9122713"
     CDS             201719..203173
                     /locus_tag="ECL_00202"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610719.1"
                     /db_xref="GeneID:9122713"
                     /translation="MYIGIDLGTSGVKAILLSEQGDVLATQTEKLQVSRPHPLWSEQD
                     PEQWWQATDRAIKGLGAQHSLREVTALGIAGQMHGATLLDSQHRVLRPAILWNDGRCA
                     EECALLEERVPASRDITGNLMMPGFTAPKLLWVQRHEPEIFRQVAKVLLPKDYLRFRM
                     TGDFASDMSDAAGTMWLDVAKRDWSEAMLDACHLTREHMPALFEGSEITGTLQSAVAE
                     RWNMPAVPVVAGGGDNAAGAVGVGMVDAGQAMLSLGTSGVYFAVSDGYRSNPESAVHS
                     FCHALPGKWHLMSVMLSAASCLDWAAKLTGMADVPALITAAQQADENAGTVWFLPYLS
                     GERTPHNNPEAKGVFFGLTHQHGPAELARAVLEGVGYALADGMDVVHDCGLNPASITL
                     IGGGARSSYWRQMLSDISGLQLDYRTGGDVGPALGAARLAQIAMNPEKPLSQLLPQLT
                     LEQAHLPDATRHARYAERRDVFRKIYQQLLPLMS"
     misc_feature    201719..203170
                     /locus_tag="ECL_00202"
                     /note="xylulokinase; Provisional; Region: PRK15027"
                     /db_xref="CDD:184987"
     gene            203277..203816
                     /locus_tag="ECL_00203"
                     /db_xref="GeneID:9122714"
     CDS             203277..203816
                     /locus_tag="ECL_00203"
                     /codon_start=1
                     /transl_table=11
                     /product="isochorismatase hydrolase"
                     /protein_id="YP_003610720.1"
                     /db_xref="GeneID:9122714"
                     /translation="MSRIALINIDTQQSFHHRDYWQEQDVPAFEQAMLGLTEGCQSRG
                     IPVVDIFHVDEKGPFSLQSGYVKPMAFLRHQPDVVFQKHVHNAFTDTGLDRWLRERDI
                     NQLILCGIRTEQCCETTARVASDLGYAVTFVSEAMLTFPMTYKGVTLSAAEIRHRTET
                     VLSGRFAAIKTVAETLESL"
     misc_feature    203289..203750
                     /locus_tag="ECL_00203"
                     /note="Cysteine hydrolases; This family contains
                     amidohydrolases, like CSHase (N-carbamoylsarcosine
                     amidohydrolase), involved in creatine metabolism and
                     nicotinamidase, converting nicotinamide to nicotinic acid
                     and ammonia in the pyridine nucleotide cycle. It...;
                     Region: cysteine_hydrolases; cl00220"
                     /db_xref="CDD:320830"
     misc_feature    order(203304..203306,203520..203522,203619..203621)
                     /locus_tag="ECL_00203"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238245"
     misc_feature    203604..203609
                     /locus_tag="ECL_00203"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238245"
     gene            203816..204736
                     /locus_tag="ECL_00204"
                     /db_xref="GeneID:9122715"
     CDS             203816..204736
                     /locus_tag="ECL_00204"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_003610721.1"
                     /db_xref="GeneID:9122715"
                     /translation="MRIDVWFVMLPGVLSLDMTGPAETFVLAGDAFRLHYIGPQPEVQ
                     TSIGLMMSGIAPLPERLPEGSLLVLPGVSDSRVQFSTPQAMQIQHWLMRLQPAIQRQD
                     ITVMCVCSGALLAAKSGLLNNRQCTTHHEVIGRLRAAVPTATIKENRIFVQDENVWTS
                     AGITSGIDLALHMINRLCGPEKALAVAREMVVWFRRSGDDPQLSPWLRYRNHLHPAIH
                     RAQDALTADPQKAWNVPDIAALAHVSPRHLTRLFQTHLGISVRDYLEQLRLAVAEQWL
                     LQGRGVEQSSLAAGFSSPRQFHRARQRVVN"
     misc_feature    203816..204724
                     /locus_tag="ECL_00204"
                     /note="Helix-turn-helix domain; Region: HTH_18; cl26291"
                     /db_xref="CDD:331112"
     gene            complement(204729..205724)
                     /locus_tag="ECL_00205"
                     /db_xref="GeneID:9122716"
     CDS             complement(204729..205724)
                     /locus_tag="ECL_00205"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase 3"
                     /protein_id="YP_003610722.1"
                     /db_xref="GeneID:9122716"
                     /translation="MQSKISWIDNLRGIACLMVVMIHTTTWYVTNAHSISPVNWDVAN
                     ILNSASRVSVPLFFMISGFLFFGERSAQPRHFIRIAACLGFYSAVALIYITLFTSISP
                     GLSLKYLLQKPVFYHLWFFFAIIVIYLVSPLIQVKNVSGKMLLALMVVIGIIANPNTV
                     SQKIDGFEWLPVNLYINGDTFYYVLYGMLGRAIGMMDTQKRGISWLCGALFIIGVIII
                     SRGTLHELQWRGNFADTWYLYCGPMVFICAVSLLTLVKNTLNARPLPVLGFISRHSLG
                     IYGFHALVIHALRTRGVELKSWPVLDIVWIFSVTLVVSLLLSMLLQKLDTRRFVS"
     misc_feature    complement(204732..205724)
                     /locus_tag="ECL_00205"
                     /note="Surface polysaccharide O-acyltransferase, integral
                     membrane enzyme [Cell wall/membrane/envelope biogenesis];
                     Region: WecH; COG3274"
                     /db_xref="CDD:225813"
     gene            205908..206213
                     /locus_tag="ECL_00206"
                     /db_xref="GeneID:9122717"
     CDS             205908..206213
                     /locus_tag="ECL_00206"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610723.1"
                     /db_xref="GeneID:9122717"
                     /translation="MMMKRVGSLFLLVVLAGCSTPQEAPAQKAQQGKMSPERSLNMEQ
                     LCKDQAAHRYNLDTQKIDVTGSERFQGSYELRGHTSRKEGFVCSFDADGQFLHLSMR"
     misc_feature    205908..>206042
                     /locus_tag="ECL_00206"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; cl11507"
                     /db_xref="CDD:325065"
     misc_feature    205986..206210
                     /locus_tag="ECL_00206"
                     /note="YsaB-like lipoprotein; Region: YsaB; pfam13983"
                     /db_xref="CDD:316497"
     gene            206374..207285
                     /locus_tag="ECL_00207"
                     /db_xref="GeneID:9122718"
     CDS             206374..207285
                     /locus_tag="ECL_00207"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit alpha"
                     /protein_id="YP_003610724.1"
                     /db_xref="GeneID:9122718"
                     /translation="MQKFDTKTFQGLILTLQDYWARQGCTIVQPLDMEVGAGTSHPMT
                     SLRALGPEPMATAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSL
                     KELGMDPTIHDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPIT
                     GEITYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEYADVDF
                     LFTCFEQYEKEAQQLLALETPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRI
                     RTLTKAVAEAYYASREALGFPMCNRNK"
     misc_feature    206386..207249
                     /locus_tag="ECL_00207"
                     /note="glycyl-tRNA synthetase subunit alpha; Validated;
                     Region: glyQ; PRK09348"
                     /db_xref="CDD:236473"
     misc_feature    order(206401..206403,206413..206415,206425..206427,
                     206449..206454,206458..206460,206464..206475,
                     206521..206523,206548..206550,206560..206562,
                     206608..206610,206926..206928,206977..206979,
                     206986..206991,207010..207012,207016..207018,
                     207025..207027,207034..207039,207046..207051,
                     207058..207060,207067..207069,207079..207081,
                     207091..207102,207109..207111,207121..207123)
                     /locus_tag="ECL_00207"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238375"
     misc_feature    206446..206469
                     /locus_tag="ECL_00207"
                     /note="motif 1; other site"
                     /db_xref="CDD:238375"
     misc_feature    order(206482..206484,206488..206490,206563..206565,
                     206611..206613,206617..206619,206623..206631,
                     206794..206799,206809..206811,206857..206862,
                     206866..206871,206875..206880)
                     /locus_tag="ECL_00207"
                     /note="active site"
                     /db_xref="CDD:238375"
     misc_feature    206560..206571
                     /locus_tag="ECL_00207"
                     /note="motif 2; other site"
                     /db_xref="CDD:238375"
     misc_feature    206869..206880
                     /locus_tag="ECL_00207"
                     /note="motif 3; other site"
                     /db_xref="CDD:238375"
     gene            207295..209364
                     /locus_tag="ECL_00208"
                     /db_xref="GeneID:9122719"
     CDS             207295..209364
                     /locus_tag="ECL_00208"
                     /codon_start=1
                     /transl_table=11
                     /product="glycyl-tRNA synthetase subunit beta"
                     /protein_id="YP_003610725.1"
                     /db_xref="GeneID:9122719"
                     /translation="MSEKTFLVEIGTEELPPKALRSLAESFAANVTAELDNAGLAHGK
                     IEWFAAPRRLALKVANLAASQPDREVEKRGPAIAQAFDAEGKPSKAAEGWARGCGITV
                     DQAERLTTDKGEWLLYRAHVKGERAEALLPNMIATSLAKLPIPKLMRWGASDVHFVRP
                     VHTVTLLLGDTVIPATILGVASDRVIRGHRFMGEPEFTIDNADQYPQILLERGKVIAD
                     YEQRKAKIKADAEEAARKIGGNADLSDSLLEEVTSLVEWPVVLTAKFEEKFLAVPAEA
                     LVYTMKGDQKYFPVYANDGKLLPNFIFVANIESKDPQQIISGNEKVVRPRLADAEFFF
                     NTDRKKRLEDNLPRLQTVLFQQQLGTLRDKTDRIAELSGWIAREIGADVNHATRAGLL
                     SKCDLMTNMVFEFTDTQGVMGMHYARHDGEAEDVAVALNEQYQPRFAGDELPSNPVAC
                     AVAIADKMDTLAGIFGIGQHPKGDKDPFALRRAALGVLRIIVEKNLNLDLQTLTEEAV
                     RLYGDKLTNANVVDDVIDFMLGRFRAWYQDEGYTVDTIQAVLARRPTRPADFDARMKA
                     VSHFRTLEAASALAAANKRVSNILAKSDETLNERVNAATLKEPEEIALAMQVVVLRDK
                     LEPYFAEGRYQEALVELAELRDVIDAFFEKVMVNVEDKDLRINRLSMLEKLRELFLRV
                     ADISLLQ"
     misc_feature    207295..209361
                     /locus_tag="ECL_00208"
                     /note="glycyl-tRNA synthetase, tetrameric type, beta
                     subunit; Region: glyS; TIGR00211"
                     /db_xref="CDD:272962"
     gene            209597..211216
                     /locus_tag="ECL_00209"
                     /db_xref="GeneID:9122720"
     CDS             209597..211216
                     /locus_tag="ECL_00209"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003610726.1"
                     /db_xref="GeneID:9122720"
                     /translation="MAHFAQSPSFILHQVTCQFATGNILFGPLNLSLETSLCALVGRN
                     GSGKTRLLRMLAGLDEPASGHIERFASHVYVAQQQDISPQTTLAELLGYDAIFAARKR
                     IDRGDYQPDDLEMLDGYWDLAERLNEAFLQAKLPPFDPDKPAAEFSGGERIRALLCGA
                     FTAEADFLLLDEPTNHLDRQGRAWFYDQLRRYQGGVLVASHDRELLAQVPRILELSPS
                     GLRSYGGNYADYKQQRDAEQQAARAALEHAATERKRTRARMQKEHDDSQRRSAKTIRT
                     VDTLNIASFERVKYKAAAKERIGSWKKQHSDQNDVLNAAVNKARERVEEDAPIMFTLP
                     GSQIAEGKQVLVLEELQLPHVSLPPMNWRMDGPMRVALRGPNGCGKSTLLKVILGETA
                     PRAGSCKVSVTCAYLDQHLSQLDLTQSVMAHLNLSNTPLEEGTLRTRLAQLQLGADKV
                     SLPLAELSGGERLKAALACVLWREHATQLLLLDEPTNHLDLASVQAIEAALAGFPGAL
                     LVVSHDESFLQGLALTHELVWEETGWHCEGL"
     misc_feature    209615..211195
                     /locus_tag="ECL_00209"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     gene            complement(211263..211550)
                     /locus_tag="ECL_00210"
                     /db_xref="GeneID:9122721"
     CDS             complement(211263..211550)
                     /locus_tag="ECL_00210"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610727.1"
                     /db_xref="GeneID:9122721"
                     /translation="MEYKDPEFELLSSLEQIIFKDVPQTVTLQQKSNPFTEYEQLRKG
                     TGLKTDEFARAMGVSVAMVLEWESKREKPTPTELKLMRLIQANPALSKQIA"
     misc_feature    complement(211269..211550)
                     /locus_tag="ECL_00210"
                     /note="putative transcriptional regulator; Provisional;
                     Region: PRK10072"
                     /db_xref="CDD:182222"
     misc_feature    complement(order(211350..211352,211425..211427))
                     /locus_tag="ECL_00210"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    complement(order(211344..211349,211359..211361,
                     211368..211370,211401..211406))
                     /locus_tag="ECL_00210"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(211615..211785)
                     /locus_tag="ECL_00211"
                     /db_xref="GeneID:9122722"
     CDS             complement(211615..211785)
                     /locus_tag="ECL_00211"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610728.1"
                     /db_xref="GeneID:9122722"
                     /translation="MQNGYCHFISYSLQKNTWRSRHMVNQVISITIRIAETDKAIVTA
                     RLITSVMILRLY"
     gene            211882..212592
                     /locus_tag="ECL_00212"
                     /db_xref="GeneID:9122723"
     CDS             211882..212592
                     /locus_tag="ECL_00212"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane lipoprotein"
                     /protein_id="YP_003610729.1"
                     /db_xref="GeneID:9122723"
                     /translation="MATGKSCSRWFAPIAALLMVVSLSGCFDKEGDQRKAFIDFLQNT
                     VMRSGERLPTLTADQKKQFGPFVSDYAILYGYSQQVSQAMDSGIRPVVDSVNAIRVPQ
                     DYVTQREPLRQSNGALGVLSQQLQNAKMQADASRSALKQGDDLKPVFDKVYEKVVTKP
                     SDALQPLIPAAQIFTQQLVQVGDFISQQGTQVSFVANGIQFPTSQQASQYNTLIGPLA
                     SQHQAFSQAWSAAVAATE"
     misc_feature    211930..212574
                     /locus_tag="ECL_00212"
                     /note="Protein of unknown function (DUF3053); Region:
                     DUF3053; pfam11254"
                     /db_xref="CDD:314241"
     gene            212839..213051
                     /locus_tag="ECL_00213"
                     /db_xref="GeneID:9122724"
     CDS             212839..213051
                     /locus_tag="ECL_00213"
                     /codon_start=1
                     /transl_table=11
                     /product="major cold shock protein"
                     /protein_id="YP_003610730.1"
                     /db_xref="GeneID:9122724"
                     /translation="MSAKMTGLVKWFNADKGFGFITPDDGSKDVFVHFSAIQNDGYKS
                     LDEGQKVSFTIESGAKGPAAGNVVSL"
     misc_feature    212839..213048
                     /locus_tag="ECL_00213"
                     /note="RNA chaperone/anti-terminator; Provisional; Region:
                     PRK10354"
                     /db_xref="CDD:182402"
     misc_feature    order(212869..212871,212896..212898,212929..212931,
                     213016..213018)
                     /locus_tag="ECL_00213"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    order(212887..212907,212926..212937)
                     /locus_tag="ECL_00213"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            complement(213110..214084)
                     /locus_tag="ECL_00214"
                     /db_xref="GeneID:9122725"
     CDS             complement(213110..214084)
                     /locus_tag="ECL_00214"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase
                     NAD-binding protein"
                     /protein_id="YP_003610731.1"
                     /db_xref="GeneID:9122725"
                     /translation="MKPSVILYKALPDDLQKRLEEHFTVTQVKNLSPETVAQHAGAFA
                     RAEGLLGSSEKVDVALLEKMPKLRATSTVSVGYDNFDVDALNARNILLMHTPHALTET
                     VADTLMALMLSTARRVVEVAERVKAGEWTKSIGPDWFGVDVHGKTLGIVGMGRIGLAL
                     AQRAHFGFNMPILYNARRHHSEAEERFNARYCELDTLLQEADFVCLILPLTDETRHLI
                     GKAAFAKMKKSAIFINAGRGPVVDEKALIEALQNGEIHAAGLDVFEQEPLPVDSPLLS
                     LPNVVALPHIGSATHETRYNMAATAVDNLIAALNGNVEKNCVNPQVQQ"
     misc_feature    complement(213119..214084)
                     /locus_tag="ECL_00214"
                     /note="bifunctional glyoxylate/hydroxypyruvate reductase
                     B; Provisional; Region: PRK15409"
                     /db_xref="CDD:185307"
     gene            complement(214111..215391)
                     /locus_tag="ECL_00215"
                     /db_xref="GeneID:9122726"
     CDS             complement(214111..215391)
                     /locus_tag="ECL_00215"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_003610732.1"
                     /db_xref="GeneID:9122726"
                     /translation="MNSSTNAVKRWWYIMPIVFITYSLAYLDRANFSFASAAGITEDL
                     GITKGISSLLGALFFLGYFFFQIPGAIYAERRSVRKLIFVCLILWGACASLTGVVNNI
                     PALAAIRFILGVVEAAVMPAMLIYISNWFTKSERSRANTFLILGNPVTVLWMSVVSGY
                     LIQSFGWREMFIIEGVPAIIWAFCWWVLVKDKPAQAKWLSEDEKAALQAQLDKEQQGL
                     KAVRNYGEAFRSRNVILLCAQYFTWSIGVYGFVLWLPSIIRSGGENLGMVEVGWLSSV
                     PYLAATIAMIIVSWASDKLQNRKLFVWPLLLIAAFAFIGSWAVGANHFWVSYTLLVIA
                     GAAMYAPYGPFFAIIPEMLPRNVAGGAMALINSMGALGSFCGSWFVGYLNGATGSPSA
                     SYIFMGVALFASVWLTLIVKPANNQQLPVGARHA"
     misc_feature    complement(214159..215334)
                     /locus_tag="ECL_00215"
                     /note="Sugar phosphate permease [Carbohydrate transport
                     and metabolism]; Region: UhpC; cl27298"
                     /db_xref="CDD:332119"
     gene            complement(215508..216446)
                     /locus_tag="ECL_00216"
                     /db_xref="GeneID:9122727"
     CDS             complement(215508..216446)
                     /locus_tag="ECL_00216"
                     /codon_start=1
                     /transl_table=11
                     /product="ribokinase-like domain-containing protein"
                     /protein_id="YP_003610733.1"
                     /db_xref="GeneID:9122727"
                     /translation="MHKTLDVITIGEAMAMFVATETGELSTVEHFIKRVAGAELNVAT
                     GLARLGLKTGWVSRVGDDSFGHFVLDSLKKEGIDAAGVTLDGRFPTGFQLKSKVENGT
                     DPIVEYFRKGSAASHLSVEDYHADYFASARHLHLSGVAAALSASSYELLDHAATTMKA
                     QGKTISFDPNLRPVLWKSEAEMVEKLNRLAFQADWVLPGVKEGVILTGENTPEGIADF
                     YLNKGVKAVVLKTGADGAWFKTADGEQGAVAAVKVENVVDTVGAGDGFAVGVISALLE
                     GKPLPQAIARGNWIGSLAIQVQGDSEGLPTRAQLNE"
     misc_feature    complement(215544..216431)
                     /locus_tag="ECL_00216"
                     /note="2-keto-3-deoxygluconate kinase (KdgK)
                     phosphorylates 2-keto-3-deoxygluconate (KDG) to form
                     2-keto-3-deoxy-6-phosphogluconate (KDGP). KDG is the
                     common intermediate product, that allows organisms to
                     channel D-glucuronate and/or D-galacturinate into the...;
                     Region: KdgK; cd01166"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(215547..215549,215655..215657,
                     215664..215666,215931..215933,216030..216032,
                     216117..216119,216123..216125,216168..216170,
                     216324..216326,216333..216338))
                     /locus_tag="ECL_00216"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238571"
     misc_feature    complement(order(215571..215573,215583..215585,
                     215649..215651,215658..215666,215694..215696,
                     215742..215744,215757..215759))
                     /locus_tag="ECL_00216"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238571"
     gene            complement(216450..217199)
                     /locus_tag="ECL_00218"
                     /db_xref="GeneID:9122728"
     CDS             complement(216450..217199)
                     /locus_tag="ECL_00218"
                     /codon_start=1
                     /transl_table=11
                     /product="xylose isomerase domain-containing protein"
                     /protein_id="YP_003610734.1"
                     /db_xref="GeneID:9122728"
                     /translation="MGRKIMVVTAAYGADQVRQAGGQRAMLPVIAGAGADGVEIRREL
                     FNSEELQALPALGESIELLGLLACYSAPAPLFMPDGALNPDLPRYLSEASTLNALWLK
                     VSLGHFSGTRPLTALRALLNESGMALVVENDQTDCGQLAPMQRFQAACREMALPVTLT
                     FDMGNWLWVGDSPEEAATRLAPAVSYIHVKAAVPHKAQFRAVAPDRADARWLALLSQL
                     PADAPRGIEFPLEGADLTAVTRHYVNLLREE"
     misc_feature    complement(<216612..217127)
                     /locus_tag="ECL_00218"
                     /note="Sugar phosphate isomerase/epimerase [Carbohydrate
                     transport and metabolism]; Region: YcjR; COG1082"
                     /db_xref="CDD:224007"
     gene            complement(217304..218320)
                     /locus_tag="ECL_00219"
                     /db_xref="GeneID:9122729"
     CDS             complement(217304..218320)
                     /locus_tag="ECL_00219"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_003610735.1"
                     /db_xref="GeneID:9122729"
                     /translation="MSKPTRATISDVAKAARTGKTSISRYLNGEKHLLSDALLARIEQ
                     AIADLDYRPSIMARGLKRGRTRLIGLIIADITNPYSVNVLSGIEAACREKGFTPLVCN
                     TNNEVDQELHYLDLLRSYQVEGIVVNAVGMREEGLNRLQQSSLPMVLIDRKIPEFACD
                     VVGLDNTQAATTATEHLIEQGFEAILFLSEPLGMVNTRRERLNAFRATLERYPGVIAE
                     NAETPLHEADQLDNTLRQFHTRHRGMRKAVISANGALTLQVARSLKRIGLHWGSDIGL
                     LGFDELEWAELAGVGITTLKQPTWQIGYAAVEQVVRRIEGISDAVREQVFSGELIVRG
                     STAR"
     misc_feature    complement(218090..218302)
                     /locus_tag="ECL_00219"
                     /note="helix_turn _helix lactose operon repressor; Region:
                     HTH_LACI; smart00354"
                     /db_xref="CDD:197675"
     misc_feature    complement(order(218138..218143,218147..218152,
                     218159..218161,218168..218170,218207..218209,
                     218216..218221,218237..218239,218246..218251,
                     218255..218269))
                     /locus_tag="ECL_00219"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    complement(218141..218170)
                     /locus_tag="ECL_00219"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    complement(217322..218122)
                     /locus_tag="ECL_00219"
                     /note="Ligand-binding domain of DNA transcription
                     repressor RegR and other putative regulators such as KdgR
                     and EndR; Region: PBP1_RegR_EndR_KdgR_like; cd06283"
                     /db_xref="CDD:107278"
     misc_feature    complement(order(217526..217531,217538..217540,
                     217550..217552,217637..217639,217958..217966,
                     217973..217975,217982..217984,218015..218017,
                     218021..218035,218054..218059,218063..218068,
                     218075..218083,218120..218122))
                     /locus_tag="ECL_00219"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107278"
     misc_feature    complement(order(217430..217432,217481..217483,
                     217649..217651,217718..217720,217829..217831,
                     217868..217870,217937..217939,218072..218074,
                     218081..218086))
                     /locus_tag="ECL_00219"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107278"
     gene            complement(218450..219112)
                     /gene="ompA"
                     /locus_tag="ECL_00220"
                     /db_xref="GeneID:9122730"
     CDS             complement(218450..219112)
                     /gene="ompA"
                     /locus_tag="ECL_00220"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane lipoprotein"
                     /protein_id="YP_003610736.1"
                     /db_xref="GeneID:9122730"
                     /translation="MKKRVLVIAALVSGALAVSGCTTNPYTGEREAGKSGIGAGIGSL
                     VGAGVGALSSSKKDRGKGALIGAAAGAALGGGVGYYMDVQEAKLRDKMKGTGVSVTRS
                     GDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYNKTAVNVIGYTDSTGSQEL
                     NMRLSQQRADSVASSLITQGVEANRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSP
                     IQ"
     misc_feature    complement(218456..219112)
                     /gene="ompA"
                     /locus_tag="ECL_00220"
                     /note="putative outer membrane lipoprotein; Provisional;
                     Region: PRK10510"
                     /db_xref="CDD:182507"
     misc_feature    complement(order(218483..218485,218495..218497,
                     218621..218623,218630..218635,218645..218647,
                     218654..218659,218756..218761))
                     /gene="ompA"
                     /locus_tag="ECL_00220"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     gene            complement(219132..219257)
                     /locus_tag="ECL_00221"
                     /db_xref="GeneID:9122731"
     CDS             complement(219132..219257)
                     /locus_tag="ECL_00221"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610737.1"
                     /db_xref="GeneID:9122731"
                     /translation="MQVYGLVIEAVYGLSQISELSPEFSPYPDVIINCHVRRGKE"
     gene            219277..221598
                     /locus_tag="ECL_00222"
                     /db_xref="GeneID:9122732"
     CDS             219277..221598
                     /locus_tag="ECL_00222"
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin guanine dinucleotide-containing
                     S/N-oxide reductase"
                     /protein_id="YP_003610738.1"
                     /db_xref="GeneID:9122732"
                     /translation="MSTSTKTILTAAHWGPMLVETDGENVLSSRGALPTQHPNSLQTV
                     VRDQVHSKTRVRWPMVRKGFLASPDKPQGIRGQDEFVRVSWDDALALIHAQHKRIRDS
                     YGPASIFAGSYGWRSNGVLHKASTLLQRYMSLAGGYTGHLGDYSTGAAQAIMPYVVGG
                     NEVYQQQTSWPLVLEHTEVVVLWSANPLNTLKIAWNASDEQGIGYFDALRKSGKRIIC
                     IDPMRSETMDFFGDSAEWLAPHMGTDVAMMLGIAHTLVEKGWHDADFLARCTSGFDKF
                     ADYLTGKTDGVAKTAAWAADICGIPADKLRELAALFHENTTMLMSGWGMQRQQFGEQK
                     HWMLVTLAAMLGQIGTPGGGFGLSYHFANGGNPTRKAAVLASMQGSVKGGVDAVDKIP
                     VARIVEALENPGGFYQHNGLDRHFPDIKFVWWAGGANFTHHQDTNRLIRAWQKPELVV
                     ISECFWTASAKHADIVLPATTSYERNDLTMTGDYSNQHMVPMKRVVAPRDEARDDFDV
                     FAELSERWEAGGRERFTEGKTDLEWLETFYQIAAQRGAAQGVTLPPFAEFWEANAIFE
                     MPESEQNAQFVRFADFRRDPENHPLKTESGKIVIYSERIARFGYADCPAHPTWLEPDE
                     WHGNAQPEQLQVLSAHPAHRLHSQLNYSSLREQYAVAGREPITLHAEDAKARGIADGD
                     LVRVWNHRGQVLAGAVVSDGIKPGVICIHQGAWPDLDESGICKNGAVNVLTKDLPSSK
                     LGNGCAGNTALAWVEKYQGPELTLTAFDPPASS"
     misc_feature    219307..221589
                     /locus_tag="ECL_00222"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:324541"
     misc_feature    order(219613..219627,219712..219714,219826..219828,
                     219841..219846,219931..219939,219997..220002,
                     220006..220008,220243..220248,220255..220257,
                     220552..220554,220558..220560,220570..220572,
                     220576..220578,220630..220635,220645..220647,
                     220699..220701,220789..220791)
                     /locus_tag="ECL_00222"
                     /note="molybdopterin cofactor binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:239170"
     misc_feature    order(219613..219615,219619..219621,219712..219714)
                     /locus_tag="ECL_00222"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239170"
     gene            complement(221561..222007)
                     /locus_tag="ECL_00223"
                     /db_xref="GeneID:9122733"
     CDS             complement(221561..222007)
                     /locus_tag="ECL_00223"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610739.1"
                     /db_xref="GeneID:9122733"
                     /translation="MIRKWQSENTASLLSLWLESTTEAHPFIEASYWKENEAMVRDVY
                     LPSAETWVWEQDGEPYGFISVMQSQFVGALFVAPAYIGKGIGRALLNHVQQRFPHLSL
                     EVYQKNVRAVNFYHAQGFRIEDSAWQDDTQHPTWIMSWQADQTPSE"
     misc_feature    complement(221573..222007)
                     /locus_tag="ECL_00223"
                     /note="putative acetyltransferase; Provisional; Region:
                     PRK10562"
                     /db_xref="CDD:236715"
     misc_feature    complement(order(221747..221752,221780..221788))
                     /locus_tag="ECL_00223"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(221985..222566)
                     /locus_tag="ECL_00224"
                     /db_xref="GeneID:9122734"
     CDS             complement(221985..222566)
                     /locus_tag="ECL_00224"
                     /codon_start=1
                     /transl_table=11
                     /product="3-methyladenine DNA glycosylase"
                     /protein_id="YP_003610740.1"
                     /db_xref="GeneID:9122734"
                     /translation="MQRCGWVSQDQLYIDYHDREWGVPETDGKKLFEMICLEGQQAGL
                     SWITVLKKRENYRNAFHQFDPVRVAAMTDDDVERLVQDAGIIRHRGKIQAIIGNARAY
                     LAMEQNGEPFSEFVWTFVNNDPQITQAATLAEIPASTPASDALSKALKKRGFKFVGST
                     ICYAFMQACGLVNDHVTGCFCHPGGHHDPQMAK"
     misc_feature    complement(222006..222566)
                     /locus_tag="ECL_00224"
                     /note="3-methyl-adenine DNA glycosylase I; Provisional;
                     Region: PRK10353"
                     /db_xref="CDD:182401"
     gene            222729..223424
                     /locus_tag="ECL_00225"
                     /db_xref="GeneID:9122735"
     CDS             222729..223424
                     /locus_tag="ECL_00225"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipase"
                     /protein_id="YP_003610741.1"
                     /db_xref="GeneID:9122735"
                     /translation="MIKKISGRHAVSGLVGISACLLSGHSAFAWQQEYIVSDPQSNTA
                     ERYTWDADHQPRYDDILAERIQSSQNAPGLALNLPSGSTSAGAMSVGWNFPLAGHVTT
                     GPVVAWRYDGTTPMMINEFGDSVTTQALTDPLWHASVSTLGWRVDTQYGELRPWAQIS
                     YNQQYGENQWKSQFGMPQTPAPAQNGNWMDVTVGTDIPFTSHMAAYASLAQGEDSTTG
                     EQFLYTLGVSANF"
     misc_feature    222732..223421
                     /locus_tag="ECL_00225"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; cl22877"
                     /db_xref="CDD:328937"
     gene            223663..224865
                     /locus_tag="ECL_00226"
                     /db_xref="GeneID:9122736"
     CDS             223663..224865
                     /locus_tag="ECL_00226"
                     /codon_start=1
                     /transl_table=11
                     /product="oxalate/formate antiporter"
                     /protein_id="YP_003610742.1"
                     /db_xref="GeneID:9122736"
                     /translation="MNTSSYNRTRWLTLFGTIVTQFALGSVYTWSLFNSALSDKLGAP
                     ISQVAFSFGLLSLGLALSSSVAGKLQERFGVKRVTMASGILLGLGFFLTAYSNNLLML
                     WLSAGVLVGLADGAGYLLTLSNCVKWFPERKGLISAFAIGSYGLGSLGFKFIDSHLLA
                     SVGLEKTFMIWGAIVLVMILFGATLMKDAPQQEVKTVNGVMENDFTLAQSMRKPQYWM
                     LAVMFLTACMSGLYVIGVAKDIAQGMVKLDAMTAANAVTVISIANLSGRLVLGILSDK
                     IARIRVITLGQVVSLVGMAALLFAPLNEATFFAAIACVAFNFGGTITVFPSLVSEFFG
                     LNNLAKNYGVIYLGFGIGSICGSLIASLFGGFYVTFCVIFALLIISLALSTTIRQPQR
                     EVFNEAHA"
     misc_feature    223687..224811
                     /locus_tag="ECL_00226"
                     /note="oxalate/formate antiporter family transporter;
                     Region: 2A0111; TIGR00890"
                     /db_xref="CDD:273323"
     gene            complement(224867..225034)
                     /locus_tag="ECL_00227"
                     /db_xref="GeneID:9122737"
     CDS             complement(224867..225034)
                     /locus_tag="ECL_00227"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610743.1"
                     /db_xref="GeneID:9122737"
                     /translation="MRKKALSETSTSAVSRPQRERKVAAENVIGANFYKITSLEAYQI
                     KVKEAVKASLI"
     gene            225147..226799
                     /locus_tag="ECL_00228"
                     /db_xref="GeneID:9122738"
     CDS             225147..226799
                     /locus_tag="ECL_00228"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoethanolamine transferase"
                     /protein_id="YP_003610744.1"
                     /db_xref="GeneID:9122738"
                     /translation="MLAVYIGLFLNGAVLFRRVEGYFEDLTVRNGIFAAIEVFGSVLA
                     TFFLLRLLSLFGRRTWQILASLVVIISAAASYYMTFMNVVIGYGIVASVMTTDIDLSK
                     EVVGKGFIVWTILTCLLPLFFIWSNTCRYTLLRQLRTRGQRIRTVAVVLLAGLLVWAP
                     IRLMEKQQKRIEKATGVDMPSYGGVVANSYLPSNWLSALGLYAWAQADESSDVKSLMN
                     PTKKFHYEAPADGLDDTYVVFVIGETTRWDHMGILGYDRDTTPKLAQEKNLVAYRGYS
                     CDTATKLSLRCMFVREGGASDNPQRTLKEQNVFAVLKQLGFSSDLFAMQSEMWFYTNT
                     LADNIAYREQIGAEPRNRGKTVDDMLLLSEMEQSLKNHPQGKHLIVLHTKGSHYSYYQ
                     RYTRDFAKWQPECIGINKYCSKQELINAYDNSVLYVDTFLSRVIDQLRDKKAIVIYAA
                     DHGESINEQEHLHGTPRKLAPPEQFRVPMIMWMSDKYLENPDKAKMFAHLKQQAEIKV
                     PRRHVELYDTIMGCLGYTSPDGGINENNNWCKLPESSQKAAQ"
     misc_feature    225147..226781
                     /locus_tag="ECL_00228"
                     /note="phosphoethanolamine transferase; Provisional;
                     Region: PRK11560"
                     /db_xref="CDD:183198"
     misc_feature    225327..225755
                     /locus_tag="ECL_00228"
                     /note="Domain of unknown function (DUF1705); Region:
                     DUF1705; pfam08019"
                     /db_xref="CDD:285290"
     misc_feature    225843..226724
                     /locus_tag="ECL_00228"
                     /note="Lipooligosaccharide Phosphoethanolamine Transferase
                     A (LptA) or Lipid A Phosphoethanolamine Transferase;
                     Region: LptA; cd16017"
                     /db_xref="CDD:293741"
     misc_feature    order(225873..225875,225987..225989,226305..226307,
                     226497..226502,226533..226535)
                     /locus_tag="ECL_00228"
                     /note="putative active site [active]"
                     /db_xref="CDD:293741"
     misc_feature    order(225873..225875,225987..225989,226305..226307,
                     226497..226502,226533..226535)
                     /locus_tag="ECL_00228"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293741"
     misc_feature    order(225873..225875,225987..225989,226305..226307,
                     226500..226502)
                     /locus_tag="ECL_00228"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:293741"
     misc_feature    order(226083..226085,226122..226124,226530..226538)
                     /locus_tag="ECL_00228"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:293741"
     gene            226891..226967
                     /locus_tag="ECL_tRNA002"
                     /db_xref="GeneID:9122739"
     tRNA            226891..226967
                     /locus_tag="ECL_tRNA002"
                     /product="tRNA-Pro"
                     /db_xref="GeneID:9122739"
     gene            227615..229195
                     /locus_tag="ECL_00229"
                     /db_xref="GeneID:9127670"
     CDS             227615..229195
                     /locus_tag="ECL_00229"
                     /codon_start=1
                     /transl_table=11
                     /product="extracellular solute-binding protein"
                     /protein_id="YP_003610745.1"
                     /db_xref="GeneID:9127670"
                     /translation="MLKLGLSLVAMTVAASVQAKTLVYCSEGSPEGFNPQLFTSGTTY
                     DASSVPIYNRLVEFKTGTTEVIPGLAEKWDVSEDGKTYTFHLRQGVKWQDSKEFKPTR
                     DFNADDVVFSFDRQKNAQNPYHKVSGGSYEYFEGMGLPDLIAEVKKVDDKTVQFVLTR
                     PEAPFLADLAMDFASILSKEYADNMLKAGTPEKVDLNPIGTGPFQLLQYQKDSRILYK
                     AFPGYWGTKPQIDRLVFSITPDASVRYAKLQKNECQVMPYPNPADIARMKQDKNINLM
                     EQAGLNVGYLSFNTEKKPFDDVKVRQALTYAVNKEAIIKAVYQGAGVAAKNLIPPTMW
                     GYNDDVKDYTYDPEKAKALLKEAGQDKGFTVELWAMPVQRPYNPNARRMAEMVQADWA
                     KIGVQAKIVTYEWGEYLKRAKAGEHQAVMMGWTGDNGDPDNFFATLFSCAAAKDGSNY
                     SRWCYKPFEDLIQPARATDDHNKRIELYKQAQVVMHDQAPALIVAHSTVYEPVRKEVK
                     GYVVDPLGKHHFENVSVE"
     misc_feature    227675..229144
                     /locus_tag="ECL_00229"
                     /note="The substrate-binding component of an ABC-type
                     dipeptide import system contains the type 2 periplasmic
                     binding fold; Region: PBP2_DppA_like; cd08493"
                     /db_xref="CDD:173858"
     misc_feature    order(228827..228829,228839..228841,228878..228889,
                     228893..228895)
                     /locus_tag="ECL_00229"
                     /note="peptide binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173858"
     gene            complement(229339..229503)
                     /locus_tag="ECL_00230"
                     /db_xref="GeneID:9122740"
     CDS             complement(229339..229503)
                     /locus_tag="ECL_00230"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610746.1"
                     /db_xref="GeneID:9122740"
                     /translation="MTFRGNTTLARHNHYRVAGDHMDEGKSEKGDTDKRGDDKSQTSE
                     DELQHNPDSL"
     gene            229462..230376
                     /locus_tag="ECL_00231"
                     /db_xref="GeneID:9122741"
     CDS             229462..230376
                     /locus_tag="ECL_00231"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610747.1"
                     /db_xref="GeneID:9122741"
                     /translation="MIMAGERGISPERHAQLLAELGLDKPMWQQYLHYIWGVMHGDLG
                     ISLKSRLPVWDEFVPRFKATLELGICAMIFATAVGIPVGVLAAVKRGSIFDHTAVGLA
                     LTGYSMPIFWWGMMLIMLVSVQLNLTPVSGRVSDMVFLDDSNPLTGFMLIDTAIWGEE
                     GNFIDAVAHMILPAMVLGTIPLAVIVRMTRSSMLEVLGEDYIRTARAKGLTRMRVIIV
                     HALRNAMLPVVTVIGLQVGTLLAGAILTETIFSWPGLGRWLIDALQRRDYPVVQGGVL
                     LVATMIILVNLLVDLLYGVVNPRIRHKK"
     misc_feature    229462..230373
                     /locus_tag="ECL_00231"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cl00427"
                     /db_xref="CDD:294296"
     misc_feature    229465..230373
                     /locus_tag="ECL_00231"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, permease component [Amino acid transport and
                     metabolism, Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    order(229690..229695,229702..229707,229720..229722,
                     229753..229764,229768..229797,229804..229809,
                     229813..229815,229999..230004,230008..230010,
                     230014..230016,230023..230028,230032..230034,
                     230044..230049,230056..230058,230107..230109,
                     230149..230154,230161..230163,230182..230193,
                     230200..230205,230230..230235,230284..230289,
                     230296..230301,230305..230310,230317..230322,
                     230329..230334)
                     /locus_tag="ECL_00231"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(229771..229815,230182..230199)
                     /locus_tag="ECL_00231"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(229813..229815,229984..229986,230200..230202,
                     230224..230226,230233..230235,230284..230286)
                     /locus_tag="ECL_00231"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(230059..230097,230113..230118,230128..230130)
                     /locus_tag="ECL_00231"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            230386..230640
                     /locus_tag="ECL_00232"
                     /db_xref="GeneID:9122742"
     CDS             230386..230640
                     /locus_tag="ECL_00232"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transporter"
                     /protein_id="YP_003610748.1"
                     /db_xref="GeneID:9122742"
                     /translation="MSHVSENKVVAAPVPMTPLQEFWHYFKRNKGAVVGLVYVSVMIL
                     IAVFANVLAPYNPADQFRDALLAPPAWQDGGSPGSPVGYR"
     misc_feature    230461..230592
                     /locus_tag="ECL_00232"
                     /note="N-terminal TM domain of oligopeptide transport
                     permease C; Region: OppC_N; pfam12911"
                     /db_xref="CDD:289664"
     gene            230627..231289
                     /locus_tag="ECL_00233"
                     /db_xref="GeneID:9122743"
     CDS             230627..231289
                     /locus_tag="ECL_00233"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transporter"
                     /protein_id="YP_003610749.1"
                     /db_xref="GeneID:9122743"
                     /translation="MGTDDVGRDVLSRLMYGARLSLLVGCLVVVLSLIMGIILGLVAG
                     YFGGIVDNIIMRIVDIMLALPSLLLALVLVAIFGPSIGNAALALTFVALPHYVRLTRA
                     AVLVEVNRDYVTASRVAGAGAMRQMFVNIFPNCLAPLIVQASLGFSNAILDMAALGFL
                     GMGAQPPTPEWGTMLSDVLQFAQSAWWVVTFPGLAILLTVLAFNLMGDGLRDALDPKL
                     KQ"
     misc_feature    230726..231226
                     /locus_tag="ECL_00233"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(230726..230731,230738..230743,230756..230758,
                     230786..230797,230801..230815,230816..230818,
                     230822..230824,230897..230902,230906..230908,
                     230912..230914,230921..230926,230930..230932,
                     230942..230947,230954..230956,231005..231007,
                     231047..231052,231059..231061,231080..231091,
                     231098..231103,231143..231148,231182..231187,
                     231194..231199,231203..231208,231215..231220)
                     /locus_tag="ECL_00233"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(230822..230824,230882..230884,231098..231100,
                     231137..231139,231146..231148,231182..231184)
                     /locus_tag="ECL_00233"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(230957..230995,231011..231016,231026..231028)
                     /locus_tag="ECL_00233"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            231300..232283
                     /locus_tag="ECL_00234"
                     /db_xref="GeneID:9122744"
     CDS             231300..232283
                     /locus_tag="ECL_00234"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide transporter ATP-binding subunit"
                     /protein_id="YP_003610750.1"
                     /db_xref="GeneID:9122744"
                     /translation="MALLNVDKLSVHFGDEGTPFRAVDRISYSVNQGEVVGIVGESGS
                     GKSVSSLAIMGLIDYPGRVMAENLQFNGQDLKRISEKQRRQLVGAEVAMIFQDPMTSL
                     NPCYTVGFQIMEAIKVHQGGNKKTRRQRAIDLLNQVGIPDPASRLDVYPHQLSGGMSQ
                     RVMIAMAIACRPKLLIADEPTTALDVTIQAQIIELLLELQQKENMALVLITHDLALVA
                     EAAHKIIVMYAGQVVETGSSHDIFRAPRHPYTQALLRALPEFAQDKARLASLPGVVPG
                     KYDRPQGCLLNPRCPYATDKCRAEEPELNQLADGRQSKCHYPLDDAGRPTL"
     misc_feature    231300..232280
                     /locus_tag="ECL_00234"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppD; PRK11022"
                     /db_xref="CDD:182906"
     gene            232280..233293
                     /locus_tag="ECL_00235"
                     /db_xref="GeneID:9122745"
     CDS             232280..233293
                     /locus_tag="ECL_00235"
                     /codon_start=1
                     /transl_table=11
                     /product="dipeptide ABC transporter ATP-binding protein
                     DppF"
                     /protein_id="YP_003610751.1"
                     /db_xref="GeneID:9122745"
                     /translation="MSTQQATTQQPLLQAIDLKKHYPVKKGIFAPERLVKALDGVSFT
                     LERGKTLAVVGESGCGKSTLGRLLTMIETPTGGELYYQGQDLLKHDPQAQKLRRQKIQ
                     IVFQNPYGSLNPRKKVGQILEEPLLINSNLSKEQRREKALAMMAKVGLKTEHYDRYPH
                     MFSGGQRQRIAIARGLMLDPDVVIADEPVSALDVSVRAQVLNLMMDLQQELGLSYVFI
                     SHDLSVVEHIADEVMVMYLGRCVEKGTKDQIFNNPRHPYTQALLSATPRLNPDDRRER
                     IKLTGELPSPLNPPPGCAFNARCIRRFGPCTQLQPQLKDYRGQLVACFAVDQDENGEK
                     PQA"
     misc_feature    232304..233275
                     /locus_tag="ECL_00235"
                     /note="dipeptide transporter ATP-binding subunit;
                     Provisional; Region: dppF; PRK11308"
                     /db_xref="CDD:236898"
     gene            complement(233337..234287)
                     /locus_tag="ECL_00236"
                     /db_xref="GeneID:9122746"
     CDS             complement(233337..234287)
                     /locus_tag="ECL_00236"
                     /codon_start=1
                     /transl_table=11
                     /product="pantothenate kinase"
                     /protein_id="YP_003610752.1"
                     /db_xref="GeneID:9122746"
                     /translation="MSKKEQTLMTPYLHFNRSQWAALRDSVPMTLTEGEIARLKGINE
                     DLSLEEVAEIYLPLSRLLNFYISSNLRRQAVLEQFLGTNGQRIPYIISIAGSVAVGKS
                     TTARVLQALLSRWPEHRSVELITTDGFLHPNEVLKERGLMKKKGFPLSYDMHRLVKFV
                     SDLKSGVPNVTAPVYSHLIYDRIPGGDKTVVQPDILILEGLNVLQSGMDYPHDPHHVF
                     VSDFVDFSIYVDAPEDLLQSWYINRFLKFREGAFTDPDSYFHHYAQLSEEEAVKVATG
                     LWNEINYVNLKENILPTRERASLILTKSEKHAVDQIRLRK"
     misc_feature    complement(233340..234281)
                     /locus_tag="ECL_00236"
                     /note="pantothenate kinase; Provisional; Region: PRK05439"
                     /db_xref="CDD:235466"
     misc_feature    complement(order(233367..233369,233379..233381,
                     233559..233561,233571..233573,233976..233987,
                     233994..233996))
                     /locus_tag="ECL_00236"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(233367..233369,233547..233549,
                     233559..233561,233757..233759,233970..233972,
                     233982..233987))
                     /locus_tag="ECL_00236"
                     /note="CoA-binding site [chemical binding]; other site"
                     /db_xref="CDD:238983"
     misc_feature    complement(order(233691..233693,233982..233984))
                     /locus_tag="ECL_00236"
                     /note="Mg2+-binding site [ion binding]; other site"
                     /db_xref="CDD:238983"
     gene            234605..234680
                     /locus_tag="ECL_tRNA003"
                     /db_xref="GeneID:9122747"
     tRNA            234605..234680
                     /locus_tag="ECL_tRNA003"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:9122747"
     gene            234689..234773
                     /locus_tag="ECL_tRNA004"
                     /db_xref="GeneID:9127671"
     tRNA            234689..234773
                     /locus_tag="ECL_tRNA004"
                     /product="tRNA-Tyr"
                     /db_xref="GeneID:9127671"
     gene            234891..234965
                     /locus_tag="ECL_tRNA005"
                     /db_xref="GeneID:9127672"
     tRNA            234891..234965
                     /locus_tag="ECL_tRNA005"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:9127672"
     gene            234972..235047
                     /locus_tag="ECL_tRNA006"
                     /db_xref="GeneID:9127673"
     tRNA            234972..235047
                     /locus_tag="ECL_tRNA006"
                     /product="tRNA-Thr"
                     /db_xref="GeneID:9127673"
     gene            235166..236350
                     /locus_tag="ECL_00237"
                     /db_xref="GeneID:9127674"
     CDS             235166..236350
                     /locus_tag="ECL_00237"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor Tu"
                     /protein_id="YP_003610753.1"
                     /db_xref="GeneID:9127674"
                     /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSA
                     RAFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGA
                     ILVVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQ
                     YDFPGDDTPIVRGSALKALEGDAEWEAKIIELAGYLDSYIPEPERAIDKPFLLPIEDV
                     FSISGRGTVVTGRVERGIIKVGEEVEIVGIKETAKSTCTGVEMFRKLLDEGRAGENVG
                     VLLRGIKREEIERGQVLAKPGSIKPHTKFESEVYILSKDEGGRHTPFFKGYRPQFYFR
                     TTDVTGTIELPEGVEMVMPGDNIKMVVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKV
                     LG"
     misc_feature    235166..236344
                     /locus_tag="ECL_00237"
                     /note="elongation factor Tu; Reviewed; Region: PRK00049"
                     /db_xref="CDD:234596"
     gene            complement(236390..236512)
                     /locus_tag="ECL_00238"
                     /db_xref="GeneID:9122748"
     CDS             complement(236390..236512)
                     /locus_tag="ECL_00238"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610754.1"
                     /db_xref="GeneID:9122748"
                     /translation="MLIRFSNYTLSAEPVSAMIMTKIITDEPGSGVKACKKGIK"
     misc_feature    complement(236405..>236509)
                     /locus_tag="ECL_00238"
                     /note="Uncharacterized protein conserved in archaea
                     (DUF2193); Region: DUF2193; cl02034"
                     /db_xref="CDD:321776"
     gene            236580..236963
                     /gene="secE"
                     /locus_tag="ECL_00239"
                     /db_xref="GeneID:9122749"
     CDS             236580..236963
                     /gene="secE"
                     /locus_tag="ECL_00239"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase subunit SecE"
                     /protein_id="YP_003610755.1"
                     /db_xref="GeneID:9122749"
                     /translation="MSANTEAQGSGRGLEAMKWVVVAVLLIVAIVGNYLYRDIMLPLR
                     ALAVVILIAAAGGVALLTTKGKATVAFAREARTEVRKVIWPTRQETLHTTLIVAAVTA
                     VMSLILWGLDGILVRLVSFITGLRF"
     misc_feature    236676..236951
                     /gene="secE"
                     /locus_tag="ECL_00239"
                     /note="preprotein translocase subunit SecE; Reviewed;
                     Region: secE; PRK05740"
                     /db_xref="CDD:235587"
     gene            236965..237510
                     /locus_tag="ECL_00240"
                     /db_xref="GeneID:9122750"
     CDS             236965..237510
                     /locus_tag="ECL_00240"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription antitermination protein NusG"
                     /protein_id="YP_003610756.1"
                     /db_xref="GeneID:9122750"
                     /translation="MSEAPKKRWYVVQAFSGFEGRVATSLREHIKLHNMEELFGEVMV
                     PTEEVVEIRGGQRRKSERKFFPGYVLVQMVMNDASWHLVRSVPRVMGFIGGTSDRPAP
                     ISDKEVDAIMNRLQQVGDKPRPKTLFEPGEMVRVNDGPFADFNGVVEEVDYEKSRLKV
                     SVSIFGRATPVELDFAQVEKA"
     misc_feature    236968..237504
                     /locus_tag="ECL_00240"
                     /note="transcription antitermination protein NusG;
                     Validated; Region: nusG; PRK05609"
                     /db_xref="CDD:180161"
     gene            237666..238094
                     /locus_tag="ECL_00241"
                     /db_xref="GeneID:9122751"
     CDS             237666..238094
                     /locus_tag="ECL_00241"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L11"
                     /protein_id="YP_003610757.2"
                     /db_xref="GeneID:9122751"
                     /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNA
                     KTESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKIS
                     RAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED"
     misc_feature    237666..238091
                     /locus_tag="ECL_00241"
                     /note="50S ribosomal protein L11; Validated; Region: rplK;
                     PRK00140"
                     /db_xref="CDD:234661"
     gene            238098..238802
                     /locus_tag="ECL_00242"
                     /db_xref="GeneID:9122752"
     CDS             238098..238802
                     /locus_tag="ECL_00242"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L1"
                     /protein_id="YP_003610758.1"
                     /db_xref="GeneID:9122752"
                     /translation="MAKLTKRMSVIRDKVDATKQYDINEAIALLKELATAKFVESVDV
                     AVNLGIDARKSDQNVRGATVLPHGTGRSVRVAVFTQGANAEAAKAAGAELVGMEDLAD
                     QIKKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKAGQ
                     VRYRNDKNGIIHTTIGKVDFDADKLKENLEALLVALKKAKPTQAKGVYIKKVSISTTM
                     GAGVAVDQAGLSAAAN"
     misc_feature    238101..238790
                     /locus_tag="ECL_00242"
                     /note="50S ribosomal protein L1; Validated; Region: rplA;
                     PRK05424"
                     /db_xref="CDD:180071"
     misc_feature    order(238203..238211,238218..238220,238224..238226,
                     238230..238232,238236..238238,238599..238601,
                     238605..238607,238611..238613,238749..238754,
                     238758..238760)
                     /locus_tag="ECL_00242"
                     /note="mRNA/rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:238235"
     gene            239095..239592
                     /locus_tag="ECL_00243"
                     /db_xref="GeneID:9122753"
     CDS             239095..239592
                     /locus_tag="ECL_00243"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L10"
                     /protein_id="YP_003610759.1"
                     /db_xref="GeneID:9122753"
                     /translation="MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKA
                     GREAGVYMRVVRNTLLRRAVEGTSFECLKDTFVGPTLIAYSMEHPGAAARLFKEFAKA
                     NAKFEVKAAAFEGELIPASQIDRLATLPTYEEAIARLMATMKEASAGKLVRTLAAVRD
                     AKEAA"
     misc_feature    239101..239586
                     /locus_tag="ECL_00243"
                     /note="50S ribosomal protein L10; Reviewed; Region: rplJ;
                     PRK00099"
                     /db_xref="CDD:234632"
     misc_feature    order(239116..239121,239128..239130,239260..239271,
                     239278..239280)
                     /locus_tag="ECL_00243"
                     /note="23S rRNA interface [nucleotide binding]; other
                     site"
                     /db_xref="CDD:240223"
     misc_feature    order(239362..239364,239431..239433,239440..239442,
                     239488..239490,239497..239502,239509..239514,
                     239518..239526,239530..239538,239542..239550,
                     239557..239562,239566..239571)
                     /locus_tag="ECL_00243"
                     /note="Interface with L7/L12 ribosomal proteins
                     [polypeptide binding]; other site"
                     /db_xref="CDD:240223"
     gene            239659..240027
                     /locus_tag="ECL_00244"
                     /db_xref="GeneID:9122754"
     CDS             239659..240027
                     /locus_tag="ECL_00244"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L7/L12"
                     /protein_id="YP_003610760.1"
                     /db_xref="GeneID:9122754"
                     /translation="MSITKDQIIEAVSAMSVMDVVELISAMEEKFGVSAAAAVAVAAG
                     PAADAAEEKTEFDVILKAAGANKVAVIKAVRGATGLGLKEAKDLVESAPAALKEGVSK
                     DDAEALKKSLEEAGAEVEVK"
     misc_feature    239659..240024
                     /locus_tag="ECL_00244"
                     /note="50S ribosomal protein L7/L12; Reviewed; Region:
                     rplL; PRK00157"
                     /db_xref="CDD:234671"
     misc_feature    order(239665..239667,239704..239712,239719..239724,
                     239731..239733,239740..239742,239782..239790,
                     239818..239823,239884..239886,239890..239895,
                     239899..239901,239905..239910,239950..239955,
                     239959..239961,239968..239970)
                     /locus_tag="ECL_00244"
                     /note="core dimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100102"
     misc_feature    order(239674..239676,239683..239685,239695..239697,
                     239734..239736,239749..239751)
                     /locus_tag="ECL_00244"
                     /note="peripheral dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100102"
     misc_feature    order(239716..239718,239725..239730,239740..239742,
                     239749..239751)
                     /locus_tag="ECL_00244"
                     /note="L10 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(239857..239862,239869..239874,239881..239883,
                     239902..239907,239914..239916)
                     /locus_tag="ECL_00244"
                     /note="L11 interface [polypeptide binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(239860..239862,239872..239874,239881..239883,
                     239902..239907,239914..239916)
                     /locus_tag="ECL_00244"
                     /note="putative EF-Tu interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     misc_feature    order(239860..239862,239869..239874,239881..239883)
                     /locus_tag="ECL_00244"
                     /note="putative EF-G interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:100102"
     gene            240347..244375
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /db_xref="GeneID:9122755"
     CDS             240347..244375
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta"
                     /protein_id="YP_003610761.1"
                     /db_xref="GeneID:9122755"
                     /translation="MVYSYTEKKRIRKDFGKRPQVLDIPYLLSIQLDSFQKFIEQDPE
                     GQYGLEAAFRSVFPIQSYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRL
                     VIYEREAPEGTVKDIKEQEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSD
                     KGKTHSSGKVLYNARIIPYRGSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTE
                     QILDLFFEKVIFEIRDNKLQMELVPERLRGETASFDIEADGKVYVEKGRRITARHIRQ
                     LEKDDIKHIEVPVEYIAGKVAAKDYVDESTGELICPANMELSLDLLAKLSQAGHKRIE
                     TLFTNDLDHGPYISETVRVDPTNDRLSALVEIYRMMRPGEPPTREAAESLFENLFFSE
                     DRYDLSAVGRMKFNRSLLRDEIEGSGILSKDDIIEVMKKLIDIRNGKGEVDDIDHLGN
                     RRIRSVGEMAENQFRVGLVRVERAVKERLSLGDLDTLMPQDMINAKPISAAVKEFFGS
                     SQLSQFMDQNNPLSEITHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEG
                     PNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVTDEIHYLSAIEEGNYVIAQANSNLD
                     DEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQVVSVGASLIPFLEHDDANRALMG
                     ANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKRGGTVQYVDASRIVIKVNEDE
                     MYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERGDVLADGPSTDLGELALGQ
                     NMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVSRDTKLGPEEITADIPN
                     VGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVK
                     DSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLF
                     SRIYAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLE
                     AKRRKITQGDDLAPGVLKIVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPIEDMPHD
                     ANGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAKLREFIQ
                     RAYDLGTDVRQKVDLNTFSDEEVLRLAENLRKGMPIATPVFDGAKEAEIKELLQLGGL
                     PTSGQITLFDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGK
                     AQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
                     ESFNVLLKEIRSLGINIELEDE"
     misc_feature    240347..244372
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /note="DNA-directed RNA polymerase subunit beta; Reviewed;
                     Region: rpoB; PRK00405"
                     /db_xref="CDD:234749"
     misc_feature    order(240608..240610,242831..242833,242942..242944,
                     242948..242950,242960..242968,242972..242974)
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /note="RPB12 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(241982..241984,241988..241996,242000..242002,
                     242009..242011,242024..242026,242306..242308,
                     242360..242368,242372..242374,242756..242767,
                     242774..242776,242780..242788,243563..243565,
                     243569..243571,243575..243577,243641..243643,
                     243647..243649,243656..243658,243665..243667,
                     243680..243682,243692..243694,243905..243907,
                     243986..243988,244010..244018,244022..244024,
                     244061..244063,244070..244078,244082..244087,
                     244148..244156,244166..244168,244172..244177,
                     244181..244183,244187..244204,244208..244225,
                     244235..244237,244304..244306,244316..244318,
                     244322..244324,244328..244333,244337..244339,
                     244343..244354,244358..244360,244364..244366)
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /note="RPB1 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(242432..242437,242741..242743,242747..242749,
                     242810..242812,242819..242821,243590..243592,
                     243629..243631,243710..243712,243875..243877,
                     243881..243883,243974..243976,244025..244027)
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /note="RPB10 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(242774..242776,242816..242818,243587..243589,
                     243992..243994)
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /note="RPB11 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     misc_feature    order(242816..242821,242831..242833,243509..243511,
                     243515..243517,243590..243598,243605..243607,
                     243611..243616,243989..244012,244016..244018)
                     /gene="rpoB"
                     /locus_tag="ECL_00245"
                     /note="RPB3 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238353"
     gene            244452..248675
                     /gene="rpoC"
                     /locus_tag="ECL_00246"
                     /db_xref="GeneID:9122756"
     CDS             244452..248675
                     /gene="rpoC"
                     /locus_tag="ECL_00246"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-directed RNA polymerase subunit beta'"
                     /protein_id="YP_003610762.1"
                     /db_xref="GeneID:9122756"
                     /translation="MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETI
                     NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERM
                     GHIELASPTAHIWFLKSLPSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERHQIL
                     TEEQYLDALEEFGDEFDAKMGAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLT
                     KRIKLLEAFVQSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRN
                     NRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGK
                     QGRFRQNLLGKRVDYSGRSVITVGPYLRLHQCGLPKKMALELFKPFIYGKLELRGLAT
                     TIKAAKKMVEREEAVVWDILDEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLH
                     PLVCAAYNADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVL
                     GLYYMTRDCVNAKGEGMVLTGPKEAERIYRAGLASLHARVKVRITEYEKDANGEFVAK
                     TSLKDTTIGRAILWMIVPKGLPFSIVNQALGKKAISKMLNTCYRILGLKPTVIFADQT
                     MYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAEVAEIQEQFQSGLVTAGERYNKV
                     IDIWAAANDRVSKAMMDNLQTETVINRDGVEEQQVSFNSIYMMADSGARGSAAQIRQL
                     AGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTR
                     RLVDVAQDLVVTEDDCGTLEGITMTPVIEGGDVKEPLRDRVLGRVTAEDILKPGTADI
                     LVPRNTLLHEQWCDLLEANSVDSVKVRSVVSCDTDFGVCAHCYGRDLARGHIINKGEA
                     IGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKLSNAKSVVNSSGK
                     LVITSRNTELKLIDEFGRTKESYKVPYGAVMAKGDGEQVAGGETVANWDPHTMPVITE
                     VSGFIRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTTGGKDLRPALKIVDAQGNDV
                     LIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPRVADLFE
                     ARRPKEPAILAEISGIISFGKETKGKRRLVITPVDGSEPYEEMIPKWRQLNVFEGERV
                     ERGDVVSDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQMLR
                     KATIENAGSSEFLEGEQVEYSRVKIANRELEANGKIGATFSRDLLGITKASLATESFI
                     SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEL
                     PAAPQVTAEDASASLAELLNAGLGGSDNE"
     misc_feature    244497..248594
                     /gene="rpoC"
                     /locus_tag="ECL_00246"
                     /note="DNA-directed RNA polymerase subunit beta';
                     Provisional; Region: PRK00566"
                     /db_xref="CDD:234794"
     STS             244562..245153
                     /gene="rpoC"
                     /locus_tag="ECL_00246"
                     /standard_name="MARC_46213-46214:1107802028:1"
                     /db_xref="UniSTS:471646"
     gene            complement(248733..249050)
                     /locus_tag="ECL_00247"
                     /db_xref="GeneID:9122757"
     CDS             complement(248733..249050)
                     /locus_tag="ECL_00247"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system lactose/cellobiose-specific
                     transporter subunit IIA"
                     /protein_id="YP_003610763.1"
                     /db_xref="GeneID:9122757"
                     /translation="MEDLETTIMELLVNAGAARSAALTALQMARKGDFDEAEKAMEES
                     REYVKHAHTIQTQLIGLDEGTGKLPVNLITVHSQDHLMNAMVIQDLAGDMIELYRRIP
                     LLN"
     misc_feature    complement(order(248805..248807,248826..248831,
                     248877..248879,249039..249041))
                     /locus_tag="ECL_00247"
                     /note="methionine cluster; other site"
                     /db_xref="CDD:238133"
     misc_feature    complement(248760..249035)
                     /locus_tag="ECL_00247"
                     /note="PTS system, Lactose/Cellobiose specific IIA
                     subunit; Region: PTS_IIA; pfam02255"
                     /db_xref="CDD:308071"
     misc_feature    complement(order(248811..248819,248823..248825,
                     248994..248996))
                     /locus_tag="ECL_00247"
                     /note="active site"
                     /db_xref="CDD:238133"
     misc_feature    complement(248823..248825)
                     /locus_tag="ECL_00247"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238133"
     misc_feature    complement(248814..248816)
                     /locus_tag="ECL_00247"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238133"
     gene            complement(249050..249313)
                     /locus_tag="ECL_00248"
                     /db_xref="GeneID:9122758"
     CDS             complement(249050..249313)
                     /locus_tag="ECL_00248"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphotransferase system PTS,
                     lactose/cellobiose-specific IIB subunit"
                     /protein_id="YP_003610764.1"
                     /db_xref="GeneID:9122758"
                     /translation="MLVQRMKDAAQKKGVEVTIKAVPVAEFKDNIATADIVLLGPQVK
                     YEQAKLQAQAEPLGKKVAVIDMMDYGMMKGDAVLEKALKLLES"
     misc_feature    complement(249065..249313)
                     /locus_tag="ECL_00248"
                     /note="PTS_IIB_chitobiose_lichenan: subunit IIB of enzyme
                     II (EII) of the N,N-diacetylchitobiose-specific and
                     lichenan-specific phosphoenolpyruvate:carbohydrate
                     phosphotransferase system (PTS). In these systems, EII is
                     either a lichenan- or an N; Region:
                     PTS_IIB_chitobiose_lichenan; cd05564"
                     /db_xref="CDD:99906"
     gene            complement(249505..251103)
                     /locus_tag="ECL_00249"
                     /db_xref="GeneID:9122759"
     CDS             complement(249505..251103)
                     /locus_tag="ECL_00249"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610765.1"
                     /db_xref="GeneID:9122759"
                     /translation="MLRGYRQTKKLTIRIDVQLMALHSRKLSFTRPIMLSFAGILCSF
                     ALIAVVVTLSQQKDFLEDYHKINGNFTHNLAVNYTESILRENDYILGRSALYFARNDT
                     LNEMLNVNPSQGLQMLMHLQNLMPTVSSISLTDTQGRYLRAPEVLPTEKSKTFDPRTR
                     PWFIAQAEASIFSHYTRPYMDYFTGHPTVTLYKPLISPEGRLKGTIAFHLDLTSMGFT
                     LRQMVAPVQGEFFVVERDGAVVLHPDPGALFKQYVSEALMDKMTSSEGHLYDKKTKAW
                     YYYYSFTNPDWFVIYRVSGATLTDITRHETTIVGWGFALAAIIIILFGLYLRHESRTV
                     LMTIINAIKTGDVNQAPRLEAMLSHTIQSNKAREMAYVRQATHDALTGCKNRRAFDSD
                     VDELLSAHQPFALALIDIDNFKSINDTWGHLSGDIVLRNVAREGIQIMQPHNVSVYRY
                     GGEEFAVIFQADQIASAFSLLDAWRTAVEKRLWREENLRVTFSAGLGEWHFEPLEELV
                     GSVDNALYSAKQQGKNRIIRTSVG"
     misc_feature    complement(250228..>250560)
                     /locus_tag="ECL_00249"
                     /note="Cache domain; Region: dCache_1; pfam02743"
                     /db_xref="CDD:308398"
     misc_feature    complement(249523..249978)
                     /locus_tag="ECL_00249"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(249745..249747,249877..249879))
                     /locus_tag="ECL_00249"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(249742..249753,249757..249759,
                     249826..249828,249838..249840,249850..249855,
                     249862..249864))
                     /locus_tag="ECL_00249"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    complement(order(249685..249687,249769..249771))
                     /locus_tag="ECL_00249"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(251374..252507)
                     /gene="thiH"
                     /locus_tag="ECL_00250"
                     /db_xref="GeneID:9122760"
     CDS             complement(251374..252507)
                     /gene="thiH"
                     /locus_tag="ECL_00250"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiH"
                     /protein_id="YP_003610766.1"
                     /db_xref="GeneID:9122760"
                     /translation="MTTFTDRWRQLNWDDIALRINSKTQADVERALQARHLSRDDMMA
                     LLSPAASTFLEPMAQRAQRLTRQRFGNTVSFYVPLYLSNLCANNCTYCGFSMSNRIKR
                     KTLDESEIARECAAIREMGFEHLLLVTGEHQSKVGMDYFRQHLPAIRRQFASLQMEVQ
                     PLSQEEYAELKTLGLDGVMVYQETYHEATYARHHLKGKKQDFFFRLETPDRLGRAGID
                     KIGLGALIGLSDSWRVDCYMVAEHLLWLQQHYWQSRYSISFPRLRPCTGGVEPASVMD
                     ERQLVQAICAFRLLAPEVELSLSTRESPAFRDRVIPLAINNVSAFSKTQPGGYADDHP
                     ELEQFAPHDSRRPEAVAAALTAQGLQPVWKDWDSWLGRASQMR"
     misc_feature    complement(251389..252501)
                     /gene="thiH"
                     /locus_tag="ECL_00250"
                     /note="thiamine biosynthesis protein ThiH; Reviewed;
                     Region: thiH; PRK09240"
                     /db_xref="CDD:236425"
     gene            complement(252504..253274)
                     /gene="thiG"
                     /locus_tag="ECL_00251"
                     /db_xref="GeneID:9122761"
     CDS             complement(252504..253274)
                     /gene="thiG"
                     /locus_tag="ECL_00251"
                     /codon_start=1
                     /transl_table=11
                     /product="thiazole biosynthesis protein ThiG"
                     /protein_id="YP_003610767.1"
                     /db_xref="GeneID:9122761"
                     /translation="MLRIADKVFDSHLFTGTGKFASPQLMVDAIRESGSQLVTLALKR
                     VDLRHHSDAILAPLLDAGVTLLPNTSGAKTAEEAIFAAQLAREALGTHWLKLEIHPDA
                     RWLLPDPIETLKAAEKLVQQGFTVLPYCGADPVLCKRLEEVGCAAVMPLGAPIGSNQG
                     LETRAMLEIIIEQATVPVVVDAGIGVPSHAAQALEMGASAVLVNTAIAVADDPIRMAR
                     AFRMAVEAGLLARESGPGTRSFQAQATSPLTGFLEALS"
     misc_feature    complement(252525..253274)
                     /gene="thiG"
                     /locus_tag="ECL_00251"
                     /note="thiazole synthase; Reviewed; Region: thiG;
                     PRK00208"
                     /db_xref="CDD:234687"
     gene            complement(253276..253476)
                     /gene="thiS"
                     /locus_tag="ECL_00252"
                     /db_xref="GeneID:9122762"
     CDS             complement(253276..253476)
                     /gene="thiS"
                     /locus_tag="ECL_00252"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfur carrier protein ThiS"
                     /protein_id="YP_003610768.1"
                     /db_xref="GeneID:9122762"
                     /translation="MRILFNDEPMKCDDGLTVAALLEKLRQLKPGTALALNQQILPRE
                     QWEHQQVSEGDQILLFQVIAGG"
     misc_feature    complement(253279..253476)
                     /gene="thiS"
                     /locus_tag="ECL_00252"
                     /note="sulfur carrier protein ThiS; Provisional; Region:
                     PRK08053"
                     /db_xref="CDD:181210"
     gene            complement(253460..254215)
                     /locus_tag="ECL_00253"
                     /db_xref="GeneID:9122763"
     CDS             complement(253460..254215)
                     /locus_tag="ECL_00253"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610769.1"
                     /db_xref="GeneID:9122763"
                     /translation="MNDRDFMRYSRQILLEDIAIDGQQKLLASRVLIVGLGGLGAPAA
                     LYLAGAGVGTLVLADDDEVHISNLQRQILFTTEDVNQPKAQITRKRLKQLNPDITLIA
                     HQERLHGDTLQREVALADAVLDCTDNMATRQAINAACVAQNTPLITASAVGFGGQMMV
                     LTPPWAQGCYRCLWPDDAEPERNCRTAGILGPVVGVMGTLQALEAIKLLSGMETERNT
                     LRLFDARSSGWRHLALHRASHCPVCGGRNAHSV"
     misc_feature    complement(253514..254194)
                     /locus_tag="ECL_00253"
                     /note="ThiF_MoeB_HesA. Family of E1-like enzymes involved
                     in molybdopterin and thiamine biosynthesis family. The
                     common reaction mechanism catalyzed by MoeB and ThiF, like
                     other E1 enzymes, begins with a nucleophilic attack of the
                     C-terminal carboxylate of MoaD...; Region:
                     ThiF_MoeB_HesA_family; cd00757"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(253823..253825,253841..253843,
                     253967..253969,254006..254008,254033..254035,
                     254039..254041,254099..254101,254105..254107,
                     254111..254113))
                     /locus_tag="ECL_00253"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238386"
     misc_feature    complement(order(253517..253522,253526..253528,
                     253547..253549,253559..253561,253745..253747,
                     253751..253753,253763..253768,253820..253822,
                     253832..253840,254099..254101))
                     /locus_tag="ECL_00253"
                     /note="substrate interface [chemical binding]; other site"
                     /db_xref="CDD:238386"
     gene            complement(254208..254843)
                     /locus_tag="ECL_00254"
                     /db_xref="GeneID:9122764"
     CDS             complement(254208..254843)
                     /locus_tag="ECL_00254"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine-phosphate pyrophosphorylase"
                     /protein_id="YP_003610770.1"
                     /db_xref="GeneID:9122764"
                     /translation="MYQPDFPCVPFRLGLYPVVDSVAWIERLLACGVRTIQLRIKDKR
                     DDEVEADVVAAIALGRRYDARLFINDYWRLAVKHQAYGVHLGQEDLETTDLSAIRDAG
                     LRLGVSTHDDMEIDVALAARPSYIALGHVFPTQTKQMPSAPQGLTQLAAHVKRLADYP
                     TVAIGGISLERAPAVLDTGVGSIAVVSAITQAADWQAATAQLLKLAGAGDE"
     misc_feature    complement(254211..254843)
                     /locus_tag="ECL_00254"
                     /note="thiamine-phosphate pyrophosphorylase; Provisional;
                     Region: PRK03512"
                     /db_xref="CDD:179586"
     gene            complement(254843..256738)
                     /gene="thiC"
                     /locus_tag="ECL_00255"
                     /db_xref="GeneID:9122765"
     CDS             complement(254843..256738)
                     /gene="thiC"
                     /locus_tag="ECL_00255"
                     /codon_start=1
                     /transl_table=11
                     /product="thiamine biosynthesis protein ThiC"
                     /protein_id="YP_003610771.1"
                     /db_xref="GeneID:9122765"
                     /translation="MSTTKLTRREQRAQAQHFIDTLEGTAFPNSKRIYITGSQADIRV
                     PMREIQLSPTLIGGSKAHPQYEDNEAVPVYDTSGPYGDPAVAINVQQGLPKLRQPWID
                     ARNDCEELSDRSSAYTKARLADDGLDELRFAGLLTPKRAKAGKCVTQLHYARQGIVTP
                     EMEFIAIRENMGRERIRSEVLRHQHPGEGFGARLPENITPQFVRDEVAAGRAIIPANI
                     NHPESEPMIIGRNFLVKVNANIGNSAVTSSIEEEVEKLVWSTRWGADTVMDLSTGRYI
                     HETREWILRNSPVPIGTVPVYQALEKVNGIAEDLTWEAFRDTLLEQAEQGVDYFTIHA
                     GVLLRYVPMTAKRLTGIVSRGGSIMAKWCLSHHKENFLYEHFREICEICAAYDVSLSL
                     GDGLRPGSIRDANDEAQFAELHTLGELTKIAWEYDVQVMIEGPGHVPMQMIRRNMTEE
                     LEHCHEAPFYTLGPLTTDIAPGYDHFTSGIGAAMIGWFGCAMLCYVTPKEHLGLPNKE
                     DVKQGLITYKIAAHAADLAKGHPGAQIRDNAMSKARFEFRWEDQFNLALDPFTARAYH
                     DETLPQESGKVAHFCSMCGPKFCSMKISQEVRDYAATQTIEVGMADMSKTFRAKGGEI
                     YLKKEEA"
     misc_feature    complement(254858..256714)
                     /gene="thiC"
                     /locus_tag="ECL_00255"
                     /note="thiamine biosynthesis protein ThiC; Provisional;
                     Region: PRK09284"
                     /db_xref="CDD:236451"
     gene            complement(256982..257479)
                     /locus_tag="ECL_00256"
                     /db_xref="GeneID:9122766"
     CDS             complement(256982..257479)
                     /locus_tag="ECL_00256"
                     /codon_start=1
                     /transl_table=11
                     /product="anti-RNA polymerase sigma 70 factor"
                     /protein_id="YP_003610772.1"
                     /db_xref="GeneID:9122766"
                     /translation="MLNQLESLTERVRGSNKLVDRWLHVRKHLLVAYYNLVGIKPGKE
                     SFMRLNEKALDDFCQSLVDYLSDGHFNIYERIIREMEGTTPYLAASKLYPLLEANTQQ
                     IMDYYDSTLENAIDHDNYLEFQQALSDLGEALEERFTLEDKLIALALDHGLDVSHEDN
                     VARPA"
     misc_feature    complement(256985..257479)
                     /locus_tag="ECL_00256"
                     /note="Regulator of sigma D [Transcription]; Region: Rsd;
                     COG3160"
                     /db_xref="CDD:225702"
     gene            257575..258348
                     /locus_tag="ECL_00257"
                     /db_xref="GeneID:9122767"
     CDS             257575..258348
                     /locus_tag="ECL_00257"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH pyrophosphatase"
                     /protein_id="YP_003610773.1"
                     /db_xref="GeneID:9122767"
                     /translation="MDRIIEKSDLGWWIVSHEQKLWLPAGEIPYGAAEKFDLVGLPAL
                     KIGEWQGEPVWLIQQPRRNDMGSVRQVLDQDVGLFQLAGRGVQLAEFYRSHKYCGYCG
                     HTMHPSKTEWAMLCSHCRERYYPQIAPCIIVAIRRDDSILLAQHTRHRNGIHTVLAGF
                     VEVGETLEQAVAREVMEESGIKVKNLRYVTSQPWPFPQSLMTAFMADYDSGEIVIDQK
                     ELLEANWYRYDDLPLLPPPGTVARRLIEDTVAMCRADAE"
     misc_feature    257575..258330
                     /locus_tag="ECL_00257"
                     /note="NADH pyrophosphatase; Reviewed; Region: nudC;
                     PRK00241"
                     /db_xref="CDD:234699"
     gene            258389..259453
                     /locus_tag="ECL_00258"
                     /db_xref="GeneID:9122768"
     CDS             258389..259453
                     /locus_tag="ECL_00258"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrinogen decarboxylase"
                     /protein_id="YP_003610774.1"
                     /db_xref="GeneID:9122768"
                     /translation="MTELKNDRYLRALLRQPVDVTPVWMMRQAGRYLPEYKATRAQAG
                     DFMSLCKNAELACEVTLQPLRRFPLDAAILFSDILTIPDAMGLGLYFETGEGPRFTST
                     IKSKADVDKLPVPDPEQELGYVMNAVRTIRRELKGEVPLIGFSGSPWTLATYMVEGGS
                     SKAFTVIKKMMYAEPLALHALLDKLAKSVTLYLNAQIKAGAQSVMIFDTWGGVLTGRD
                     YQQFSLYYMHKIVDGLLRENEGRRVPVTLFTKGGGQWLEAMAATGCDALGLDWTTDIA
                     DARRRVGDKVALQGNMDPSMLYAQPARIEEEVASILAGFGQGEGHVFNLGHGIHQDVP
                     PEHAGAFVEAVHRLSAQYHK"
     misc_feature    258392..259438
                     /locus_tag="ECL_00258"
                     /note="uroporphyrinogen decarboxylase; Validated; Region:
                     hemE; PRK00115"
                     /db_xref="CDD:234644"
     misc_feature    order(258464..258481,258494..258496,258506..258508,
                     258524..258526,258605..258625,258659..258661,
                     258674..258676,258818..258820,258848..258850,
                     258866..258868,259007..259009,259013..259018,
                     259130..259132,259367..259369)
                     /locus_tag="ECL_00258"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238368"
     misc_feature    order(258467..258469,258479..258481,258617..258619,
                     258848..258850,259013..259015,259367..259369)
                     /locus_tag="ECL_00258"
                     /note="active site"
                     /db_xref="CDD:238368"
     gene            259463..260131
                     /locus_tag="ECL_00259"
                     /db_xref="GeneID:9122769"
     CDS             259463..260131
                     /locus_tag="ECL_00259"
                     /codon_start=1
                     /transl_table=11
                     /product="endonuclease V"
                     /protein_id="YP_003610775.1"
                     /db_xref="GeneID:9122769"
                     /translation="MDLASLRAQQIELASSVIREDRLDKDPPQYIGGADVGFEQGGEV
                     TRAAMVLLKYPSLELVEYKVARIATTMPYIPGFLSFREYPALLAAWEQLSQKPDLLFV
                     DGHGISHPRRLGVASHFGLLVDVPTIGVAKKRLCGAFEPLSAEPGALAPLIDKGEQLA
                     WVWRSKARCNPLFIATGHRVSMDSALAWVQRCMKGYRLPEPTRWADAVASARPAFVRW
                     QEIQ"
     misc_feature    259463..260128
                     /locus_tag="ECL_00259"
                     /note="endonuclease V; Provisional; Region: PRK11617"
                     /db_xref="CDD:236937"
     misc_feature    order(259565..259567,259571..259576,259679..259681,
                     259685..259696,259769..259777,259787..259789,
                     259802..259807,259853..259867,260078..260080,
                     260090..260092)
                     /locus_tag="ECL_00259"
                     /note="Active_site [active]"
                     /db_xref="CDD:143472"
     gene            260176..260766
                     /locus_tag="ECL_00260"
                     /db_xref="GeneID:9122770"
     CDS             260176..260766
                     /locus_tag="ECL_00260"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610776.1"
                     /db_xref="GeneID:9122770"
                     /translation="MLQNPIHLRLEKLESWQHVTFMACLCERMYPNYAAFCKQTEFGD
                     GHIYRRILDLIWETLTVKDAKVNFDSQLEKLEEAIPVADDFDLYGVYPAIDACVALSE
                     LIHSRLSGETLEHAIEVSKASITTVAMLEMTQAGREMTDEELRANPAVEQEWDIQWEI
                     FRLLAECEERDIELIKGLRADLREAGESNIGIIFNQ"
     misc_feature    260176..260757
                     /locus_tag="ECL_00260"
                     /note="Uncharacterized protein YjaG, DUF416 family
                     [Function unknown]; Region: YjaG; COG3068"
                     /db_xref="CDD:225610"
     gene            260953..261225
                     /locus_tag="ECL_00261"
                     /db_xref="GeneID:9122771"
     CDS             260953..261225
                     /locus_tag="ECL_00261"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator HU subunit alpha"
                     /protein_id="YP_003610777.1"
                     /db_xref="GeneID:9122771"
                     /translation="MNKTQLIDVIADKADLSKVQAKAALESTLAAITESLKEGDAVQL
                     VGFGTFKVNHRAERTGRNPQTGKEIKIAAANVPAFVSGKALKDAVK"
     misc_feature    260953..261222
                     /locus_tag="ECL_00261"
                     /note="transcriptional regulator HU subunit alpha;
                     Provisional; Region: PRK10753"
                     /db_xref="CDD:138142"
     misc_feature    order(260968..260970,260977..260982,260989..260991,
                     261016..261027,261031..261039,261043..261051,
                     261055..261060,261070..261084,261091..261093,
                     261175..261183,261187..261189,261193..261195,
                     261205..261210)
                     /locus_tag="ECL_00261"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:259853"
     misc_feature    order(261109..261111,261115..261120,261124..261126,
                     261130..261141,261154..261159,261163..261165)
                     /locus_tag="ECL_00261"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:259853"
     gene            261231..261929
                     /locus_tag="ECL_00262"
                     /db_xref="GeneID:9122772"
     CDS             261231..261929
                     /locus_tag="ECL_00262"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610778.1"
                     /db_xref="GeneID:9122772"
                     /translation="MAVNSFNEGAATPLLSFWRGALALAGVLLLSACSHDTSLPPFTA
                     SGYADNQGAVRIWRKDSGGEVHLLSAFSPWHNGNTSTAEYRWQGDDLSFIELNIYGKT
                     PEHVKVRFDDHGELSFMQREVNAQKQQLSSDQVALYRYRAGQIRQTSDALRQGRVVLR
                     QGRWHTDGTVTTCEGQTVKPDLESWATEHIQRRQRHSSMEVSVAWLEAPEGSQLLLVA
                     NEDFCTWQPTEKSF"
     misc_feature    261360..261914
                     /locus_tag="ECL_00262"
                     /note="Protein of unknown function (DUF1481); Region:
                     DUF1481; pfam07356"
                     /db_xref="CDD:311355"
     gene            complement(261977..263269)
                     /locus_tag="ECL_00263"
                     /db_xref="GeneID:9122773"
     CDS             complement(261977..263269)
                     /locus_tag="ECL_00263"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosylglycineamide synthetase"
                     /protein_id="YP_003610779.1"
                     /db_xref="GeneID:9122773"
                     /translation="MKVLVIGNGGREHALAWKAAQSPLVETVFVAPGNAGTALEPALQ
                     NVAIGVTDIPALLSFAQNEKIDLTIVGPEAPLVIGVVDAFRAAGLKIFGPTEGAAQLE
                     GSKAFTKDFLARHNIPTAEYQNFTEVEPALAYLREKGAPIVIKADGLAAGKGVIVAMT
                     LEEAEAAVQDMLAGNAFGDAGHRIVIEEFLDGEEASFIVMVDGEHVLPMATSQDHKRV
                     GNADTGPNTGGMGAYSPAPVVTDEVHQRTMDRIIWPTVKGMAAEGNTYTGFLYAGLMI
                     DKQGNPKVIEFNCRFGDPETQPIMLRMKSDLVELCLAACDGKLDEKTSEWDERASLGV
                     VIAAGGYPGHYNTGDEIHGLPLEETEGAKVFHAGTKLADDDRVLTNGGRVLCATALGH
                     TVAEAQKRAYALMADIHWNGSFSRQDIGYRAIAREQGE"
     misc_feature    complement(261992..263269)
                     /locus_tag="ECL_00263"
                     /note="phosphoribosylamine--glycine ligase; Provisional;
                     Region: PRK00885"
                     /db_xref="CDD:234856"
     gene            complement(263285..264874)
                     /locus_tag="ECL_00264"
                     /db_xref="GeneID:9122774"
     CDS             complement(263285..264874)
                     /locus_tag="ECL_00264"
                     /codon_start=1
                     /transl_table=11
                     /product="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase"
                     /protein_id="YP_003610780.1"
                     /db_xref="GeneID:9122774"
                     /translation="MQQRRPVRRALLSVSDKAGIVEFAQALSARGVELLSTGGTARLL
                     ADKGLPVTEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGQDDAIMEQHDIAPIDMVV
                     VNLYPFAQTVAREGCSLEDAVENIDIGGPTMVRSAAKNHKDVAIVVKSSDYSAIINEM
                     DANEGSLTLDTRFDLAIKAFEHTAAYDSMIANYFGSLVPAYHGESKDPSGRFPRTLNL
                     NFIKKQDMRYGENSHQQAAFYIEEEVKEASVATAQQVQGKALSYNNIADTDAALECVK
                     EFNEPACVIVKHANPCGVAVSTSILDAYDRAYKTDPTSAFGGIIAFNRELDAETAQAI
                     ISRQFVEVIIAPSASEEALKITAAKQNVRVLVCGQWAERVPGLDFKRVNGGLLVQDRD
                     LGMVTAADLRVVTKRQPTEQELRDALFCWKVAKFVKSNAIVYAKENMTIGIGAGQMSR
                     VYSAKIAGIKAGDEGLEVKGSAMASDAFFPFRDGIDAAAAVGITCVIQPGGSIRDDEV
                     IAAADEHGIAMIFTDMRHFRH"
     misc_feature    complement(263288..264865)
                     /locus_tag="ECL_00264"
                     /note="bifunctional
                     phosphoribosylaminoimidazolecarboxamide
                     formyltransferase/IMP cyclohydrolase; Provisional; Region:
                     purH; PRK00881"
                     /db_xref="CDD:234854"
     gene            265437..266982
                     /locus_tag="ECL_16S01"
                     /db_xref="GeneID:9122775"
     rRNA            265437..266982
                     /locus_tag="ECL_16S01"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:9122775"
     gene            267179..270085
                     /locus_tag="ECL_23S01"
                     /db_xref="GeneID:9127644"
     rRNA            267179..270085
                     /locus_tag="ECL_23S01"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:9127644"
     gene            270143..270263
                     /locus_tag="ECL_5S01"
                     /db_xref="GeneID:9127652"
     rRNA            270143..270263
                     /locus_tag="ECL_5S01"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:9127652"
     gene            270437..271366
                     /locus_tag="ECL_00265"
                     /db_xref="GeneID:9127660"
     CDS             270437..271366
                     /locus_tag="ECL_00265"
                     /codon_start=1
                     /transl_table=11
                     /product="homoserine O-succinyltransferase"
                     /protein_id="YP_003610781.1"
                     /db_xref="GeneID:9127660"
                     /translation="MPIRVQDELPAVNFLREENVFVMTTSRATGQEIRPLKVLILNLM
                     PKKIETENQFLRLLSNSPLQVDIQLLRIDARESRNTPSEHLNNFYCNFDDIREENFDG
                     LIVTGAPLGLVEFNDVAYWPQIKQVLEWAKDHVTSTLFVCWAVQAALNILYGIPKQTR
                     TEKLSGVYEHHILHPHALLTRGFDDSFLAPHSRYADFPAQLIRDYTDLEILAETEDGD
                     AYLFASKDKRIAFVTGHPEYDPHTLAAEYFRDVEAGLNPDVPYNYFPKNDPQNKPRAT
                     WRSHGNLLFTNWLNYYVYQITPYDLRHMNPTLE"
     misc_feature    270437..271342
                     /locus_tag="ECL_00265"
                     /note="homoserine O-succinyltransferase; Provisional;
                     Region: PRK05368"
                     /db_xref="CDD:235433"
     misc_feature    270575..270577
                     /locus_tag="ECL_00265"
                     /note="proposed active site lysine [active]"
                     /db_xref="CDD:153225"
     misc_feature    270860..270862
                     /locus_tag="ECL_00265"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153225"
     gene            271637..273238
                     /locus_tag="ECL_00266"
                     /db_xref="GeneID:9122776"
     CDS             271637..273238
                     /locus_tag="ECL_00266"
                     /codon_start=1
                     /transl_table=11
                     /product="malate synthase"
                     /protein_id="YP_003610782.1"
                     /db_xref="GeneID:9122776"
                     /translation="MTQQATTVDELAFTQPYGEQEQQILTAEAVEFLTELVTRFTPQR
                     NKLLAARIHQQQEIDNGKLPGFISETASIRRGDWKIRGIPEDLQDRRVEITGPVERKM
                     VINAMNANVKVFMADFEDSLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNP
                     AVLICRVRGLHLPEKHVTWRGEAIPGSLFDFALYFFHNHKNLLAKGSGPYFYLPKTQA
                     WQEAAWWSEVFSYAEDRFNLPRGTIKATLLIETLPAVFQMHEILHALRDHIVGLNCGR
                     WDYIFSYIKTLKNHPDRVLPDRQVVTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFI
                     PSKDAERNNQVLNKVKADKELEARNGHDGTWIAHPGLADTAMEVFNHVLGDNKNQLFV
                     TRDDDAPIAEEQLLAPCSGERTEEGMRANIRVAVQYIEAWISGNGCVPIYGLMEDAAT
                     AEISRTSIWQWIHHQKTLSNGKPVTKSLFRQMLAEEMRVIQDELGEHRFSSGRFDDAA
                     RLMEQITTSDDLIDFLTLPGYRLLA"
     misc_feature    271643..273235
                     /locus_tag="ECL_00266"
                     /note="malate synthase; Validated; Region: PRK09255"
                     /db_xref="CDD:236432"
     misc_feature    order(272132..272134,272384..272386,272462..272464,
                     272468..272470,272975..272977)
                     /locus_tag="ECL_00266"
                     /note="active site"
                     /db_xref="CDD:238369"
     gene            273271..274575
                     /locus_tag="ECL_00267"
                     /db_xref="GeneID:9122777"
     CDS             273271..274575
                     /locus_tag="ECL_00267"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate lyase"
                     /protein_id="YP_003610783.1"
                     /db_xref="GeneID:9122777"
                     /translation="MKTRTQQIEELKKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECT
                     LAQNGAVKMWHLLHGGSKKGYINSLGALTGGQALQQAKAGIEAIYLSGWQVAADANLA
                     SSMYPDQSLYPANSVPSVVDRINNTFRRADQIQWAAGIEPNDPRFIDYFLPIVADAEA
                     GFGGVLNAFELMKSMIEAGAAAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARL
                     AADVLGVPTLVIARTDADAADLITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRG
                     LAYAPYADLVWCETSTPDLALAKRFADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIA
                     SFQQQLSDMGYKYQFITLAGIHSMWFNMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKE
                     GYTFVSHQQEVGTGYFDNVTTIIQGGASSVTALTGSTEEAQF"
     misc_feature    273271..274572
                     /locus_tag="ECL_00267"
                     /note="isocitrate lyase; Provisional; Region: PRK15063"
                     /db_xref="CDD:237893"
     misc_feature    order(273433..273435,273463..273465,273469..273480,
                     273484..273498,273502..273507,273514..273516,
                     273520..273528,273547..273549,273559..273561,
                     273577..273579,273586..273591,273598..273609,
                     273613..273618,273625..273630,273634..273639,
                     273646..273651,273757..273759,273775..273780,
                     273790..273792,273799..273801,273889..273894,
                     273901..273903,273910..273915,273922..273924,
                     274339..274347,274351..274359,274363..274371)
                     /locus_tag="ECL_00267"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119340"
     misc_feature    order(273535..273537,273541..273549,273592..273594,
                     273739..273741,273745..273747,273826..273828,
                     273964..273966,274135..274137,274219..274221,
                     274225..274227,274321..274323)
                     /locus_tag="ECL_00267"
                     /note="active site"
                     /db_xref="CDD:119340"
     misc_feature    order(273592..273594,273739..273741,273745..273747,
                     273826..273828)
                     /locus_tag="ECL_00267"
                     /note="Mg2+/Mn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:119340"
     gene            274626..276365
                     /locus_tag="ECL_00268"
                     /db_xref="GeneID:9122778"
     CDS             274626..276365
                     /locus_tag="ECL_00268"
                     /codon_start=1
                     /transl_table=11
                     /product="isocitrate dehydrogenase kinase/phosphatase"
                     /protein_id="YP_003610784.1"
                     /db_xref="GeneID:9122778"
                     /translation="MSRGLELLIAQTILQGFDAQYGRFLEVTSGAQQRFEHADWHAVQ
                     QAMKQRIHLYDHHVGLVVEQLRCITDGKNPDAAFLLRVKEHYTHLLPDYPRFEIAESF
                     FNSVYCRLFDHRSLSPERLFIFSSQPERRFRTIPRPLAKDFFPDHGWEKLLHRVLTDL
                     PLRLPWENKARDIGFIIAHLHESFGEEALSHCHLQVANELFYRNKAAWLVGKLVTPSA
                     TVPFLLPIHRTDDGELFVDTCLTTSAEASIVFGFARSYFMVYAPLPAALVEWLREILP
                     GKTTAELYMAIGCQKHAKTESYREYLRYVTTADEQFIEAPGIRGMVMLVFTLPGFDRV
                     FKVIKDTFAPQKEMTAAHVRACYQLVKEHDRVGRMADTQEFENFVLDKRQIDPALMAL
                     LLQEAPAKITDLGDKIAISHLYIERRMVPLNIWLEQADGQALKDAIEEYGNAIRQLAA
                     ANIFPGDMLFKNFGVTRHGRVVFYDYDEICYMTEVNFRDIPPPRYPEDELSGEPWYSV
                     SPGDVFPEEFRHWLCADPRIGPLFEEMHADLFRASYWRGLQTRIKNGHVEDVYAYRRK
                     QRFCIRFSPYHAG"
     misc_feature    274626..276344
                     /locus_tag="ECL_00268"
                     /note="Isocitrate dehydrogenase kinase/phosphatase [Signal
                     transduction mechanisms]; Region: AceK; COG4579"
                     /db_xref="CDD:226945"
     gene            complement(276434..277261)
                     /locus_tag="ECL_00269"
                     /db_xref="GeneID:9122779"
     CDS             complement(276434..277261)
                     /locus_tag="ECL_00269"
                     /codon_start=1
                     /transl_table=11
                     /product="IclR family transcriptional regulator"
                     /protein_id="YP_003610785.1"
                     /db_xref="GeneID:9122779"
                     /translation="MVTTVPAKRGRKPAATPAAQQGGQVQSLTRGLKLLEWIAESHSS
                     VALTELAQQAGLPNSTTHRLLTTMQQLGFVRQVGELGHWAVGAHAFIVGSSFLQSRNL
                     LAIVHPILRKLMEESGETVNLAVLDQSDHQAIIIDQVQCTQLMRMSAPIGGKLPMHAS
                     GAGKAFLSQLSEEQVTGLLHRKGLHAYTHATLVSPVHLKEDLALTRKRGYSFDDEEHA
                     LGLRCIAACIFDEHREPFAAISISGPISRMTDDRVTELGALVIKAAKEVTLAYGGIR"
     misc_feature    complement(276437..277261)
                     /locus_tag="ECL_00269"
                     /note="transcriptional repressor IclR; Provisional;
                     Region: PRK11569"
                     /db_xref="CDD:183206"
     gene            277455..281138
                     /locus_tag="ECL_00270"
                     /db_xref="GeneID:9122780"
     CDS             277455..281138
                     /locus_tag="ECL_00270"
                     /codon_start=1
                     /transl_table=11
                     /product="B12-dependent methionine synthase"
                     /protein_id="YP_003610786.1"
                     /db_xref="GeneID:9122780"
                     /translation="MSSKVEQLRAQLNERILVLDGGMGTMIQSYRLSEDDFRGERFAD
                     WPCDLKGNNDLLVLSKPQVIADIHNAYFEAGADIVETNTFNSTTIAMADYQMESLSAE
                     INYEAAKLARACADAWTARTPEKPRYVAGVLGPTNRTASISPDVNDPAFRNITFDQLV
                     AAYRESTKALVEGGSDLILIETVFDTLNAKAAIYAVKEEFEALGVELPIMISGTITDA
                     SGRTLSGQTTEAFYNSLRHAEALSFGLNCALGPDELRQYVQELSRIAECYVTAHPNAG
                     LPNAFGEYDLDADTMAAQIREWAESGFLNIVGGCCGTTPEHIAAMSNAVAGLPPRKLP
                     ELPVACRLSGLEPLTIGDDSLFVNVGERTNVTGSAKFKRLIKEEKYSEALDVARQQVE
                     SGAQIIDINMDEGMLDAEAAMVRFLNLIAGEPDIARVPIMIDSSKWEVIEKGLKCIQG
                     KGIVNSISMKEGVDIFIHHAKMVRRYGAAVVVMAFDEVGQADTRERKIEICRRAYKIL
                     TEEVGFPPEDIIFDPNIFAVATGIEEHNNYAQDFIGACEDIKRELPHALISGGVSNVS
                     FSFRGNDPVREAIHAVFLYYAIRNGMDMGIVNAGQLAIYDDLPAELRDAVEDVILNRR
                     DDATERLLDLAEKYRGSKSDDAANVQQAEWRSWDVKKRLEYSLVKGITEFIEQDTEEA
                     RQQAARPIEVIEGPLMDGMNVVGDLFGEGKMFLPQVVKSARVMKQAVAYLEPFIEASK
                     EQGSSNGKMVIATVKGDVHDIGKNIVGVVLQCNNYEIIDLGVMVPADKILRTAREVNA
                     DLIGLSGLITPSLDEMVNVAKEMERQGFTIPLLIGGATTSKAHTAVKIEQNYSGPTVY
                     VQNASRTVGVVSALLSDTQRDDFVARTRKEYETVRIQHARKKPRTPPVTLQAARDNDL
                     AFDWASYTPPVAHRLGVQEVTANIETLRNYIDWTPFFMTWSLAGKYPRILEDEVVGEE
                     AKRLFKDANDMLDKLSAEKALNPRGVVGLFPANRVGDDIEIYRDETRTHVLTVSHHLR
                     QQTEKVGFANYCLADFVAPKLSGKADYIGAFAVTGGLEEDALADAFEAQHDDYNKIMV
                     KAIADRLAEAFAEYLHERVRKVYWGYAANENLSNEELIRENYQGIRPAPGYPACPEHT
                     EKGTIWQLLDVEAHTGMKLTESFAMWPGASVSGWYFSHPDSKYFAVAQLQRDQIEDYA
                     LRKGMSVSEVERWLAPNLGYDAD"
     misc_feature    277455..281123
                     /locus_tag="ECL_00270"
                     /note="B12-dependent methionine synthase; Provisional;
                     Region: metH; PRK09490"
                     /db_xref="CDD:236539"
     gene            281255..282886
                     /locus_tag="ECL_00271"
                     /db_xref="GeneID:9122781"
     CDS             281255..282886
                     /locus_tag="ECL_00271"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium-dependent inorganic phosphate (Pi)
                     transporter"
                     /protein_id="YP_003610787.1"
                     /db_xref="GeneID:9122781"
                     /translation="MLTLLHLLSAVALLVWGTHIVRTGVMRVFGARLRTVLSSSVEKK
                     PLAFCAGIGVTALVQSSNATTLLVTSFVAQDLVALAPALVIVLGADVGTALMARILTF
                     DLSWLSPLLIFIGVIFFLGRKQTRAGQLGRVGIGLGLILLALELIVQAVTPITEANGV
                     QVIFASLTGDIMLDALIGAVFAIVSYSSLAAVLLTATLTAAGAISFPVALCLVIGANL
                     GSGLLAMLNNSAANAAARRVALGSLLFKLVGSLIILPFVHPLANLMDNLSLPKAELVI
                     YFHVFYNLVRCLAMVPFAEPMARFCERLIRDEPELDARLKPKHLDTSALDTPALALAN
                     AARETLRMGDAMETMLEGLQKVMHGEPREEKELRRLADDINVLYTAIKLYLARIPQDE
                     LAEEESRRWAEIIEMSLNLEQASDIVERMGSEIADKSLAARRAFSVEGLKELEALHEQ
                     LLSNLKLAMLVFFSSDVPSARRLRRNKHRFRILNRRYSHAHVERLHQQNVQSIETSSL
                     HLGLLGDMKRLNSLFCAVAYSVMEQPDEDDERDEY"
     misc_feature    281255..282856
                     /locus_tag="ECL_00271"
                     /note="Na+/phosphate symporter [Inorganic ion transport
                     and metabolism]; Region: NptA; COG1283"
                     /db_xref="CDD:224202"
     gene            complement(282883..283170)
                     /locus_tag="ECL_00272"
                     /db_xref="GeneID:9122782"
     CDS             complement(282883..283170)
                     /locus_tag="ECL_00272"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_003610788.1"
                     /db_xref="GeneID:9122782"
                     /translation="MHKLTPYDPAIALVDDEEIAVFMADALETGDSAYIAKALGVIAR
                     AKGMSTISQQTGLSREQLYRSFSDKGNPTLKTTLAVMKALGLGLTIKPAGD"
     misc_feature    complement(282898..283164)
                     /locus_tag="ECL_00272"
                     /note="probable addiction module antidote protein; Region:
                     dnstrm_HI1420; TIGR02684"
                     /db_xref="CDD:188241"
     gene            283165..283371
                     /locus_tag="ECL_00273"
                     /db_xref="GeneID:9122783"
     CDS             283165..283371
                     /locus_tag="ECL_00273"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610789.1"
                     /db_xref="GeneID:9122783"
                     /translation="MHAHSLLPLGYIAQHFCHKYVSGLAAFVTTTQQHDDAIALVFKI
                     DSVARTKVDPQLAYTFPHGFYVAR"
     gene            283677..284546
                     /locus_tag="ECL_00274"
                     /db_xref="GeneID:9122784"
     CDS             283677..284546
                     /locus_tag="ECL_00274"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA pseudouridine synthase F"
                     /protein_id="YP_003610790.1"
                     /db_xref="GeneID:9122784"
                     /translation="MLPTQSIRLNKYISESGICSRREADRYIEQGNVFLNGKRATIGD
                     QVMPGDVVKVNGQLIEPRDAEDLVFIALNKPVGIVSTTEDGERDNIVDFVNHSSRIFP
                     IGRLDKDSQGLIFLTNHGDLVNKILRAGNDHEKEYIVTVNKPVTDEFIRGMGAGVPIL
                     GTVTKKCKVKKEAPFAFRITLVQGLNRQIRRMCEYFGYEVTKLERTRIMNVSLSGIPL
                     GEWRDLTDDELIELFKLIENSSSEAKPKAKAKPKTQAIKRPVVKAPQSEEKGRGKPAG
                     KRFTQPGRKKKGR"
     misc_feature    283677..284543
                     /locus_tag="ECL_00274"
                     /note="23S rRNA pseudouridine synthase F; Provisional;
                     Region: PRK10475"
                     /db_xref="CDD:236698"
     gene            complement(284614..285558)
                     /locus_tag="ECL_00275"
                     /db_xref="GeneID:9122785"
     CDS             complement(284614..285558)
                     /locus_tag="ECL_00275"
                     /codon_start=1
                     /transl_table=11
                     /product="bile acid:sodium symporter"
                     /protein_id="YP_003610791.1"
                     /db_xref="GeneID:9122785"
                     /translation="MLSAITRLFPLWALLLSILAYYTPTTFTGIGPWVTTLLMLIMFG
                     MGVHLKIDDFKRVLSRPAPVAAGIFLHYLVMPLAAWLLAMAFKMPPDLSAGMVLVGSV
                     ASGTASNVMIYLAKGDVALSVTISSVSTLVGVIATPLLTRLYVDAHIQVDVMGMLLSI
                     LQIVVIPIALGLVIHHLFPRVVKAVEPYLPAFSMVCILAIISAVVAGSASHIASVGFV
                     VIIAIVLHNTIGLLGGYWGGKLFGFDESTCRTLAIEVGMQNSGLAAALGKIYFSPLAA
                     LPGALFSVWHNLSGSLLAGYWSGKPIEEKPQKTDEYRL"
     misc_feature    complement(284626..285546)
                     /locus_tag="ECL_00275"
                     /note="Predicted Na+-dependent transporter [General
                     function prediction only]; Region: YfeH; COG0385"
                     /db_xref="CDD:223462"
     gene            complement(285651..287000)
                     /locus_tag="ECL_00276"
                     /db_xref="GeneID:9122786"
     CDS             complement(285651..287000)
                     /locus_tag="ECL_00276"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate kinase III"
                     /protein_id="YP_003610792.1"
                     /db_xref="GeneID:9122786"
                     /translation="MTSFVVAKFGGTSVADYDAMNRSADVVLADPNTRLVVLSASAGV
                     TNLLVSLSEGLEATERFVKLDALRKIQFDILERLQNPNVIREEVERLLENITTLAEAA
                     SLATSTALTDELVSHGELMSTLLFVEIMRERNVQAQWFDVRKIMRTSDRFGRAEPDVE
                     ALAELTNQQLVPRLDEGIVITQGFIGSEAKGRTTTLGRGGSDYTAALLGEALHATRVD
                     IWTDVPGIYTTDPRVVSAAKRIDVIAFEEAAEMATFGAKVLHPATLLPAVRSDIPVFV
                     GSSKDPKAGGTLVCKKTENPPLFRALALRRKQTLVTLHSHNMLHSRGFLAEVFGILAR
                     HNISVDLITTSEVSIALTLDTTGSTSTGDTLLTQSLLIELSELCRVEVEENLALVAII
                     GNKLSRACGVGKEVFGVLDPFNIRMICYGASSYNLCFLVPAEQAEQVVQKLHQNLFE"
     misc_feature    complement(285654..286991)
                     /locus_tag="ECL_00276"
                     /note="aspartate kinase III; Validated; Region: PRK09084"
                     /db_xref="CDD:236376"
     gene            287376..289025
                     /locus_tag="ECL_00277"
                     /db_xref="GeneID:9122787"
     CDS             287376..289025
                     /locus_tag="ECL_00277"
                     /codon_start=1
                     /transl_table=11
                     /product="glucose-6-phosphate isomerase"
                     /protein_id="YP_003610793.1"
                     /db_xref="GeneID:9122787"
                     /translation="MKNINPTQTAAWQALQKHFDEMKDVTIAELFAKDADRFNKFSAT
                     FDDLMLVDFSKNRITEETLAKLQDLAKETELADAIKSMFSGEKINRTEDRAVLHVALR
                     NRSNTPIIVDGKDVMPEVNAVLEKMKAFSEAIISGSWKGYTGKAITDVVNIGIGGSDL
                     GPFMVTEALRPYKNHLNMHFVSNVDGTHIAEVLKNVNPETTLFLVASKTFTTQETMTN
                     AHSARDWFLKIAGDNKHVAKHFAALSTNGKAVGEFGIDTANMFEFWDWVGGRYSLWSA
                     IGLSIILSVGFDNFVELLSGAHAMDKHFSTTAPEKNLPVLLALIGIWYNNFFGAETEA
                     ILPYDQYMHRFAAYFQQGNMESNGKYVDRNGNAVDYQTGPIIWGEPGTNGQHAFYQLI
                     HQGTKMVPCDFIAPAITHNPLSDHHPKLLSNFFAQTEALAFGKSREVVEQEYRDQGKD
                     PATLEHVVPFKVFEGNRPTNSILLREITPFSLGALIALYEHKIFTQGAILNIFTFDQW
                     GVELGKQLANRILPELGDDKAISSHDSSTNGLINRYKAWRA"
     misc_feature    287379..289022
                     /locus_tag="ECL_00277"
                     /note="glucose-6-phosphate isomerase; Reviewed; Region:
                     pgi; PRK00179"
                     /db_xref="CDD:234679"
     gene            289393..289635
                     /locus_tag="ECL_00278"
                     /db_xref="GeneID:9122788"
     CDS             289393..289635
                     /locus_tag="ECL_00278"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610794.1"
                     /db_xref="GeneID:9122788"
                     /translation="MKKVLYGIFAISALAATSVYAAPVQVGEAAGSAATSASAGSSTA
                     ASTSTVSSAVGVALAATGGGDGSNTGTTTTTTTSTQ"
     gene            289699..290337
                     /locus_tag="ECL_00279"
                     /db_xref="GeneID:9122789"
     CDS             289699..290337
                     /locus_tag="ECL_00279"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_003610795.1"
                     /db_xref="GeneID:9122789"
                     /translation="MKRPAIILICLLLQACSATTKGLGNSLWDSIFGTPGVHLTDDEL
                     QNMPYASQYMQLNDGPQLFVVLAFDENGQQKWVTQDQATIVTQHSRIVKTLLGGDNLL
                     EVNNLAADPLSKPNQITDGASWTRTMGWTEHKQVRYATARSTFRWDGTDSVRVGSDET
                     RVRVLDEEVTTDRATWHNRFWVDDEGQIRQSLQYLGAGFFPVKTTLIKAAKS"
     misc_feature    289747..290319
                     /locus_tag="ECL_00279"
                     /note="Group 4 capsule polysaccharide lipoprotein gfcB,
                     YjbF; Region: YjbF; pfam11102"
                     /db_xref="CDD:314120"
     gene            290334..291071
                     /locus_tag="ECL_00280"
                     /db_xref="GeneID:9122790"
     CDS             290334..291071
                     /locus_tag="ECL_00280"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610796.1"
                     /db_xref="GeneID:9122790"
                     /translation="MKTLIRVALIASFATPLAWSAGTVKVYTPDSTQPKTLTNAGNLI
                     DLVGQPRLANSWWTGAVIAERQATVAAEQKHKALLARLTGLAEQEDGDDAAAINSLRQ
                     QLLALKVTGRQNINLDPDEVRVTEKGNPALEGDYTLWLPAQPSTITVMGLISSPGKKP
                     FTPGRDVASYLDEQSLLSGADNSYAWVIYPDGNTQKAPVAYWNKRHVEPMPGSIIFVG
                     FADHFWTKAYDGLNADILHSLTQRIPE"
     misc_feature    290391..291065
                     /locus_tag="ECL_00280"
                     /note="Capsule biosynthesis GfcC; Region: Caps_synth_GfcC;
                     pfam06251"
                     /db_xref="CDD:283829"
     gene            291071..293167
                     /locus_tag="ECL_00281"
                     /db_xref="GeneID:9122791"
     CDS             291071..293167
                     /locus_tag="ECL_00281"
                     /codon_start=1
                     /transl_table=11
                     /product="putative lipoprotein"
                     /protein_id="YP_003610797.1"
                     /db_xref="GeneID:9122791"
                     /translation="MKKTYLYSMLALCVSAACHAETYPAPIGPSQSDFGGVGLLQTPT
                     ARMAREGEISLNYRDNDQYRYYSASVQLFPWLETTLRYTDVRTKQYSSVDAFSGDQTY
                     KDKAFDLKLRLWEESYWMPQVSVGAKDIGGTGLFDAEYIVASKAWGPFDFSLGLGWGY
                     LGTSGNVKNPFCTYSDKFCYRDNSYQKAGSINGDQMFHGPAALFGGVEYQTPWQPLRL
                     KLEYEGNDYSQEFAGKIEQKSKFNVGAIYRVTDWADVNLSYERGNTVMFGFTLRTNFN
                     DMRPHYNDNARPAYQPEPQDAILQHSVVANQLTLLKYNAGLADPKIQVKGDTLYVTGE
                     QVKYRDSREGIERANRIIMNDLPEGIRTIRVTENRLNLPQVTTETDVASLKRHLEGEP
                     LGHETELVQKRVEPIVPETTEQGWYIDKSRFDFHIDPVLNQSVGGPENFYMYQLGVMA
                     TADLWVTDHLLTTGSLFGNIANNYDKFNYTNPPNDTKLPRVRTRVREYVQNDAYVNNL
                     QANYFQYFGNGFYGQVYGGYLETMYGGAGAEVLYRPVDSNWAFGIDANYVKQRDWRSA
                     QDMMKFTDYSVKTGHLTAYWTPSFAQDVLVKASVGQYLAGDKGGTLDISKHFDSGVVV
                     GGYATITNVSPDEYGEGDFTKGVYVSIPLDLFSSGPTRSRAAIGWTPLTRDGGQQLGR
                     KFQLYDMTSDKNINFR"
     misc_feature    291158..293146
                     /locus_tag="ECL_00281"
                     /note="Exopolysaccharide biosynthesis protein YbjH;
                     Region: YjbH; pfam06082"
                     /db_xref="CDD:310577"
     gene            complement(293223..293675)
                     /locus_tag="ECL_00282"
                     /db_xref="GeneID:9122792"
     CDS             complement(293223..293675)
                     /locus_tag="ECL_00282"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
                     N-acyltransferase"
                     /protein_id="YP_003610798.1"
                     /db_xref="GeneID:9122792"
                     /translation="MERRPTGVRNVTCGENVTLYEPCNLYDCVLGNGVFIGPFVEIQG
                     NTRIGDESKIQSHTFICEYVTLGERCFIGHGVMFANDMFRDGKPNTDRNSWGRITVGN
                     DVSIGSGATILAVSICDGVVIGAGSVVTKSITEKGVYAGNPARLLRRL"
     misc_feature    complement(293232..293588)
                     /locus_tag="ECL_00282"
                     /note="WcxM-like, Left-handed parallel beta-Helix (LbH)
                     N-terminal domain: This group is composed of Xanthomonas
                     campestris WcxM and proteins with similarity to the WcxM
                     N-terminal domain. WcxM is thought to be bifunctional,
                     catalyzing both the isomerization...; Region:
                     LbH_WxcM_N_like; cd03358"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(293250..293252,293298..293300,
                     293352..293354,293361..293363,293367..293369,
                     293418..293420,293424..293429,293445..293447,
                     293463..293465,293469..293471,293493..293495,
                     293517..293519,293523..293525))
                     /locus_tag="ECL_00282"
                     /note="putative trimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(293247..293249,293253..293258,
                     293283..293288,293301..293306,293337..293339,
                     293352..293357,293361..293363,293418..293420,
                     293427..293429,293511..293513,293517..293519))
                     /locus_tag="ECL_00282"
                     /note="putative active site [active]"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(293427..293429,293511..293513,
                     293517..293519))
                     /locus_tag="ECL_00282"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:100048"
     misc_feature    complement(order(293235..293237,293247..293249,
                     293253..293258,293262..293264,293283..293288,
                     293301..293306,293310..293312,293337..293339,
                     293352..293357,293361..293363,293418..293420,
                     293427..293429))
                     /locus_tag="ECL_00282"
                     /note="putative CoA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100048"
     gene            293772..294182
                     /locus_tag="ECL_00283"
                     /db_xref="GeneID:9122793"
     CDS             293772..294182
                     /locus_tag="ECL_00283"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphate-starvation-inducible protein PsiE"
                     /protein_id="YP_003610799.1"
                     /db_xref="GeneID:9122793"
                     /translation="MTSLTRPRVEFISTILQTVLNLGLLSLGLILVVFLGKETVHLAD
                     VLFAPEQTSKYALVEGLVVYFLYFEFIALIVKYFQSGFHFPLRYFVYIGITAIVRLII
                     VDHKSPLDVLIYSAAILLLVITLWLCNSKRLKRE"
     misc_feature    293787..294179
                     /locus_tag="ECL_00283"
                     /note="phosphate-starvation-inducible protein PsiE;
                     Provisional; Region: PRK02833"
                     /db_xref="CDD:235075"
     gene            294329..296023
                     /locus_tag="ECL_00284"
                     /db_xref="GeneID:9122794"
     CDS             294329..296023
                     /locus_tag="ECL_00284"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system lactose/cellobiose family transporter
                     subunit IIC"
                     /protein_id="YP_003610800.1"
                     /db_xref="GeneID:9122794"
                     /translation="MAHSSILERITDVSQKLASEVHLRSLRDSFIISVPFLVLAGLFI
                     MLNYVFLDPKGILSGLLSTDTLVQLRNIGERVLNGTMNILSLMLVILIAYHIASKKKH
                     PTPVIPAMVALAVFYALMPIETVQTLADGQQARLTGMVSYGSTNAGGVFLAILTAVLS
                     TNLFLWISKNKKLQIRLGDDVPSMVVQSFQSMFSIMLTVAIFALVAFSVNLFLHTEIP
                     TLIQHLIQAPLVHLTTNLSGFLVLTTLTNLLFSLGIHPGGIINPILEPPLLVAMQENM
                     SAFASGQIPPHIIVLPFRDLYGHMGGTGSTLALLLAVFVRSHMSSHRNFSRTVIAPGI
                     FNINEPVIFGFPVLYNPLMMIPFILYPQINFTIAYFATAWGWVSKIVAYVPWSVPPLI
                     SGWLGSGGDFRNVILQILLLALGVVIYLPFLTAYERSLIKRSNETIINTLASESEITL
                     QEDNDIHRLDGKTIILACNEGMSTSLMASKMRKYCESQNCTLNVYAVNAGKLVDEYKN
                     AQLILLGPQIAYLQETILQDINHHCPVIPLDPQHFSKLDGPEVIHAALPYFKKESV"
     misc_feature    294365..295627
                     /locus_tag="ECL_00284"
                     /note="Phosphotransferase system cellobiose-specific
                     component IIC [Carbohydrate transport and metabolism];
                     Region: CelB; COG1455"
                     /db_xref="CDD:224372"
     misc_feature    295718..295996
                     /locus_tag="ECL_00284"
                     /note="PTS_IIB: subunit IIB of enzyme II (EII) is the
                     central energy-coupling domain of the
                     phosphoenolpyruvate:carbohydrate phosphotransferase system
                     (PTS). In the multienzyme PTS complex, EII is a
                     carbohydrate-specific permease consisting of two
                     cytoplasmic...; Region: PTS_IIB; cl10014"
                     /db_xref="CDD:324559"
     misc_feature    295730..295750
                     /locus_tag="ECL_00284"
                     /note="P-loop; other site"
                     /db_xref="CDD:99904"
     misc_feature    order(295730..295732,295736..295741,295745..295750)
                     /locus_tag="ECL_00284"
                     /note="active site"
                     /db_xref="CDD:99904"
     misc_feature    295730..295732
                     /locus_tag="ECL_00284"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:99904"
     gene            296020..297063
                     /locus_tag="ECL_00285"
                     /db_xref="GeneID:9122795"
     CDS             296020..297063
                     /locus_tag="ECL_00285"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610801.1"
                     /db_xref="GeneID:9122795"
                     /translation="MINCAYIGFGKSATRYHLPYVLCRKDKYNVKRIYDIARKPEVEA
                     QPHYQHICFTSRLQDILEDNTLQLVVICTHPDSHFEYARLCLAHGKNVLVEKPFTTTP
                     EEAKTLFALAREKGLTVSPFQNRRFDSCYLTMKQAIESGKLGEIVEIESHFDYFRPAS
                     ETCPGSYFDGAFYGLGVHTLDQIIALLGRPQQVGYHLQRQRNPLNPDDAFTVHLYYPK
                     TTAIVKTSHLVKIPAPRFTVHGTRGSFIRYGIDQQETSLKAGIMPGHPGFGEDSECAV
                     LEYIDDAGCSVREELSAVPGDYGRVYDALYDTLSSGKANYVSEHEALTNLDILQKAFQ
                     QPTPAIVSLEEEA"
     misc_feature    296020..297054
                     /locus_tag="ECL_00285"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: MviM; cl28197"
                     /db_xref="CDD:333017"
     gene            297066..297926
                     /locus_tag="ECL_00286"
                     /db_xref="GeneID:9122796"
     CDS             297066..297926
                     /locus_tag="ECL_00286"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610802.1"
                     /db_xref="GeneID:9122796"
                     /translation="MKRLLNCRASDFRGPITGDSLRDAISASEGRVIMAEIAVQAPPL
                     FAEVTNAELLCAFGADLLLLKGIHFQRPALNGGEERFGADPVSQVKCLTGRLTGVNFE
                     VLPADDLSSPGAFLPAHLEAVRHADFYCLTGYDKPGVTAGRMCQAIAALRAQTNKLIL
                     AAKFYNSGLAQPQEYAGYISAGADGAIFSAPGGCRGASEGRVSHIAQAVQSLGGLAIT
                     TLSSSQEGADCATVRDIGLASKRCGSDMHNFGDAGVAGMADPEALNALSLAIRGRRHT
                     WVRMAASLSR"
     gene            297967..298671
                     /locus_tag="ECL_00287"
                     /db_xref="GeneID:9122797"
     CDS             297967..298671
                     /locus_tag="ECL_00287"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator protein"
                     /protein_id="YP_003610803.1"
                     /db_xref="GeneID:9122797"
                     /translation="MPKYMEIYHEVRRRIVVGIYAPDKKLPEGARLAAEFGCSELTIT
                     KALDLLVREGLVLRKRGLGSFVKRQVSAASNSHLIGTAQRCATQGKTLTTRVQLYTAV
                     PASADIAQKLQIPEGELVHEIHRVRVIAEIPSIVEYTWMPVALFPRLALSHVQHSIYA
                     YITHELGCTVHSAHMKVTGRNASEQERVWLELTEPTTLIQVEQTAFLDNGKLFEYSCA
                     RHLWHTFNFETDFVRV"
     misc_feature    297967..298659
                     /locus_tag="ECL_00287"
                     /note="DNA-binding transcriptional regulator, GntR family
                     [Transcription]; Region: MngR; COG2188"
                     /db_xref="CDD:225099"
     gene            complement(298775..299665)
                     /locus_tag="ECL_00288"
                     /db_xref="GeneID:9122798"
     CDS             complement(298775..299665)
                     /locus_tag="ECL_00288"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter permease"
                     /protein_id="YP_003610804.1"
                     /db_xref="GeneID:9122798"
                     /translation="MAMVQPKSQKLRLLATHLGLLIFIAAIMFPLLMVIAISLRSGNF
                     ATGSLIPDEISWEHWKLALGFSVEHADGRVTPPPFPVLLWLWNSVKVATITAIGIVTL
                     STTCAYAFARMKFPGKASLLKGMLIFQMFPAVLSLVALYALFDRLGQYVPFIGLNTHG
                     GVIFAYLGGIALHVWTIKGYFETIDGSLEEAAALDGATPWQAFRLVLLPLSVPILAVV
                     FILSFIAAITEVPVASLLLRDVNSYTLAVGMQQYLNPQNYLWGDFAAAAVLSAIPITV
                     VFLLAQRWLVNGLTAGGVKG"
     misc_feature    complement(298778..299665)
                     /locus_tag="ECL_00288"
                     /note="maltose transporter permease; Provisional; Region:
                     malG; PRK10998"
                     /db_xref="CDD:182891"
     misc_feature    complement(order(298844..298846,298853..298858,
                     298865..298870,298874..298879,298886..298891,
                     298919..298924,298961..298966,298973..298984,
                     299003..299005,299012..299017,299057..299059,
                     299108..299110,299117..299122,299132..299134,
                     299138..299143,299150..299152,299156..299158,
                     299162..299167,299243..299245,299249..299254,
                     299261..299290,299294..299305,299333..299335,
                     299348..299353,299360..299365))
                     /locus_tag="ECL_00288"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(298967..298984,299243..299287))
                     /locus_tag="ECL_00288"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(298889..298891,298919..298921,
                     298928..298930,298964..298966,299180..299182,
                     299243..299245))
                     /locus_tag="ECL_00288"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(299036..299038,299048..299053,
                     299069..299107))
                     /locus_tag="ECL_00288"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(299680..301224)
                     /locus_tag="ECL_00289"
                     /db_xref="GeneID:9122799"
     CDS             complement(299680..301224)
                     /locus_tag="ECL_00289"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter membrane protein"
                     /protein_id="YP_003610805.1"
                     /db_xref="GeneID:9122799"
                     /translation="MDVIKKKHWWQSDVLKWSAIGLLCLLVGYLVVLMYVQGEYLFAI
                     MTLILSSAGLYIFANRKAYAWRYVYPGVAGMGLFVLFPLICTIAIAFTNYSSTNQLAQ
                     ERATQVLLDSSYQAGKTFNFGLYPAGDEWKLALTDGESGKTYISDAFKFGGEQKLALK
                     EAPALPEGERANLRIITQNRQALTQLTAVLPDESKVTMSSLRQFSGTQPLYTLADDGT
                     LTNNQSGVKYRPNNDIGFYQSVNADGSWGDDKLSPGYTVTIGWDNFTRVFTDEGIQKP
                     FFAIFVWTVVFSVLTVLLTVAVGMVLACLVQWEALKGKAIYRVLLILPYAVPSFISIL
                     IFKGLFNQSFGEINMMLSALFGIKPAWFSDPTTARSMIIIVNTWLGYPYMMILCMGLL
                     KAIPDDLYEASAMDGAGPFQNFFKITLPLLIKPLTPLMIASFAFNFNNFVLIQLLTNG
                     GPDRLGTTTPAGYTDLLVSYTYRIAFEGGGGQDFGLAAAIATLIFLLVGALAIVNLKA
                     TRMKFD"
     misc_feature    complement(299683..301224)
                     /locus_tag="ECL_00289"
                     /note="maltose transporter membrane protein; Provisional;
                     Region: malF; PRK10999"
                     /db_xref="CDD:236816"
     gene            complement(301350..302540)
                     /locus_tag="ECL_00290"
                     /db_xref="GeneID:9122800"
     CDS             complement(301350..302540)
                     /locus_tag="ECL_00290"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose ABC transporter periplasmic protein"
                     /protein_id="YP_003610806.1"
                     /db_xref="GeneID:9122800"
                     /translation="MKIKTGARVFALSALAAMMISAPALAKIEEGKLVIWINGDKGYN
                     GLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLL
                     AEVTPDKAFQDKLFPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLVPNPPKTWEEIPK
                     LDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKFENGKYDVKDVGVDNAGAKAGL
                     TFLVDLIKNKHINADTDYSIAEAAFNKGETAMTINGPWAWTNIDKSKINYGVTLLPTF
                     NGKPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDQGLDEVNKDKPLGAVALKSFQ
                     DQLAKDPRIAATMDNAQKGEIMPNIPQMAAFWYATRTAVINAASGRQTVDAALKDAQG
                     RITK"
     misc_feature    complement(301353..302540)
                     /locus_tag="ECL_00290"
                     /note="maltose ABC transporter periplasmic protein;
                     Reviewed; Region: malE; PRK09474"
                     /db_xref="CDD:236533"
     gene            302583..302708
                     /locus_tag="ECL_00291"
                     /db_xref="GeneID:9122801"
     CDS             302583..302708
                     /locus_tag="ECL_00291"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610807.1"
                     /db_xref="GeneID:9122801"
                     /translation="MVQRHSVSLFDILFPSSQPLRPTPGLCDLCCINLSYECWRT"
     gene            302912..304021
                     /locus_tag="ECL_00292"
                     /db_xref="GeneID:9122802"
     CDS             302912..304021
                     /locus_tag="ECL_00292"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose/maltodextrin transporter ATP-binding
                     protein"
                     /protein_id="YP_003610808.1"
                     /db_xref="GeneID:9122802"
                     /translation="MASVQLRNVTKAWGDVVVSKDINLDIHEGEFVVFVGPSGCGKST
                     LLRMIAGLETITSGDLLIGDTRMNDIPPAERGVGMVFQSYALYPHLSVAENMSFGLKL
                     AGAKKEVINQRVTQVAEVLQLAHLLERKPKALSGGQRQRVAIGRTLVAEPRVFLLDEP
                     LSNLDAALRVQMRIEISRLHKRLGRTMIYVTHDQVEAMTLADKIVVLDAGRVAQVGKP
                     LELYHYPADRFVAGFIGSPKMNFLPVKVTATAIEQVQVELPNRQQVWLPVDSANVQVG
                     ANMSLGIRPEHLLPSHIADVTLEGEVQVVEQLGHETQIHIQIPAIRQNLVYRQNDVVL
                     VEEGATFAIGLPPERCHLFREDGTACRRLHKEPGV"
     misc_feature    302912..304018
                     /locus_tag="ECL_00292"
                     /note="maltose/maltodextrin transporter ATP-binding
                     protein; Provisional; Region: PRK11000"
                     /db_xref="CDD:182893"
     gene            304093..305400
                     /locus_tag="ECL_00293"
                     /db_xref="GeneID:9122803"
     CDS             304093..305400
                     /locus_tag="ECL_00293"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose-inducible porin"
                     /protein_id="YP_003610809.1"
                     /db_xref="GeneID:9122803"
                     /translation="MMITLRKVPLALAIAAGIMSAQAGAVDFKGYARSGIGWTGSGGE
                     QQCFQATGAQSKYRLGNECETYAELKLGQEVWKEGDKSFYFDTNVAYSVSQQNDWEST
                     SPAFREANVQGKNLIEWLPGSTIWAGKRFYQRHDVHMIDFYYWDISGPGAGIENIDLG
                     FGKLSLAATRSSESGGSATFADRDANGDRVYDNVVPNDVFDVRLAGLETNPGGTLELG
                     VDYGHTNIPDDYYLQPGASKDGWLFTAEHTQSMMKGFNKFVLQYGTDSMTSNGKGIPQ
                     GGSVDNDGSMWRVLDHGAITLADRWDLMYVGMYQNIDRDNNNGTEWWTVGVRPMFKWT
                     PIMSTLLEVGYDNVKSQRTDEKNSQYKITLAQQWQAGDSIWSRPAIRVFATYAKWDEK
                     WGYANNSDTGYTSGVAYSDTSAKTFSRGDNDEWTFGAQMEIWW"
     misc_feature    304093..305397
                     /locus_tag="ECL_00293"
                     /note="maltoporin; Provisional; Region: lamB; PRK09360"
                     /db_xref="CDD:236481"
     gene            305515..306459
                     /locus_tag="ECL_00294"
                     /db_xref="GeneID:9122804"
     CDS             305515..306459
                     /locus_tag="ECL_00294"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose regulon periplasmic protein"
                     /protein_id="YP_003610810.1"
                     /db_xref="GeneID:9122804"
                     /translation="MKMKKSLVALCLSAGLLACVPAVSFADVNFVPQNTSAAPAIPAA
                     ALQQLTWTPVDQSKTQSTQLSMGGQQLNVPGISGPVAAYSVPANIGELTLTLTSEVNK
                     QTSVFAPNVLILDQNMTPSAFFPSDYFSYQEPGVMSADRLEGVMRLTPALGQQKIYVL
                     VFTTEKDLQQTTKLVDPAKAYAKGTGNSVPDIPDPLARHTTDGLVKLKVSTNSASSVL
                     VGPLFGSSGTGPVTVGNTAAPVYTAPAATAAATAAPAPAKKAEPVLNDTEEYFNNAIK
                     QAVKRGDVDKALKLLDEAERLGSTTARSTFISSVKGKG"
     misc_feature    305518..306456
                     /locus_tag="ECL_00294"
                     /note="maltose regulon periplasmic protein; Provisional;
                     Region: PRK10564"
                     /db_xref="CDD:236716"
     gene            306640..307137
                     /locus_tag="ECL_00295"
                     /db_xref="GeneID:9122805"
     CDS             306640..307137
                     /locus_tag="ECL_00295"
                     /codon_start=1
                     /transl_table=11
                     /product="chorismate pyruvate lyase"
                     /protein_id="YP_003610811.1"
                     /db_xref="GeneID:9122805"
                     /translation="MSHPALTQLRSLRYFDQIPALDPQQLDWLLLEDSMTKRFEQQGK
                     TVTVTMIQEGFVTSADIASELPLLPKEERYWLREILLCADGEPWLAGRTVVPESTLSG
                     PELALQRLGNTPLGRYLFTSSELTRDFIEIGRDAELWGRRSRLRLSGKPLILTELFLP
                     ASPLY"
     misc_feature    306640..307134
                     /locus_tag="ECL_00295"
                     /note="chorismate pyruvate lyase; Provisional; Region:
                     ubiC; PRK11655"
                     /db_xref="CDD:236949"
     gene            307151..308020
                     /locus_tag="ECL_00296"
                     /db_xref="GeneID:9122806"
     CDS             307151..308020
                     /locus_tag="ECL_00296"
                     /codon_start=1
                     /transl_table=11
                     /product="4-hydroxybenzoate octaprenyltransferase"
                     /protein_id="YP_003610812.1"
                     /db_xref="GeneID:9122806"
                     /translation="MEWSLTQNKLLAYHRLMRTDKPIGALLLLWPTLWALWVATPGVP
                     PLWILGVFVAGVWLMRAAGCVVNDYADRKFDGHVKRTANRPLPSGQVTEKEARVLFIV
                     LVLLSFLLVLTLNTMTILLSVAALALAWVYPFMKRYTHLPQVVLGAAFGWSIPMAFAA
                     VSESVPLSCWLMFLANILWAVAYDTQYAMVDRDDDLKIGIKSTAILFGRHDKLIIGIL
                     QVAVLALMVAIGRLNGLNWEFYWSVLVAGLLFAYQQKLIAKRERDACFKAFMNNNYVG
                     LVLFLGLAMSYFG"
     misc_feature    307166..308011
                     /locus_tag="ECL_00296"
                     /note="4-hydroxybenzoate octaprenyltransferase; Reviewed;
                     Region: ubiA; PRK12848"
                     /db_xref="CDD:237229"
     misc_feature    order(307361..307363,307373..307375,307721..307723,
                     307733..307735)
                     /locus_tag="ECL_00296"
                     /note="putative active site [active]"
                     /db_xref="CDD:260122"
     gene            complement(308119..310539)
                     /locus_tag="ECL_00298"
                     /db_xref="GeneID:9122807"
     CDS             complement(308119..310539)
                     /locus_tag="ECL_00298"
                     /codon_start=1
                     /transl_table=11
                     /product="glycerol-3-phosphate acyltransferase"
                     /protein_id="YP_003610813.1"
                     /db_xref="GeneID:9122807"
                     /translation="MSGWPRIYYKLLNLPLSVLVKSKSIPAEPALELGLDTSRPIMYV
                     LPYNSKADLLTLRAQCLAHDLPDPLEPLEVDGTLLPRYVFIHGGPRVFTYYTPKEESI
                     KLFHDYLDLHRSNPDLDVQMVPVSVMFGRRPGREKGEENPPLRMLNGIQKFFAVSWLG
                     RDSFVRFSPSVSLRRMADEHGTDKIIAQKLARVARMHFARQRLAAVGPRLPARQDLFN
                     KLLASKAIARAVEDEARSKKISHEKAQQNAIALMEEIAANFSYEMIRLSDRILGFTWN
                     RLYQGINVHNAERVRQLAHDGHEIVYVPCHRSHMDYLLLSYVLYHQGLVPPHIAAGIN
                     LNFWPAGPIFRRLGAFFIRRTFKGNKLYSTVFREYLGELFSRGYSVEYFVEGGRSRTG
                     RLLDPKTGTLSMTIQAMLRGGTRPITLVPIYIGYEHVMEVGTYAKELRGATKEKESLP
                     QMLRGLSKLRNLGQGYVNFGEPMPLMTYLNNHVPDWRESIDPIEAVRPAWLTPTVNGI
                     AAELMVRINNAGAANAMNLCCTALLASRQRSLTREQLTEQLDCYLDLMRNVPYSVDST
                     TPASTASELIDHALQMNKFEVEKDTIGDIIILPREQAVLMTYYRNNIAHMLMLPSLMA
                     AIITQHRRISRQELLRHVETLYPMLKAELFLRWSKDELAIELDKMTEELRRQGLITVV
                     NDELHINPSRSRTLQLLAAGARETLQRYAITFWLLSANPSINRGTLEKESRTLAQRLS
                     VLHGINAPEFFDKAVFSSLVLTLRDEGFISDTGDAEPEETLKVYQMLAELITSDVRLT
                     IESATQGE"
     misc_feature    complement(308122..310539)
                     /locus_tag="ECL_00298"
                     /note="glycerol-3-phosphate acyltransferase; Validated;
                     Region: PRK04974"
                     /db_xref="CDD:235325"
     misc_feature    complement(order(309376..309384,309535..309546,
                     309607..309609,309613..309615,309622..309624))
                     /locus_tag="ECL_00298"
                     /note="putative acyl-acceptor binding pocket; other site"
                     /db_xref="CDD:153255"
     gene            310694..311062
                     /locus_tag="ECL_00299"
                     /db_xref="GeneID:9122808"
     CDS             310694..311062
                     /locus_tag="ECL_00299"
                     /codon_start=1
                     /transl_table=11
                     /product="diacylglycerol kinase"
                     /protein_id="YP_003610814.1"
                     /db_xref="GeneID:9122808"
                     /translation="MANNTTGLTRIIKAAGYSWKGFRAAWVNEAAFRQEGVAAIVAVI
                     IACFLDVDAITRVLLIGSVLLVMIVEILNSAIEAVVDRIGSDFHELSGRAKDMGSAAV
                     LLAIITAVITWVTLLWSHFR"
     misc_feature    310718..311044
                     /locus_tag="ECL_00299"
                     /note="Integral membrane diacylglycerol kinase; Region:
                     DAGK_IM; cd14264"
                     /db_xref="CDD:260133"
     misc_feature    order(310718..310720,310733..310735,310745..310747,
                     310754..310756,310781..310783,310790..310792,
                     310796..310798,310901..310903,310910..310915,
                     310922..310924,310934..310939,310973..310981,
                     310985..310990,310994..310996)
                     /locus_tag="ECL_00299"
                     /note="putative active site [active]"
                     /db_xref="CDD:260133"
     misc_feature    order(310739..310759,310763..310768,310850..310858,
                     310862..310867,310874..310876,310883..310885,
                     310895..310900,310904..310909,310913..310921,
                     310925..310933,310937..310942,310955..310957,
                     310961..310966,310973..310975,310982..310984,
                     310991..310996,311003..311008,311015..311017,
                     311027..311029,311036..311041)
                     /locus_tag="ECL_00299"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:260133"
     misc_feature    order(310751..310753,310778..310780,310901..310903,
                     310922..310924,310934..310936,310976..310981)
                     /locus_tag="ECL_00299"
                     /note="putative active site [active]"
                     /db_xref="CDD:260133"
     misc_feature    order(310778..310780,310922..310924)
                     /locus_tag="ECL_00299"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:260133"
     gene            311171..311779
                     /locus_tag="ECL_00300"
                     /db_xref="GeneID:9122809"
     CDS             311171..311779
                     /locus_tag="ECL_00300"
                     /codon_start=1
                     /transl_table=11
                     /product="LexA repressor"
                     /protein_id="YP_003610815.1"
                     /db_xref="GeneID:9122809"
                     /translation="MKALTTRQQEVFDLIRDHIGQTGMPPTRAEIAQRLGFRSPNAAE
                     EHLKALARKGVIEIVSGASRGIRLLVEEETGIPLVGRVAAGEPLLAQQHIEGHYQVDP
                     GMFKPSADFLLRVSGMSMKDIGILDGDLLAVHKTQDVRNGQVVVARIDDEVTVKRLKK
                     QGNTVQLLPENNEFSPIVVDLREQNFSIEGLAVGVIRNGEWL"
     misc_feature    311177..311767
                     /locus_tag="ECL_00300"
                     /note="LexA repressor; Validated; Region: PRK00215"
                     /db_xref="CDD:234688"
     gene            complement(311795..311908)
                     /locus_tag="ECL_00301"
                     /db_xref="GeneID:9122810"
     CDS             complement(311795..311908)
                     /locus_tag="ECL_00301"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610816.1"
                     /db_xref="GeneID:9122810"
                     /translation="MEKIIGSARRHNALSDAVSSDMKKYREWIKNQATADP"
     gene            311895..313181
                     /locus_tag="ECL_00302"
                     /db_xref="GeneID:9122811"
     CDS             311895..313181
                     /locus_tag="ECL_00302"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-damage-inducible SOS response protein"
                     /protein_id="YP_003610817.1"
                     /db_xref="GeneID:9122811"
                     /translation="MIFSNITVPLLGLVDTAVIGHLDSPIYLGGVAIGATATSFLFML
                     LLFLRMSTTGLTAQAYGAKDPLRLARALVQPLILALGAGALIAILRTPLIDLALHVVG
                     GSEAVLEQARRFLEIRWLSAPASLANLVLLGWLLGVQYARAPVILLVVGNLLNIVLDL
                     WLVMGLHMNVQGAALATAIAEYGTFILGLWMVWRVLVMRGISLALLKSAWRGNIRTLL
                     ALNRDIMLRSLLLQLCFGALTVFGARLGPDIVAVNAVLMTLLTFTAYALDGFAYAVEA
                     HSGQAYGARESGQLRDVWRAACRQSGLVALTFALIYACFGEQIIALLTSLPALRELAS
                     HYLIWQVILPVVGVWCYLLDGMFIGATRGAEMRNSMAVAAAGFALTLLTLPWLGNHGL
                     WLSLAVFLALRGLSLGFIWHRHWQNNTWLPSRNDIS"
     misc_feature    311895..313166
                     /locus_tag="ECL_00302"
                     /note="DNA-damage-inducible SOS response protein;
                     Provisional; Region: PRK10367"
                     /db_xref="CDD:182413"
     misc_feature    311895..313133
                     /locus_tag="ECL_00302"
                     /note="DinF and similar proteins, a subfamily of the
                     multidrug and toxic compound extrusion (MATE)-like
                     proteins; Region: MATE_DinF_like; cd13136"
                     /db_xref="CDD:240541"
     gene            313299..313511
                     /locus_tag="ECL_00303"
                     /db_xref="GeneID:9122812"
     CDS             313299..313511
                     /locus_tag="ECL_00303"
                     /codon_start=1
                     /transl_table=11
                     /product="putative stress-response protein"
                     /protein_id="YP_003610818.1"
                     /db_xref="GeneID:9122812"
                     /translation="MMNKDEIGGNWKQFKGKAKEQWGKLTDDDMTVIEGKRDQLVGKI
                     QERYGYEKDQAEKEVGDWEKRNDYRW"
     misc_feature    313302..313508
                     /locus_tag="ECL_00303"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10428"
                     /db_xref="CDD:182452"
     gene            complement(313581..314093)
                     /locus_tag="ECL_00304"
                     /db_xref="GeneID:9122813"
     CDS             complement(313581..314093)
                     /locus_tag="ECL_00304"
                     /codon_start=1
                     /transl_table=11
                     /product="zinc uptake transcriptional repressor"
                     /protein_id="YP_003610819.1"
                     /db_xref="GeneID:9122813"
                     /translation="MDKSTKELLAQAEKLCAQRNVRLTPQRLEVLRLMTLQQGAISAY
                     DLLDLLRESEPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFIC
                     DRCGVVKEEGAEGVEDIMHTLAARMGFALRHNVIEAHGLCSACVEVEACRHQDACHHD
                     HSILVKKKPR"
     misc_feature    complement(313590..314093)
                     /locus_tag="ECL_00304"
                     /note="zinc uptake transcriptional repressor; Provisional;
                     Region: PRK11639"
                     /db_xref="CDD:183251"
     misc_feature    complement(order(313764..313766,313797..313799,
                     313809..313811,313830..313832,313974..313976))
                     /locus_tag="ECL_00304"
                     /note="metal binding site 2 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(313878..313922)
                     /locus_tag="ECL_00304"
                     /note="putative DNA binding helix; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(313692..313694,313743..313745,
                     313800..313802,313812..313814))
                     /locus_tag="ECL_00304"
                     /note="metal binding site 1 [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(313671..313697,313701..313709,
                     313734..313739,313785..313793))
                     /locus_tag="ECL_00304"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133478"
     misc_feature    complement(order(313668..313670,313779..313781,
                     313788..313790))
                     /locus_tag="ECL_00304"
                     /note="structural Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:133478"
     gene            314206..314697
                     /locus_tag="ECL_00305"
                     /db_xref="GeneID:9122814"
     CDS             314206..314697
                     /locus_tag="ECL_00305"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610820.1"
                     /db_xref="GeneID:9122814"
                     /translation="MMKKPDCIRHWRDVEEPDNSTYPDSNELFSIGAPLARHLGLRRI
                     GIHHERLPPGRRTSYPHAESDEEEFIYVLEGYPEAWINGYLWKLEPGDSVGFPAGTGV
                     CHTFINNTEEEVRLLVVGEANKKHNRIYYPLNPEYAATREDRWVDHPPQFFGPHDGKP
                     GKK"
     misc_feature    314224..314694
                     /locus_tag="ECL_00305"
                     /note="Conserved domain found in cupin and related
                     proteins; Region: cupin_like; cl21464"
                     /db_xref="CDD:328732"
     gene            314867..316177
                     /locus_tag="ECL_00306"
                     /db_xref="GeneID:9122815"
     CDS             314867..316177
                     /locus_tag="ECL_00306"
                     /codon_start=1
                     /transl_table=11
                     /product="conjugative transfer protein"
                     /protein_id="YP_003610821.1"
                     /db_xref="GeneID:9122815"
                     /translation="MKKHFKFSVVSIAVSLFMANQAGAANTWTESRSDAMGGTGVASG
                     SYGSGALINPALLAKAKPDDDVTVILPSVGVQVTDEDNLQDEIDTINDKINHYKDVVD
                     SLTPIEVITNPLGSIDQFQGAAKDLADELDYLKGKTARATAGAGIAVSIPNDVLSVAF
                     MAKGYAHGRVSSSIDQQDIDYLRSIQNSDAVAAGVALDAALNGTDQITKNLNSTASGR
                     AAIVSDYGVAIARQFDLGGVPVSLGVTPKLQKTWIYNYTTSIYDYDSNKWNDSRYRKD
                     DTGFNVDAGIAADFGENWTVGVSGQNLMSRDIDTKDIRIRNGRTGEVVSYKDTYQIRP
                     LVTAGAAWHNDLVTLTADGDLTETKGFKSEDTSQYVGVGAEVTPLSWLAVRAGYRADM
                     KGNDSNVFTGGVGFAPFNTVHVDLMGLYGEDETWGAGAQLSMTF"
     misc_feature    315020..315928
                     /locus_tag="ECL_00306"
                     /note="F plasmid transfer operon, TraF, protein; Region:
                     TraF_2; pfam13729"
                     /db_xref="CDD:316268"
     gene            316260..317255
                     /locus_tag="ECL_00307"
                     /db_xref="GeneID:9122816"
     CDS             316260..317255
                     /locus_tag="ECL_00307"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA-dihydrouridine synthase A"
                     /protein_id="YP_003610822.1"
                     /db_xref="GeneID:9122816"
                     /translation="MSSEHQTAFPAHRFSIAPMLDWTDRHCRYFLRQLSRHTLLYTEM
                     VTTGAIIHGKGDYLAYSEEEHPVALQLGGSDPAALAHCAKLAEERGYDEINLNVGCPS
                     DRVQNGMFGACLMGNAQLVADCIKAMRDVVSIPVTVKTRIGIDDQDSYEFLCDFINTV
                     AGKGECEMFIIHARKAWLSGLSPKENREIPPLDYPRVYQLKRDFPHLTMSINGGIKSL
                     DEAKTHLAHMDGVMVGREAYQNPGILTTVDREIFGVEGADTDPVAVVRAMYPYIEREL
                     SNGTYLGHITRHMLGLFQGIPGARQWRRYLSENAHKAGADIEVLEQALRLVADKR"
     misc_feature    316263..317249
                     /locus_tag="ECL_00307"
                     /note="tRNA-dihydrouridine synthase A; Provisional;
                     Region: PRK11815"
                     /db_xref="CDD:236991"
     gene            317392..317634
                     /locus_tag="ECL_00308"
                     /db_xref="GeneID:9122817"
     CDS             317392..317634
                     /locus_tag="ECL_00308"
                     /codon_start=1
                     /transl_table=11
                     /product="phage shock protein G"
                     /protein_id="YP_003610823.1"
                     /db_xref="GeneID:9122817"
                     /translation="MLELLFVIGFFVMLLATGVSLLGILAALVVATVVMFIGGLFALT
                     IKLLPWLLLAVAVVWVIRAIKSPKLPTYQRNNRFRY"
     misc_feature    317392..317619
                     /locus_tag="ECL_00308"
                     /note="phage shock protein G; Reviewed; Region: pspG;
                     PRK09459"
                     /db_xref="CDD:181875"
     gene            complement(317819..318802)
                     /locus_tag="ECL_00309"
                     /db_xref="GeneID:9122818"
     CDS             complement(317819..318802)
                     /locus_tag="ECL_00309"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="YP_003610824.1"
                     /db_xref="GeneID:9122818"
                     /translation="MATRIEFHKHGGPDVLNAVEFTPAAPGENEVQVENKAIGINYID
                     TYIRGGLYPPPSLPSGLGTEAAGVVSKVGSAVKHVKEGDRVVYAQSALGAYSSVHNVP
                     ADKVALLPNAISFEQAAASFLKGLTVYYLLRKTYEIKPDEQFLFHAAAGGVGLIACQW
                     AKALGAKLIGTVGSAQKAQRALQAGAWQVINYREESIVERLKEVTGGKKVRVVYDSVG
                     KDTWEASLDCLQRRGLMVSFGNASGAVTGVNLGILNQKGSLYVTRPSLQGYITNREEL
                     LEASNELFSLIASGVIKVDVADAQKYALSDAQRAHEVLESRSTQGSSLLIP"
     misc_feature    complement(317822..318802)
                     /locus_tag="ECL_00309"
                     /note="quinone oxidoreductase, NADPH-dependent;
                     Provisional; Region: PRK10754"
                     /db_xref="CDD:182701"
     gene            318863..320275
                     /locus_tag="ECL_00310"
                     /db_xref="GeneID:9122819"
     CDS             318863..320275
                     /locus_tag="ECL_00310"
                     /codon_start=1
                     /transl_table=11
                     /product="replicative DNA helicase"
                     /protein_id="YP_003610825.1"
                     /db_xref="GeneID:9122819"
                     /translation="MAGNKPFNKQTEPRERDFQVAGLKVPPHSIEAEQSVLGGLMLDN
                     ERWDDVAERVVSDDFYTRPHRHIFTEMARLQESGSPIDLITLAESLERQGQLDSVGGF
                     AYLAELSKNTPSAANISAYADIVRERAVVREMISVANEIAEAGFDPQGRTSEDLLDLA
                     ESRVFKIAESRANKDEGPKNIADVLDATVARIEQLFQQPHDGVTGVNTGYDDLNKKTA
                     GLQPSDLIIVAARPSMGKTTFAMNLVENAAMLQDKPVLIFSLEMPSEQIMMRSLASLS
                     RVDQTRIRTGQLDDEDWARISGTMGILLEKRNIYIDDSSGLTPTEVRSRARRIAREHG
                     GIGLIMIDYLQLMRVPSLSDNRTLEIAEISRSLKALAKELHVPVVALSQLNRSLEQRA
                     DKRPVNSDLRESGSIEQDADLIMFIYRDEVYHENSDLKGIAEIIIGKQRNGPIGTVRL
                     TFNGQWSRFDNYAGPQYDDE"
     misc_feature    318863..320272
                     /locus_tag="ECL_00310"
                     /note="replicative DNA helicase; Provisional; Region:
                     PRK08006"
                     /db_xref="CDD:181193"
     gene            320292..321371
                     /locus_tag="ECL_00311"
                     /db_xref="GeneID:9122820"
     CDS             320292..321371
                     /locus_tag="ECL_00311"
                     /codon_start=1
                     /transl_table=11
                     /product="alanine racemase"
                     /protein_id="YP_003610826.1"
                     /db_xref="GeneID:9122820"
                     /translation="MQAATVVINRRALRHNLQRLRELAPASKLVAVVKANAYGHGLLE
                     TARTLPDADAFGVARLEEALRLRAGGITQPILLLEGFFEAADLPTIADQHLHTAVHNE
                     EQLSALETAELSEPVTVWMKLDTGMHRLGVRPEHAQAFYQRLCQCKNVRQPVNIVSHF
                     ARADEPDCGATEQQLDIFNTFCEGKPGMRSIAASGGILLWPQSHFDWARPGIILYGVS
                     PLENRPWGPDFGFQPVMSLVSKLIAVREHKAGEPVGYGGTWTSARDTRLGVVAMGYGD
                     GYPRAAPSGTPVLVNGREVKIVGRVAMDMICVDLGPDAQDKAGDDVVMWGDGLPVERI
                     AEITKVSAYELITRLTSRVAMKYID"
     misc_feature    320298..321365
                     /locus_tag="ECL_00311"
                     /note="Type III Pyridoxal 5-phosphate (PLP)-Dependent
                     Enzymes, Proteobacterial Alanine Racemases; Region:
                     PLPDE_III_AR_proteobact; cd06827"
                     /db_xref="CDD:143500"
     misc_feature    order(320385..320387,320391..320393,320403..320405,
                     320523..320525,320655..320657,320676..320678,
                     320760..320762,320766..320768,320868..320876,
                     320916..320927,321318..321320)
                     /locus_tag="ECL_00311"
                     /note="active site"
                     /db_xref="CDD:143500"
     misc_feature    order(320385..320387,320391..320393,320403..320405,
                     320523..320525,320766..320768,320868..320873,
                     320916..320918,320922..320927,321318..321320)
                     /locus_tag="ECL_00311"
                     /note="pyridoxal 5'-phosphate (PLP) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:143500"
     misc_feature    order(320391..320393,320403..320405,320676..320678,
                     320766..320768,321318..321320)
                     /locus_tag="ECL_00311"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143500"
     misc_feature    order(320391..320393,321054..321056)
                     /locus_tag="ECL_00311"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143500"
     misc_feature    order(321015..321017,321024..321026,321042..321047,
                     321051..321059,321096..321098,321111..321113,
                     321129..321131,321195..321197,321201..321203,
                     321312..321314,321318..321323,321336..321338,
                     321345..321347)
                     /locus_tag="ECL_00311"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143500"
     gene            321498..322691
                     /locus_tag="ECL_00312"
                     /db_xref="GeneID:9122821"
     CDS             321498..322691
                     /locus_tag="ECL_00312"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid aminotransferase"
                     /protein_id="YP_003610827.1"
                     /db_xref="GeneID:9122821"
                     /translation="MFQKVDAYAGDPILSLMERFKEDPRSDKVNLSIGLYYNEDGIIP
                     QLKAVAEAEARLNAAPHGASLYLPMEGLNTYRNAIAPLLFGADHAVLAQKRVATIQTL
                     GGSGALKVGADFLKKYFPDSGVWVSDPTWENHVAIFEGAGFKVATYPWFDSETNGVRV
                     DALLEKLNTLPERSIVLLHPCCHNPTGADLTNTQWDAVIEVLKARNLIPFLDIAYQGF
                     GAGMEEDAYAIRAVASAGLPVLVSNSFSKIFSLYGERVGGLSVVCEDAEAAGRVLGQL
                     KATVRRIYSSPPNFGAQVVATVLGDEQLKASWLAEVVSMRKRILSMRQELVNVLKEAV
                     PGHNFDYLLKQRGMFSYTGLSAAQVERLREEFGVYLIASGRMCVAGLNASNVHRVAQA
                     FAAVM"
     misc_feature    321498..322688
                     /locus_tag="ECL_00312"
                     /note="aromatic amino acid aminotransferase; Provisional;
                     Region: PRK09257"
                     /db_xref="CDD:181731"
     misc_feature    order(321804..321812,321888..321890,322047..322049,
                     322140..322142,322227..322229,322233..322238,
                     322260..322262)
                     /locus_tag="ECL_00312"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    order(321813..321815,321918..321920,322119..322121,
                     322254..322262,322368..322370,322377..322379)
                     /locus_tag="ECL_00312"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    322236..322238
                     /locus_tag="ECL_00312"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            322909..323622
                     /locus_tag="ECL_00313"
                     /db_xref="GeneID:9122822"
     CDS             322909..323622
                     /locus_tag="ECL_00313"
                     /codon_start=1
                     /transl_table=11
                     /product="acid phosphatase/phosphotransferase"
                     /protein_id="YP_003610828.1"
                     /db_xref="GeneID:9122822"
                     /translation="MRKITLALSAACLLFSLNSTVVARASAPTPLYTGTTAAILAEQA
                     PIHWVSVAQIENSLMGRPPMAVGFDIDDTVLFSSPGFWRGKKTYSPDSEAYLKNPEFW
                     EKMNNGWDEFSIPKEVARALIAMHVKRGDSIYFVTGRSQTKTETVSKTLQDDFLIPAA
                     SMNPVIFAGDKPGQNTKTQWLEQKHIKVFYGDSDNDISAARDVGARGIRVLRASNSTY
                     RPLPMAGKFGEEVIVNSEY"
     misc_feature    322909..323619
                     /locus_tag="ECL_00313"
                     /note="acid phosphatase/phosphotransferase; Provisional;
                     Region: aphA; PRK11009"
                     /db_xref="CDD:236818"
     misc_feature    order(323062..323067,323074..323076,323134..323136,
                     323140..323145,323152..323157,323164..323166,
                     323233..323235,323239..323253,323368..323370,
                     323542..323553,323569..323586,323605..323610,
                     323614..323619)
                     /locus_tag="ECL_00313"
                     /note="oligomer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:319802"
     misc_feature    order(323113..323127,323149..323151,323191..323196,
                     323212..323214,323317..323325,323416..323418,
                     323437..323439,323479..323484,323491..323496,
                     323557..323562)
                     /locus_tag="ECL_00313"
                     /note="active site"
                     /db_xref="CDD:319802"
     misc_feature    323113..323127
                     /locus_tag="ECL_00313"
                     /note="HAD signature motif I; other site"
                     /db_xref="CDD:319802"
     misc_feature    323317..323319
                     /locus_tag="ECL_00313"
                     /note="HAD signature motif II; other site"
                     /db_xref="CDD:319802"
     misc_feature    323437..323439
                     /locus_tag="ECL_00313"
                     /note="HAD signature motif III; other site"
                     /db_xref="CDD:319802"
     misc_feature    order(323479..323484,323494..323496)
                     /locus_tag="ECL_00313"
                     /note="HAD signature motif IV; other site"
                     /db_xref="CDD:319802"
     gene            323735..324151
                     /locus_tag="ECL_00314"
                     /db_xref="GeneID:9122823"
     CDS             323735..324151
                     /locus_tag="ECL_00314"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610829.1"
                     /db_xref="GeneID:9122823"
                     /translation="MWYQQTLTLSAKPRGFHLVTDEVIGQIRDLSRVKTGLLHLLLQH
                     TSASLTLNENCDPTVRSDMERHFLKTVPDNASYEHDYEGADDMPSHIKSSLLGVSLML
                     PVHNGRLLLGTWQGIWLGEHRIHGGSRKIIATLQGE"
     misc_feature    323735..324145
                     /locus_tag="ECL_00314"
                     /note="Thiamin phosphate synthase YjbQ, UPF0047 family
                     [Coenzyme transport and metabolism]; Region: YjbQ;
                     COG0432"
                     /db_xref="CDD:223509"
     gene            324154..324507
                     /locus_tag="ECL_00315"
                     /db_xref="GeneID:9122824"
     CDS             324154..324507
                     /locus_tag="ECL_00315"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610830.1"
                     /db_xref="GeneID:9122824"
                     /translation="MTISELLQYCMSKPGAEQSVHSDWKATQIKVGDVLFAMVKEVEG
                     RPAASLKTSPELAELLRQQHDDVRPSKHLNKAHWSTVYLDGSLPGSQIYYLVDASYQQ
                     AVELLPEATRQQLSV"
     misc_feature    324154..324504
                     /locus_tag="ECL_00315"
                     /note="Predicted DNA-binding protein with double-wing
                     structural motif, MmcQ/YjbR family [Transcription];
                     Region: MmcQ; COG2315"
                     /db_xref="CDD:225197"
     gene            complement(324511..327333)
                     /locus_tag="ECL_00316"
                     /db_xref="GeneID:9122825"
     CDS             complement(324511..327333)
                     /locus_tag="ECL_00316"
                     /codon_start=1
                     /transl_table=11
                     /product="excision nuclease subunit A"
                     /protein_id="YP_003610831.1"
                     /db_xref="GeneID:9122825"
                     /translation="MDKIEVRGARTHNLKNINLIIPRDKLIVVTGLSGSGKSSLAFDT
                     LYAEGQRRYVESLSAYARQFLSLMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTIT
                     EIHDYLRLLYARVGEPRCPDHDVPLAAQTVSQMVDNVLSQPEGKRLMLLAPIIKERKG
                     EHTKTLENLASQGYIRARIDGEVCDLSDPPKLELQKKHTIEVVIDRFKVRDDLATRLA
                     ESFETALELSGGTAVVSDMDDPNAEELLFSANFACPICGYSMRELEPRLFSFNNPAGA
                     CPTCDGLGVQQYFDPDRVIQNPELSLAGGAIRGWDKRNFYYFQMLKSLAEHYKFDVEA
                     PWASLSPNVHKVILFGSGKENIEFKYMNDRGDTSVRRHPFEGVLHNMERRYKETESSA
                     VREELAKFISNRSCATCEGTRLRREARHVFVENTALPTISDMSIGHAMDFFNNLKLSG
                     QRAKIAEKVLKEIGDRLKFLVNVGLNYLTLSRSAETLSGGEAQRIRLASQIGAGLVGV
                     MYVLDEPSIGLHQRDNERLLGTLIHLRNLGNTVIVVEHDEDAIRAADHVIDIGPGAGV
                     HGGQVVAEGTLKDIMAVPESLTGQYMSGKRKIEVPKQRVAANPEKVLKLTGARGNNLK
                     DVTLTLPVGLFTCITGVSGSGKSTLINDTLFPIAQTALNGATLAEPAPYRDIQGLEHF
                     DKVIDIDQSPIGRTPRSNPATYTGVFTPVRELFAGVPEARSRGYTPGRFSFNVRGGRC
                     EACQGDGVIKVEMHFLPDIYVPCDQCKGKRYNRETLEIKYKGKTIHEVLDMTIEEARE
                     FFDAVPALARKLQTLMDVGLTYIRLGQSATTLSGGEAQRVKLARELSKRGTGQTLYIL
                     DEPTTGLHFADIQQLLDVLHQLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGE
                     ILVSGTPETVAECEASHTARFLKPLL"
     misc_feature    complement(324514..327333)
                     /locus_tag="ECL_00316"
                     /note="excinuclease ABC subunit A; Reviewed; Region: uvrA;
                     PRK00349"
                     /db_xref="CDD:234734"
     gene            327585..328109
                     /gene="ssb"
                     /locus_tag="ECL_00317"
                     /db_xref="GeneID:9122826"
     CDS             327585..328109
                     /gene="ssb"
                     /locus_tag="ECL_00317"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand DNA-binding protein Ssb"
                     /protein_id="YP_003610832.1"
                     /db_xref="GeneID:9122826"
                     /translation="MASRGVNKVILVGNLGQDPEVRYMPSGGAVANITLATSESWRDK
                     ATGEMKEQTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDQSGQEKYTTEV
                     VVNVGGTMQMLGGRQGGGAPAGGGQQQGGWGQPQQPQGGNQFSGGAQSRPQQQSAPAP
                     SNEPPMDFDDDIPF"
     misc_feature    327585..328106
                     /gene="ssb"
                     /locus_tag="ECL_00317"
                     /note="single-stranded DNA-binding protein; Provisional;
                     Region: PRK09010"
                     /db_xref="CDD:236362"
     misc_feature    order(327609..327620,327693..327701,327744..327746,
                     327750..327752,327813..327815,327840..327842,
                     327873..327875,327882..327884)
                     /gene="ssb"
                     /locus_tag="ECL_00317"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(327624..327632,327648..327650,327678..327680,
                     327699..327704,327738..327743,327747..327749,
                     327753..327755,327759..327761,327765..327767,
                     327804..327809,327831..327833,327837..327839,
                     327843..327848,327885..327887,327891..327893)
                     /gene="ssb"
                     /locus_tag="ECL_00317"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     gene            complement(328172..328453)
                     /locus_tag="ECL_00318"
                     /db_xref="GeneID:9122827"
     CDS             complement(328172..328453)
                     /locus_tag="ECL_00318"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_003610833.1"
                     /db_xref="GeneID:9122827"
                     /translation="MATITTSMVLLRWPLLSAVLMFLASTLNIQFRKSDYAGLAVIST
                     LLGLGAACWFATGLLGITLLDIAAVWENIKVVMVEAMSHTPPDWPMVIT"
     misc_feature    complement(328190..328453)
                     /locus_tag="ECL_00318"
                     /note="Family of unknown function; Region: YjcB;
                     pfam15940"
                     /db_xref="CDD:318208"
     gene            329137..330678
                     /locus_tag="ECL_00319"
                     /db_xref="GeneID:9122828"
     CDS             329137..330678
                     /locus_tag="ECL_00319"
                     /codon_start=1
                     /transl_table=11
                     /product="EAL domain-containing protein"
                     /protein_id="YP_003610834.1"
                     /db_xref="GeneID:9122828"
                     /translation="MLRVVGIIMVVMLPVMLALWFAQLRAVSETSAQLRTFAELALDK
                     TELVIEQVDLARAEAEKYQGKVCTPSHRQYMLNVVRGRLFIADLIYAEGQNFRCSSIF
                     TPDRPYAISPANYIRKPDIAIYYYRDTPFFTGYKMTYMQRGNYVVVVNPLSYSEVMST
                     DHSLSWGVYDTVTNAFFSVSQKANVSLLNSMIRDKDVVFQKDDRFYTVVKSDKRPIAA
                     IVSTSNKRFYETLYHQATLTLPLGMICSIIILLVWSRTHRELNSPGRLLHRALNKRQL
                     CVHYQPIIDIKNNQCVGAEALLRWPGFNGPVMSPAEFIPLAEKEGMSERITDYVVEEV
                     FSDLGHFLAAHPDLYISINLSATDFHSSRLIAMISDKARHYAVRAQQIKIEVTERGFI
                     DVPKTTPVIQAFRQAGYEVAIDDFGTGYSNLHNLYSLNVDILKIDKSFIDTLTTNSTS
                     HLIAEHIIEMAQSLRLKTIAEGVETAEQVSWLLKRGVQFCQGWHFAKAMPPQEFMTWQ
                     QQPLH"
     misc_feature    329137..330669
                     /locus_tag="ECL_00319"
                     /note="Environmental sensor c-di-GMP phosphodiesterase,
                     contains periplasmic CSS-motif sensor and cytoplasmic EAL
                     domain [Signal transduction mechanisms]; Region: YjcC;
                     COG4943"
                     /db_xref="CDD:227279"
     gene            complement(330684..331010)
                     /locus_tag="ECL_00320"
                     /db_xref="GeneID:9122829"
     CDS             complement(330684..331010)
                     /locus_tag="ECL_00320"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding transcriptional regulator SoxS"
                     /protein_id="YP_003610835.1"
                     /db_xref="GeneID:9122829"
                     /translation="MSHQQIIQTLIEWIDEHIDQPLNIDVVAKKSGYSKWYLQRMFRT
                     VMHQTLGEYIRQRRLLLAAQALRSTQRPIFDIAMDLGYVSQQTFSRVFRREFDRTPSD
                     YRHQLN"
     misc_feature    complement(330690..331010)
                     /locus_tag="ECL_00320"
                     /note="DNA-binding transcriptional regulator SoxS;
                     Provisional; Region: PRK10219"
                     /db_xref="CDD:182314"
     gene            331108..331566
                     /locus_tag="ECL_00321"
                     /db_xref="GeneID:9122830"
     CDS             331108..331566
                     /locus_tag="ECL_00321"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610836.1"
                     /db_xref="GeneID:9122830"
                     /translation="MEKRLPRIKALLTPGEVAKRSGVAVSALHFYESKGLIKSIRNAG
                     NQRRYTRDVLRYVAIIKIAQRIGIPLATIGEAFGVLPEGHTLSPKEWKELSSQWREEL
                     DRRIHTLVALRDELDGCIGCGCLSRSDCPLRNPGDKLGEQGTGARLLEED"
     misc_feature    331108..331563
                     /locus_tag="ECL_00321"
                     /note="redox-sensitivie transcriptional activator SoxR;
                     Provisional; Region: PRK15002"
                     /db_xref="CDD:184964"
     gene            331879..332550
                     /locus_tag="ECL_00322"
                     /db_xref="GeneID:9122831"
     CDS             331879..332550
                     /locus_tag="ECL_00322"
                     /codon_start=1
                     /transl_table=11
                     /product="glutathione S-transferase"
                     /protein_id="YP_003610837.1"
                     /db_xref="GeneID:9122831"
                     /translation="MLTVHHLNQSRSHRVIWALEELSLPYEIVHYQREKTMLAPESLK
                     RVHPLGKSPVIEDNGLILAESGAILEYLQETYDAESQLKPLDPAHKVQYRFWLHYAEG
                     SLMPLLLMKLVFSSLGKPPVPFGIRTLGKALGQGVQKAYLNPQLETHARFIESHLAEN
                     SWFAGETLSMADIQMSFPIFALLARGGVEDLPHTHAWKKKVENRPAWQRTLEQGGPLT
                     IPGEA"
     misc_feature    331882..332109
                     /locus_tag="ECL_00322"
                     /note="GST_N family, Saccharomyces cerevisiae GTT1-like
                     subfamily; composed of predominantly uncharacterized
                     proteins with similarity to the S. cerevisiae GST protein,
                     GTT1, and the Schizosaccharomyces pombe GST-III. GSTs are
                     cytosolic dimeric proteins involved...; Region:
                     GST_N_GTT1_like; cd03046"
                     /db_xref="CDD:239344"
     misc_feature    order(331909..331911,331915..331920,331924..331929,
                     331936..331941,332074..332076,332083..332088)
                     /locus_tag="ECL_00322"
                     /note="putative C-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(331909..331911,332029..332037,332068..332073)
                     /locus_tag="ECL_00322"
                     /note="putative GSH binding site (G-site) [chemical
                     binding]; other site"
                     /db_xref="CDD:239344"
     misc_feature    order(332029..332031,332065..332070,332074..332079,
                     332086..332088)
                     /locus_tag="ECL_00322"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:239344"
     misc_feature    332125..332493
                     /locus_tag="ECL_00322"
                     /note="C-terminal, alpha helical domain of GTT1-like
                     Glutathione S-transferases; Region: GST_C_GTT1_like;
                     cd03189"
                     /db_xref="CDD:198298"
     misc_feature    order(332158..332160,332179..332181,332386..332388,
                     332395..332400,332407..332409,332419..332421)
                     /locus_tag="ECL_00322"
                     /note="putative N-terminal domain interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:198298"
     misc_feature    order(332158..332163,332170..332175,332182..332184,
                     332332..332334)
                     /locus_tag="ECL_00322"
                     /note="putative dimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:198298"
     misc_feature    order(332179..332181,332191..332196,332203..332208,
                     332410..332412,332419..332421)
                     /locus_tag="ECL_00322"
                     /note="putative substrate binding pocket (H-site)
                     [chemical binding]; other site"
                     /db_xref="CDD:198298"
     gene            332849..334198
                     /locus_tag="ECL_00323"
                     /db_xref="GeneID:9122832"
     CDS             332849..334198
                     /locus_tag="ECL_00323"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610838.1"
                     /db_xref="GeneID:9122832"
                     /translation="MSTPSARTGGSLDAIFKISARGSTVRQEIVAGLTTFLAMVYSVI
                     VVPGMLGKAGFPPAAVFVATCLVAGVGSIVMGLWANLPMAIGCAISLTAFTAFSLVLG
                     QHISVPVALGAVFLMGVLFTIISATGIRSWILRNLPHGVAHGTGIGIGLFLLLIAANG
                     VGLVIKNPLDGLPVALGHFASFPVIMSLIGLAVIIGLEKLKVPGGILLTIIGVSIVGL
                     IFDPTVHFSGIFAMPSLSDDNGNSLIGSLDIVGALNPVILPSVLALVMTAVFDATGTI
                     RAVAGQANLLDKDGQIIDGGKALTTDSLSSVFSGLVGASPAAVYIESAAGTAAGGKTG
                     LTAITVGVLFLLILFLSPLSYLVPAYATAPALMYVGLLMLSNVAKIDFADFVDAMSGL
                     ITAVFIVLTCNIVTGIMIGFASLVIGRLVSGEWRKLNIGTVVIAVALVVFYAGGWAI"
     misc_feature    332873..334189
                     /locus_tag="ECL_00323"
                     /note="Xanthine/uracil/vitamin C permease, AzgA family
                     [Nucleotide transport and metabolism]; Region: AzgA;
                     COG2252"
                     /db_xref="CDD:225161"
     gene            334349..335995
                     /locus_tag="ECL_00324"
                     /db_xref="GeneID:9122833"
     CDS             334349..335995
                     /locus_tag="ECL_00324"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610839.1"
                     /db_xref="GeneID:9122833"
                     /translation="MEIFFTILIMTLVVSLSGVVTRVLPFQVPLPLMQIAIGALLAWP
                     TFGLHVEFDPELFLVLFIPPLLFADGWKTPTREFLEHGREIFGLALALVVVTVVGIGF
                     LIYWVVPGIPLIPAFALAAVLSPTDAVALSGIVGEGRIPKKIMGILQGEALMNDASGL
                     VALKFAVAVAMGTMIFTVGGATLEFFKVAIGGILAGFVVSWLYGRSLRFLSRWGGDEP
                     ATQIVLLFLLPFASYLIAEHIGVSGILAAVAAGMTITRSGVMRRAPLAMRLRANSTWA
                     MLEFVFNGMVFLLLGLQLPGIMESSLVAAEADPNVEVWMLFTDIVLIYMALMLVRFGW
                     LWTMKNFSVRFLKKKPMEFGSWTTRELLIASFAGVRGAITLAGVLSIPLLLPTGDVFP
                     ARYELVFLAAGVILFSLFVGVIMLPILLQHIDAGDATQQHKEERIARAATAEVAIVAI
                     QKMEERLAADAEENIDNQLLTEVSSRVIGNLRRRADGRNDVESSLQEENLERRFRLAA
                     LRSERAELYHLRATRQISNETLQKLLHDLDLLEALLIENQ"
     misc_feature    334367..335986
                     /locus_tag="ECL_00324"
                     /note="Na+/H+ antiporter, bacterial form; Region: a_cpa1;
                     TIGR00831"
                     /db_xref="CDD:129911"
     gene            complement(336072..336959)
                     /locus_tag="ECL_00325"
                     /db_xref="GeneID:9122834"
     CDS             complement(336072..336959)
                     /locus_tag="ECL_00325"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003610840.1"
                     /db_xref="GeneID:9122834"
                     /translation="MDIRTLRYFVEVVRQQSFTRAAEKLFVTQPTISKMLKNLEDELN
                     CTLLIRDGRKLLLTDTGRVVFERGLAILAEFRQLEAELDDINHLTKGVLRLGIPPMVG
                     MMMAGPISLFRQRYPGVELKISEFGGLTVQQAVTNGELDVAMTALPVEEESGLATLPL
                     FSHPLCVLVPRSGDWLKRDSVKPELLGEYPLLIYNEDFALSRQLMTLFNQHSVKPRIA
                     VRSGQWDFLAAMVQAGVGIAILPQPICERLDKNTLRWIPLESDLHWQLGMIWREGIYL
                     SHSAQAWLQCCEGFWVPSP"
     misc_feature    complement(336774..336950)
                     /locus_tag="ECL_00325"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:306606"
     misc_feature    complement(336099..336686)
                     /locus_tag="ECL_00325"
                     /note="The C-terminal substrate binding domain of
                     LysR-like transcriptional regulator CidR, contains the
                     type 2 periplasmic binding fold; Region: PBP2_CidR;
                     cd08438"
                     /db_xref="CDD:176129"
     misc_feature    complement(order(336261..336266,336270..336275,
                     336291..336308,336585..336605,336609..336611,
                     336621..336623,336630..336635,336639..336644))
                     /locus_tag="ECL_00325"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176129"
     gene            337062..337469
                     /locus_tag="ECL_00326"
                     /db_xref="GeneID:9122835"
     CDS             337062..337469
                     /locus_tag="ECL_00326"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610841.1"
                     /db_xref="GeneID:9122835"
                     /translation="MAVALSRVTPAVVQRLQVPVQVLLYAGLFVFAEYLVGWLHLPLP
                     ANLVGMVLMLTLILCRVIPLSWVRAGARWLLAEMLLFFVPAVVAVVNYAQLLMVDGWR
                     IFAVIALSTLMVLGATAWVVDKVYRFEIRRQKT"
     misc_feature    337095..337457
                     /locus_tag="ECL_00326"
                     /note="Putative effector of murein hydrolase LrgA, UPF0299
                     family [General function prediction only]; Region: YohJ;
                     COG1380"
                     /db_xref="CDD:224298"
     gene            337466..338155
                     /locus_tag="ECL_00327"
                     /db_xref="GeneID:9122836"
     CDS             337466..338155
                     /locus_tag="ECL_00327"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610842.1"
                     /db_xref="GeneID:9122836"
                     /translation="MTNFQISVLCLIATLVIYFANKRLYRRFHALPLMPLVFTPILLV
                     LMLVFGHISWQNYIGESHWLLWLLGPATIAFAVPVYDNLNIIKRHWMSLSAGVITATV
                     VAVCSSVWLARLFTLPDEIQRSLAVRSVTTPFALAAAKPLGGQPDLVALFVVVTGVFG
                     MAVGDMLFLRLSIREGLAKGAGFGAASHGAGTARSYELGQQEGVVASLVMMLSGVLMV
                     LIAPLVAWVMF"
     misc_feature    337466..338152
                     /locus_tag="ECL_00327"
                     /note="Putative effector of murein hydrolase [Cell
                     wall/membrane/envelope biogenesis]; Region: LrgB; COG1346"
                     /db_xref="CDD:224265"
     gene            complement(338187..339836)
                     /locus_tag="ECL_00328"
                     /db_xref="GeneID:9122837"
     CDS             complement(338187..339836)
                     /locus_tag="ECL_00328"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610843.1"
                     /db_xref="GeneID:9122837"
                     /translation="MKRVLTALAATLPFAAHAADAITGEVQRQPTNWQAIIMFLIFVV
                     LTLYITWWASKRVRSRNDYYTAGGNITGFQNGLAIAGDFMSAASFLGISALVYTSGYD
                     GLIYSLGFLVGWPIILFLIAERLRNLGRFTFADVASYRLKQGPIRILSACGSLVVVAL
                     YLIAQMVGAGKLIELLFGLNYHVAVVLVGVLMVMYVLFGGMLATTWVQIIKAVLLLFG
                     ASFMAFMVMKHVGFSFNNLFTEAMAVHPKGEAIMSPGGLVKDPISALSLGLGLMFGTA
                     GLPHILMRFFTVSDAREARKSVFYATGFMGYFYILTFIIGFGAIMLVGANPAFKDAAG
                     ALIGGNNMAAVHLADAVGGNLFLGFISAVAFATILAVVAGLTLAGASAVSHDLYANVF
                     RKGATEREELKVSKITVLILGVVAILLGILFEKQNIAFMVGLAFSIAASCNFPIILLS
                     MYWSKLTTRGAMVGGWLGLLTAVILMILGPTIWVQILGHEKALFPYEYPALFSIAVAF
                     IGIWIFSATDNSPEGNLEREKFRAQFIRSQTGLGVEQGRAH"
     misc_feature    complement(338190..339836)
                     /locus_tag="ECL_00328"
                     /note="acetate permease; Provisional; Region: actP;
                     PRK09395"
                     /db_xref="CDD:236495"
     misc_feature    complement(order(338724..338729,338736..338738,
                     339585..339587,339594..339596))
                     /locus_tag="ECL_00328"
                     /note="Na binding site [ion binding]; other site"
                     /db_xref="CDD:271374"
     gene            complement(339833..340147)
                     /locus_tag="ECL_00329"
                     /db_xref="GeneID:9122838"
     CDS             complement(339833..340147)
                     /locus_tag="ECL_00329"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_003610844.1"
                     /db_xref="GeneID:9122838"
                     /translation="MNNDICQQIENSAHYRELVDKRQRFAFLLSIIMLIIYVGFILLI
                     AFAPHWLGTPLHEGTSVTRGIPIGIGVIVISFVLTGVYVWRANGEFDRLNKAVLREVK
                     AS"
     misc_feature    complement(339839..340147)
                     /locus_tag="ECL_00329"
                     /note="Uncharacterized membrane protein, DUF485 family
                     [Function unknown]; Region: YjcH; COG3162"
                     /db_xref="CDD:225704"
     gene            complement(340282..342240)
                     /locus_tag="ECL_00330"
                     /db_xref="GeneID:9122839"
     CDS             complement(340282..342240)
                     /locus_tag="ECL_00330"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyl-CoA synthetase"
                     /protein_id="YP_003610845.1"
                     /db_xref="GeneID:9122839"
                     /translation="MSQIHKHDIPANIADRCLINPEQYHEKYQQSVSDPDAFWGEQGH
                     ILDWIKPYQKVKNTSFAPGNVSIKWYEDGTLNLAANCLDRHLAERGNETAIIWEGDDA
                     SQSKHISYKELHRDVCRFANVLLDQGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHS
                     VIFGGFSPEAVAGRIVDSSSKLVITADEGVRAGRGIPLKKNVDEALKNPNVKTVSNVI
                     VLKRTGGKIDWNEGRDLWWSDLIEKASDQHQPQEMNAEDPLFILYTSGSTGKPKGVLH
                     TTGGYLVYAATTFKYVFDYHPGDIYWCTADVGWVTGHSYLLYGPLACGATTLMFEGVP
                     NWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLRILGSVGEPINP
                     EAWEWYWKKIGNEKCPVMDTWWQTETGGFMITPMPGATRLKAGSATQPFFGVQPALVD
                     NEGNPLDGATEGNLVIVDSWPGQARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDG
                     YYWITGRVDDVLNVSGHRLGTAEIESALVSHPKIAEAAVVGIPHNIKGQAIYAYVTLN
                     HGEEPSPELYADVRNWVRKEIGPLATPDVLHWTDSLPKTRSGKIMRRILRKIAAGDTS
                     NLGDTSTLADPGVVEKLLEEKQSIAMPS"
     misc_feature    complement(340294..342225)
                     /locus_tag="ECL_00330"
                     /note="acetyl-CoA synthetase; Provisional; Region:
                     PRK00174"
                     /db_xref="CDD:234677"
     gene            342664..343977
                     /locus_tag="ECL_00331"
                     /db_xref="GeneID:9122840"
     CDS             342664..343977
                     /locus_tag="ECL_00331"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate/aspartate:proton symporter"
                     /protein_id="YP_003610846.1"
                     /db_xref="GeneID:9122840"
                     /translation="MKNVKVSLAWQILLALVLGILLGSYLHYHSDSREWLIANLLSPA
                     GDIFIHLIKMIVVPIVISTLVVGIAGVGDAKQLGRIGAKTILYFEVITTIAIILGITL
                     ANVFQPGSGIDMSQLATVDISKYQSTTAEVQSHAHGLMGTILSLVPTNIVASMAKGEM
                     LPIIFFSVLFGLGLSSLPATHREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVT
                     VANFGFASLWPLAKLVILVHFAILFFALVVLGIVARLCGLSIWILIRILKDELILAYS
                     TASSESVLPRIIEKMEAYGAPASITSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGID
                     LSLWQEIVLVLTLMVTSKGIAGVPGVSFVVLLATLGSVGIPLEGLAFIAGVDRILDMA
                     RTALNVVGNALAVLVIAKWEHKFDRKKALAYEREVLGRFDKTADQ"
     misc_feature    342664..343974
                     /locus_tag="ECL_00331"
                     /note="glutamate/aspartate:proton symporter; Provisional;
                     Region: gltP; PRK11283"
                     /db_xref="CDD:183075"
     gene            complement(344058..344732)
                     /locus_tag="ECL_00332"
                     /db_xref="GeneID:9122841"
     CDS             complement(344058..344732)
                     /locus_tag="ECL_00332"
                     /codon_start=1
                     /transl_table=11
                     /product="Sel1 domain-containing protein"
                     /protein_id="YP_003610847.1"
                     /db_xref="GeneID:9122841"
                     /translation="MKPFLLLLLVFTSFVHADEIGSQYKAQAEAGDARAQYYLADTWF
                     SSGDSKQAAMWAEKAAKGGDIDAMALLSQIHFTQGDYAQAKALAQQATIAGSKRGAIM
                     LARVLVNTQGGKTDYPQAIKLLQTATEDIDNDSAVDAQMLLGLIYANGVEVAQDDALA
                     ASWFKRSSSLSRTGYAEYWAGMLFQQGEKGFITPNKQKALYWLNLSCTEGFDTGCEEF
                     DALSGE"
     misc_feature    complement(344067..>344663)
                     /locus_tag="ECL_00332"
                     /note="TPR repeat [Signal transduction mechanisms];
                     Region: TPR; COG0790"
                     /db_xref="CDD:223861"
     misc_feature    complement(344505..344591)
                     /locus_tag="ECL_00332"
                     /note="SLR repeat [structural motif]; Region: SLR repeat"
                     /db_xref="CDD:276807"
     misc_feature    complement(344406..344495)
                     /locus_tag="ECL_00332"
                     /note="SLR repeat [structural motif]; Region: SLR repeat"
                     /db_xref="CDD:276807"
     misc_feature    complement(344286..344387)
                     /locus_tag="ECL_00332"
                     /note="SLR repeat [structural motif]; Region: SLR repeat"
                     /db_xref="CDD:276807"
     gene            complement(344854..345006)
                     /locus_tag="ECL_00333"
                     /db_xref="GeneID:9122842"
     CDS             complement(344854..345006)
                     /locus_tag="ECL_00333"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610848.1"
                     /db_xref="GeneID:9122842"
                     /translation="MTPLKTALGIVFIICLTIVIFTFITRGKLCELTIKSEHQEVAAK
                     LACVAG"
     misc_feature    complement(344857..>344976)
                     /locus_tag="ECL_00333"
                     /note="Hok/gef family; Region: HOK_GEF; cl27487"
                     /db_xref="CDD:332308"
     gene            complement(345328..347007)
                     /locus_tag="ECL_00334"
                     /db_xref="GeneID:9122843"
     CDS             complement(345328..347007)
                     /locus_tag="ECL_00334"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase alpha subunit"
                     /protein_id="YP_003610849.1"
                     /db_xref="GeneID:9122843"
                     /translation="MSNAINEIDNTDLVFIFGYNPADSHPIVANHVIRAKQNGAKIIV
                     CDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDQAFVATRTEGFEEYRKI
                     VEGYTPESVEAITGVSAQEIRQAARMYAGAKTAAILWGMGVTQFYQGVETVRSLTSLA
                     MLTGNLGKAHVGVNPVRGQNNVQGACDMGALPDTYPGYQYVKFPENRAKFAKAWGVES
                     LPEHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKGFEDLELVIVQDIFM
                     TKTAAAADVILPSTSWGEHEGVYTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMG
                     YPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGYIQWPCRDESEADQGTSYLFKEKF
                     DTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPG
                     YAQINTADAERLGIEDEALVWVNSRKGRIITRAQVSDRPNKGAVYMTYQWWIGACNEL
                     VTENLSPITKTPEYKYCAVRVEPIADQHAAEQYVIDEYNKLKARLRESAMG"
     misc_feature    complement(345421..>347007)
                     /locus_tag="ECL_00334"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:324541"
     misc_feature    complement(order(346123..346125,346138..346143,
                     346177..346179,346186..346194,346264..346272,
                     346588..346590,346807..346809,346867..346875,
                     346936..346941,346948..346950,346954..346959))
                     /locus_tag="ECL_00334"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:238218"
     gene            complement(347056..347496)
                     /locus_tag="ECL_00335"
                     /db_xref="GeneID:9122844"
     CDS             complement(347056..347496)
                     /locus_tag="ECL_00335"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase H"
                     /protein_id="YP_003610850.1"
                     /db_xref="GeneID:9122844"
                     /translation="MINWSRLMKKVVTVCPYCASGCKIHLVVDNGKIVRAEAAQGKTN
                     QGTLCLKGYYGWDFINDTQILTPRLKTPMIRRERGGKLEAVSWNEALDYVATRLSAIK
                     AKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARV"
     misc_feature    complement(<347059..347460)
                     /locus_tag="ECL_00335"
                     /note="Molybdopterin-Binding (MopB) domain of the MopB
                     superfamily of proteins, a large, diverse, heterogeneous
                     superfamily of enzymes that, in general, bind
                     molybdopterin as a cofactor. The MopB domain is found in a
                     wide variety of molybdenum- and...; Region:
                     Molybdopterin-Binding; cl09928"
                     /db_xref="CDD:299123"
     gene            complement(347553..347705)
                     /locus_tag="ECL_00336"
                     /db_xref="GeneID:9122845"
     CDS             complement(347553..347705)
                     /locus_tag="ECL_00336"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610851.1"
                     /db_xref="GeneID:9122845"
                     /translation="MLSLNYSAVGSSQMDFYVTELQPMSHPLPFRHVNFDDCLLFVRV
                     LPGKHP"
     gene            347728..348459
                     /locus_tag="ECL_00337"
                     /db_xref="GeneID:9122846"
     CDS             347728..348459
                     /locus_tag="ECL_00337"
                     /codon_start=1
                     /transl_table=11
                     /product="two component transcriptional regulator"
                     /protein_id="YP_003610852.1"
                     /db_xref="GeneID:9122846"
                     /translation="MKPAILVVDDDTAVCELLQDVLSEHVFTVLVCHNGQDALNRVHQ
                     EPGIALVLLDMMLPDINGLQVLLQLQKQRPDLPVVMLTGLGSESDVVVGLEMGADDYI
                     GKPFNPRVVVARVKAVLRRTGALAADTPAPRVAGIAFNGWTLDTTRCELIDPQRNPVP
                     LTQGEYGLLLALTQNARRVLSREQLLELTHSESADVFDRTIDVLIMRLRRKIEANPHQ
                     PALIKTIRGLGYVFAADVCHPDRAA"
     misc_feature    347740..348432
                     /locus_tag="ECL_00337"
                     /note="DNA-binding response regulator, OmpR family,
                     contains REC and winged-helix (wHTH) domain [Signal
                     transduction mechanisms, Transcription]; Region: OmpR;
                     COG0745"
                     /db_xref="CDD:223816"
     gene            complement(348464..349372)
                     /locus_tag="ECL_00338"
                     /db_xref="GeneID:9122847"
     CDS             complement(348464..349372)
                     /locus_tag="ECL_00338"
                     /codon_start=1
                     /transl_table=11
                     /product="putative membrane-bound beta-hydroxylase"
                     /protein_id="YP_003610853.1"
                     /db_xref="GeneID:9122847"
                     /translation="MFAAIIIAIFIISVIYAHSRGKEKQTLSRQLFDHSTFMAPINMF
                     MTAFSSLPARQPFFETERFPELNKLTENWEVIREEALRLQDHIKAAQNHNDAGFNTFF
                     KRGWKRFYLKWYADAHPSAQILCPVTTQLVSEIPSVKAAMFAELPAGAKLGKHRDPYA
                     GSVRYHLGLVTPNDDRCFIEVDQQRHSWRDGEAVIFDETYVHWAENKSDHTRIILFCD
                     IERPMKWRWAQAVNHWVGTTLMSAASSPNDDNDRTGGINRIFKYVHAGRERGQRLKKR
                     NRKLYYALKYLVITAIFAALIVAAIT"
     misc_feature    complement(348491..349336)
                     /locus_tag="ECL_00338"
                     /note="Aspartyl/asparaginyl beta-hydroxylase, cupin
                     superfamily [Posttranslational modification, protein
                     turnover, chaperones]; Region: LpxO2; COG3555"
                     /db_xref="CDD:226085"
     gene            complement(349515..350522)
                     /locus_tag="ECL_00339"
                     /db_xref="GeneID:9122848"
     CDS             complement(349515..350522)
                     /locus_tag="ECL_00339"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610854.1"
                     /db_xref="GeneID:9122848"
                     /translation="MERKGIIAAGNMLVDHVHQIVQWPERGWLAEITHSERSTGGAPL
                     NVLLTLAKMHVGLPLQAVGLIGEDSDGDYILAMLDQYHVNRQRVQRTTFAPTSMSQVM
                     ADPSGQRTFFHSPGANRLLDLPAFDRLDGTMKIFHLGYLLLLDSLDMPDDEYGTRSAR
                     LLAQMREQGYETSLDLVSRKGDPRYQPLVLPALRHLDYLVINELEAGEFSGLEMRDGN
                     DAPHVAHIAEAAAQLLAAGVRQRVVIHCPEGAWGEAANEEGRWIPSWRLTQEEIIGSV
                     GAGDAFCAGFLYGCHESLPLAESIYLAHACARASLLAANAIYGAKTLEELTRFIQESS
                     A"
     misc_feature    complement(349521..350507)
                     /locus_tag="ECL_00339"
                     /note="Sugar or nucleoside kinase, ribokinase family
                     [Carbohydrate transport and metabolism]; Region: RbsK;
                     COG0524"
                     /db_xref="CDD:223598"
     misc_feature    complement(order(349683..349685,349692..349694,
                     350343..350345))
                     /locus_tag="ECL_00339"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238177"
     misc_feature    complement(order(349677..349679,349686..349691,
                     349698..349700,349791..349793,349917..349919))
                     /locus_tag="ECL_00339"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238177"
     gene            complement(350522..351385)
                     /locus_tag="ECL_00340"
                     /db_xref="GeneID:9122849"
     CDS             complement(350522..351385)
                     /locus_tag="ECL_00340"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610855.1"
                     /db_xref="GeneID:9122849"
                     /translation="MMPLISLADGLAHARQHRYALGAFNVLDTHFLRALFAAAKQERS
                     PFIINIAEVHFKYVSLESLVEAVKYEAARHAIPVVLNLDHGLHFDAVVRALRLGFSSV
                     MFDGSTLSYEENIRQTREVVKMCHAVGVSVEAELGAVGGDEGGALYGHADEAYFTDPQ
                     LAREFVDSTGIDALAVAIGNAHGKYKGEPKLDFPRLDAIRQQTGLPLVLHGGSGISDA
                     DFRRAIELGIHKINFYTGMSQAALSAVEQRMANRQPLYDEFAELLLGIEEAITDTVAE
                     QMRIFGSAGQA"
     misc_feature    complement(350525..351382)
                     /locus_tag="ECL_00340"
                     /note="hypothetical protein; Provisional; Region:
                     PRK06801"
                     /db_xref="CDD:180701"
     gene            complement(351393..352079)
                     /locus_tag="ECL_00341"
                     /db_xref="GeneID:9122850"
     CDS             complement(351393..352079)
                     /locus_tag="ECL_00341"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610856.1"
                     /db_xref="GeneID:9122850"
                     /translation="MKRSEINEILGHTRQFFSMHDVHLPPFASFPPTKWQQLDQAAWQ
                     EVFDLKLGWDVTAFGGSSFAAQGLTLFTLRNGSPNGTPYEKCYAEKIMHVRDGQLTPM
                     HFHWRKREDIINRGGGNLIIELWNAGAHAETENTDVTVTIDGCQQTHAPGSQLRLTPG
                     ESICLTPGLYHSFWGERGFGDVLVGEVSSVNDDEHDNHFLQPVARYNNIEEDEPAVLV
                     LCNEYNLFRI"
     misc_feature    complement(351411..352079)
                     /locus_tag="ECL_00341"
                     /note="Protein of unknown function (DUF1498); Region:
                     DUF1498; pfam07385"
                     /db_xref="CDD:311371"
     gene            complement(352150..353325)
                     /locus_tag="ECL_00342"
                     /db_xref="GeneID:9122851"
     CDS             complement(352150..353325)
                     /locus_tag="ECL_00342"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
                     /protein_id="YP_003610857.1"
                     /db_xref="GeneID:9122851"
                     /translation="MPLQTVCQKFFSASLPDVHSFRINVLVSMAVALTHGADLTLTSL
                     GRSLPGRAHVKNKIKRVDRALGNTALHRDIPRIQHLLTHTITSLMPFCVIAVDWTGWH
                     DRNWYLLRASLVCNGRSLPLMSEVVPAELAQNSDVQCRFLDRLHDAIPKDKAVTIITD
                     AGFRTDWFRHVSQLGWSFTGRVRGCISFRLDGDKKWMKISELEATGQPVCVGYGVLSR
                     KPRTPCYGRFYLHKRPDAGRQGKGGMPKTQREHRSSAREPWLLFSNAEGLEPHQIMAL
                     YSRRMQIEQNFRDDKSPRFGFGLRLSRSQGKGRLEVLNMVAAMASLVMWLAGYRAERQ
                     CLHWHYQASSIRHRRVLSYLSLAEEVIRHEPGKVRRLNIVNEMKKLGKEYSNMVMVA"
     misc_feature    complement(352360..353052)
                     /locus_tag="ECL_00342"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:307645"
     gene            complement(353451..354392)
                     /locus_tag="ECL_00343"
                     /db_xref="GeneID:9122852"
     CDS             complement(353451..354392)
                     /locus_tag="ECL_00343"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC superfamily ATP binding protein"
                     /protein_id="YP_003610858.1"
                     /db_xref="GeneID:9122852"
                     /translation="MRLKPLVTALCAGALLAATPFAQAKDLKSIGVTVGDLANPFFVQ
                     ITKGAELEARKLAGDNVKVTLVSSGYDLGQQVAQIDNFIAAKVDMIILNAADSKGIGP
                     AVKRAKEAGIVVVAVDVAAEGADATITSDNTQAGEMACKYITDRLNGKGNVVIINGPP
                     VSAVQNRVEGCQTEFKKHPDIKVLSDNQNAKGSREGGLEVMTSLLAANPKIDGVFAIN
                     DPTAIGADLAAKQAQRNEFFIVGVDGSPDGEEALKRENSLFVATPAQDPQVMAAKAVE
                     IGYDILQGKPAPKEPVLIPVTMIDKKNVGTYKGWTVK"
     misc_feature    complement(353493..354308)
                     /locus_tag="ECL_00343"
                     /note="Periplasmic sugar-binding domain of uncharacterized
                     ABC-type transport systems; Region:
                     PBP1_ABC_sugar_binding_like_11; cd06321"
                     /db_xref="CDD:107316"
     misc_feature    complement(order(353598..353600,353664..353666,
                     353892..353894,354039..354041,354270..354272))
                     /locus_tag="ECL_00343"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107316"
     gene            complement(354421..355416)
                     /locus_tag="ECL_00344"
                     /db_xref="GeneID:9122853"
     CDS             complement(354421..355416)
                     /locus_tag="ECL_00344"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC superfamily permease"
                     /protein_id="YP_003610859.1"
                     /db_xref="GeneID:9122853"
                     /translation="MTTPTHPQQVAKSASAKKMLMSDLMQTVGILPILILIVAVFGFI
                     APNFFTESNLLNITRQASINIVLAAGMTFIILTGGIDLSVGSILGTTAVAAMVVSLIP
                     EFAGLSIPAALMLGLVLGLFNGALVAFAGLPPFIVTLGTYTALRGAAYLLADGTTVIN
                     SNINFEWIGNNYLGPVPWLVVIALAVIVVCWFILRRTTLGVHIYAVGGNMQAARLTGI
                     KVWLVLLFVYGMSGLLSGLGGVMSASRLYSANGNLGMGYELDAIAAVILGGTSFVGGI
                     GTITGTLVGALIIATLNNGMTLMGVSYFWQLVIKGAVIIIAVLIDKYRTRHHQSA"
     misc_feature    complement(354424..355416)
                     /locus_tag="ECL_00344"
                     /note="Predicted ABC-type sugar transport system, permease
                     component [General function prediction only]; Region:
                     COG4158"
                     /db_xref="CDD:226633"
     misc_feature    complement(354730..354786)
                     /locus_tag="ECL_00344"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(355413..356933)
                     /locus_tag="ECL_00345"
                     /db_xref="GeneID:9122854"
     CDS             complement(355413..356933)
                     /locus_tag="ECL_00345"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose ABC superfamily ATP binding component"
                     /protein_id="YP_003610860.1"
                     /db_xref="GeneID:9122854"
                     /translation="MSRTPVLEMRSIAKTFGNFHALKGVDLTVFPGEIHALMGENGAG
                     KSTLMKILAGAYTATSGEILIDGQPYHIKGPKDALAAGITLIYQEMQLAPNLTVAENI
                     FLGSELSRGGLVQRKEMAAQAQAVIDRLGANFNATDLVMKLTIAEQQQVEIARALHRN
                     SRILVMDEPTAALSSRETHRLFELILRLRDEGMAIIYISHRMAEVYELSDRVSVLRDG
                     QYVGSLTRDKLNASELVKMMVGRPLSDLFNKERDIPLGSPRLNVHHLTDGKKVQPCSL
                     QVRSGEIVGLAGLVGAGRSELAQLIFGVRKATGGMIEVDGEPVVIHSPRAAIENGIGF
                     LTENRKEQGLFLELAAQENITMATLERDATFGMLNRKKAQSISDDAIALLNIRVPHAQ
                     VRAGGLSGGNQQKLLISRWVAIGPRILILDEPTRGVDVGAKSEIYRIMNQMARKGVAI
                     LMISSELPEVVGMSDRVYVMREGSIAGELHGHDISQENIMTLATGVNDSHHQAVQL"
     misc_feature    complement(355449..356933)
                     /locus_tag="ECL_00345"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     gene            357115..359391
                     /locus_tag="ECL_00346"
                     /db_xref="GeneID:9122855"
     CDS             357115..359391
                     /locus_tag="ECL_00346"
                     /codon_start=1
                     /transl_table=11
                     /product="integral membrane sensor hybrid histidine
                     kinase"
                     /protein_id="YP_003610861.1"
                     /db_xref="GeneID:9122855"
                     /translation="MPSRSPFFASARGRLLIFNLLVVAVTLMVSGVAVLGFRHASQIQ
                     EQVQQQTLDDMTGSMNLARDTASVATAAVRLSQVVGALEYKGEAERLKQTQMALRHSL
                     EQLADAPLAQQEPGLVARIIRRSNELQQSVTGMLERGQRRHLQRNALLSSLYQSQSYL
                     RHLQDINRRFGSNIPDAQQLAEMDRLILAAIDTPSPRATLQQLDAVTATLPQRATQPV
                     VNLVLPDFNDELRRLAPLSKQLEESDLAISWYMFHIKALVAILNSDINQYVEQVAEAS
                     RLRTAQSHQELRSISVFISIFAVLALIITGCACWYIYRNLGSNLTAISRAMSRLAHGE
                     QDVSVPALQRRDELGELARAFNVFARNTASLEHTTRLLKEKTSQMEIDRIERQGLEEA
                     LLHSQKMKAVGQLTGGLAHDFNNLLAVIIGSLELTDPDSSDAPRIARALNAAERGALL
                     TQRLLAFSRKQSLTPHAVEMKPLLENLRELMRHSLPATLSLEIEAQSPAWPAWIDVGQ
                     LENAIINLVMNARDAMEGQTGVIKIRTWNQRVTRSDGRRQDMVALEVIDRGSGMTQEV
                     KSRVFEPFFTTKQTGSGSGLGLSMVYGFVRQSGGRVEIESAPGQGTTVRLHLPRSTLP
                     VVPEDETHSATASAENERLVLVLEDEADVRQTLCEQLHQLGYLTLEAESGEQALNMLA
                     ASPDIGMFISDLMLPGSLSGAEVINHVRSHYPQLPVLLISGQDLRPTHNPQLPDVALL
                     RKPFTRVQLAQALRKISA"
     misc_feature    357994..358197
                     /locus_tag="ECL_00346"
                     /note="HAMP domain; Region: HAMP; pfam00672"
                     /db_xref="CDD:307012"
     misc_feature    order(358072..358077,358081..358086,358093..358098,
                     358102..358104,358153..358158,358162..358167,
                     358174..358179,358183..358188,358195..358197)
                     /locus_tag="ECL_00346"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    <358243..359382
                     /locus_tag="ECL_00346"
                     /note="two component system sensor kinase SsrA;
                     Provisional; Region: PRK15347; cl28304"
                     /db_xref="CDD:333124"
     gene            359512..360135
                     /locus_tag="ECL_00347"
                     /db_xref="GeneID:9122856"
     CDS             359512..360135
                     /locus_tag="ECL_00347"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610862.1"
                     /db_xref="GeneID:9122856"
                     /translation="MIVMPTTYSPNTVARSFTLVDEFELSGRVLHVIYDSQTPRAAII
                     EADIETFDGVPRHRVVAALDLQHKAHLGKDIIAVERCWEDTRVVQVEGICVDPAERDK
                     GLATRLYEALVLHCGVTLISDFEQYEGGKMLWQKIARESDQIAVFVLDTEQGAFWPYD
                     GSKVIYDGGCIPEDRIWSHSPDQKCSGIVLVAENKQRVRQIMEASPR"
     misc_feature    <359737..>359850
                     /locus_tag="ECL_00347"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:306954"
     gene            360214..360537
                     /locus_tag="ECL_00348"
                     /db_xref="GeneID:9122857"
     CDS             360214..360537
                     /locus_tag="ECL_00348"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610863.1"
                     /db_xref="GeneID:9122857"
                     /translation="MKRYSTALLFGLLSLSSQLAHADVIDDAIGNIQQAINDAYNPGS
                     SRSNDDDDRYDDDRRIDSRQYDDRRRQLEDRRRRLDERQRQLDDDRRRLEEDERRLEE
                     DYDRG"
     gene            complement(360590..361348)
                     /locus_tag="ECL_00349"
                     /db_xref="GeneID:9122858"
     CDS             complement(360590..361348)
                     /locus_tag="ECL_00349"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex accessory
                     protein"
                     /protein_id="YP_003610864.1"
                     /db_xref="GeneID:9122858"
                     /translation="MSLTITLTGTGSAQLVPVFGCDCAACRRARLQENYRRRPCSAAV
                     KFNDAVTLLDAGIPHLMDDWPAGSFQQFLLTHYHMDHVQGLFPLRWGVGATIPVYGPP
                     DEAGCDDLFKHPGILDFSHMLEPFVMFELQGLRVTPLPLNHSKLTFGYLLESAHSRVA
                     WLSDTAGLPEKTVKFLLNNQPQAMIIDCSHEPRPQTPRNHCDLNTVVALNEVIGCPQV
                     ILTHISHQFDVWMMDNPLPDGIEAGYDGMVLVLD"
     misc_feature    complement(360596..361342)
                     /locus_tag="ECL_00349"
                     /note="carbon-phosphorus lyase complex accessory protein;
                     Provisional; Region: phnP; PRK11244"
                     /db_xref="CDD:183052"
     misc_feature    complement(order(360857..360859,360920..360922,
                     361106..361111,361115..361117,361121..361123))
                     /locus_tag="ECL_00349"
                     /note="active site"
                     /db_xref="CDD:293822"
     misc_feature    complement(order(360857..360859,360920..360922,
                     361106..361111,361115..361117,361121..361123))
                     /locus_tag="ECL_00349"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293822"
     misc_feature    complement(order(360857..360859,360920..360922,
                     361115..361117,361121..361123))
                     /locus_tag="ECL_00349"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293822"
     misc_feature    complement(order(360857..360859,361106..361111))
                     /locus_tag="ECL_00349"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:293822"
     gene            complement(361358..361792)
                     /locus_tag="ECL_00350"
                     /db_xref="GeneID:9122859"
     CDS             complement(361358..361792)
                     /locus_tag="ECL_00350"
                     /codon_start=1
                     /transl_table=11
                     /product="aminoalkylphosphonic acid N-acetyltransferase"
                     /protein_id="YP_003610865.1"
                     /db_xref="GeneID:9122859"
                     /translation="MPDCTLRPATADDAQIVYALICELKQAEFDHQAFHAGYLANLQD
                     HNMRYQLAELNGQVVGMIGLHMQFHLHHARWIGEIQELVVMPEARGLKVGSQLLAWAE
                     DTARQAGAELTELSTSVRRLDAHRFYVREGYTQSHFRFTKPL"
     misc_feature    complement(361361..361792)
                     /locus_tag="ECL_00350"
                     /note="aminoalkylphosphonic acid N-acetyltransferase;
                     Provisional; Region: PRK10146"
                     /db_xref="CDD:182266"
     misc_feature    complement(order(361508..361513,361541..361549))
                     /locus_tag="ECL_00350"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            complement(361785..362312)
                     /locus_tag="ECL_00351"
                     /db_xref="GeneID:9122860"
     CDS             complement(361785..362312)
                     /locus_tag="ECL_00351"
                     /codon_start=1
                     /transl_table=11
                     /product="ribose 1,5-bisphosphokinase"
                     /protein_id="YP_003610866.1"
                     /db_xref="GeneID:9122860"
                     /translation="MGPSGSGKDSLLSALRQREHPQLLVAHRYITRAANAGSENHIAL
                     SEQEFFTRAGQNLLALSWHANGYYYGIGIEIDLWLHAGFDVLVNGSRAHLPQARARYA
                     SALLPVCLQVSPDVLRSRLQSRGRESEKEIAQRLERAAHYTPADCHILNNDGSLLQSV
                     DNVLSLIRQKEKQHA"
     misc_feature    complement(361788..362312)
                     /locus_tag="ECL_00351"
                     /note="ribose 1,5-bisphosphokinase; Provisional; Region:
                     PRK10078"
                     /db_xref="CDD:236648"
     misc_feature    complement(361791..362312)
                     /locus_tag="ECL_00351"
                     /note="Guanylate kinase [Nucleotide transport and
                     metabolism]; Region: Gmk; COG0194"
                     /db_xref="CDD:223272"
     misc_feature    complement(order(362283..362294,362307..362309))
                     /locus_tag="ECL_00351"
                     /note="active site"
                     /db_xref="CDD:238977"
     gene            complement(362333..363469)
                     /locus_tag="ECL_00352"
                     /db_xref="GeneID:9122861"
     CDS             complement(362333..363469)
                     /locus_tag="ECL_00352"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism protein PhnM"
                     /protein_id="YP_003610867.1"
                     /db_xref="GeneID:9122861"
                     /translation="MIINNVRLVLEDEVINGSIEIRDGAIRAYAETRSHLPEAMDGEG
                     GWLLPGLIELHTDNLDKFFTPRPKVDWPAHSAMSSHDALMVASGITTVLDAVAIGDVR
                     DGGDRLENLEKMINAVEETQKRGLNRAEHRLHLRCELPHHTTLPLFEKLVDREPVSLV
                     SLMDHSPGQRQFASLEKYREYYQGKYSLNDVEMARYEEEQLALAAQWSQPNRVSIAAM
                     CRDRNIALASHDDATHNHVRESHQLGSVIAEFPTTFEAAEASRAHGMNVLMGAPNIVR
                     GGSHSGNVAASKLASLGLLDILSSDYYPASLLDAAFRVADDDSNCFTLSQAIRLVTKN
                     PASALNLHDRGEIAEGKRADLVLAHRKGEHIHIDHVWRQGKRVF"
     misc_feature    complement(362336..363469)
                     /locus_tag="ECL_00352"
                     /note="Alpha-D-ribose 1-methylphosphonate 5-triphosphate
                     diphosphatase PhnM [Inorganic ion transport and
                     metabolism]; Region: PhnM; COG3454"
                     /db_xref="CDD:225985"
     misc_feature    complement(order(362567..362569,362783..362785,
                     363299..363301,363305..363307))
                     /locus_tag="ECL_00352"
                     /note="active site"
                     /db_xref="CDD:238631"
     gene            complement(363466..364146)
                     /locus_tag="ECL_00353"
                     /db_xref="GeneID:9122862"
     CDS             complement(363466..364146)
                     /locus_tag="ECL_00353"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610868.1"
                     /db_xref="GeneID:9122862"
                     /translation="MIHVENVSKTFVLHQQNGVRLPVLQNASLKVNSGECVVLHGHSG
                     SGKSTLLRSLYANYLPDEGHIHIRHADEWVDLVQAPARKVLEVRRSTIGWVSQFLRVI
                     PRISALDVVMQPLLDLGVPRETCAAKAASLLTRLNVPERLWHLAPSTFSGGEQQRVNI
                     ARGFIVDYPILLLDEPTASLDSKNSAAVVELIEQAKARGAAIVGIFHDESVRNRVADR
                     LHPMGTNV"
     misc_feature    complement(363478..364146)
                     /locus_tag="ECL_00353"
                     /note="Alpha-D-ribose 1-methylphosphonate 5-triphosphate
                     synthase subunit PhnL [Inorganic ion transport and
                     metabolism]; Region: PhnL; COG4778"
                     /db_xref="CDD:227118"
     gene            complement(364232..364987)
                     /gene="phnK"
                     /locus_tag="ECL_00354"
                     /db_xref="GeneID:9122863"
     CDS             complement(364232..364987)
                     /gene="phnK"
                     /locus_tag="ECL_00354"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate C-P lyase system protein PhnK"
                     /protein_id="YP_003610869.1"
                     /db_xref="GeneID:9122863"
                     /translation="MKPLLSVNNLTHLYAPGKGFSDVSFELWPGEVLGIVGESGSGKT
                     TLLKSISARLAPQNGEILYEGASLYGMSEAERRRLLRTEWGVVHQHPLDGLRRQVSAG
                     GNIGERLMATGARHYGNIRETAQRWLTDVEIPASRIDDLPTTFSGGMQQRLQIARNLV
                     THPKLVFMDEPTGGLDVSVQARLLDLLRGLVVELNLAVVIVTHDLGVARLLADRLLVM
                     KQGQVVESGLTDRVLDDPLHPYTQLLVSSVLQN"
     misc_feature    complement(364235..364987)
                     /gene="phnK"
                     /locus_tag="ECL_00354"
                     /note="phosphonate C-P lyase system protein PhnK;
                     Provisional; Region: phnK; PRK11701"
                     /db_xref="CDD:183280"
     gene            complement(364984..365829)
                     /gene="phnJ"
                     /locus_tag="ECL_00355"
                     /db_xref="GeneID:9122864"
     CDS             complement(364984..365829)
                     /gene="phnJ"
                     /locus_tag="ECL_00355"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism PhnJ"
                     /protein_id="YP_003610870.1"
                     /db_xref="GeneID:9122864"
                     /translation="MANLSGYNFAYLDEQTKRMIRRAILKAVAIPGYQVPFGGREMPM
                     PYGWGTGGIQLTASVIGESDVLKVIDQGADDTTNAVSIRNFFKRVTGVNTTEKTEDAT
                     LIQTRHRIPETPLTEDQILIFQVPIPEPLRFIEPRETETRTMHALEEYGVMQVKLYED
                     IARFGHIATTYAYPVKVNGRYVMDPSPIPKFDNPKMDMMPALQLFGAGREKRIYAVPP
                     YTRVESLDFDDHPFTVQEWDEPCAICGSKHSYLDEVVLDDTGKRMFVCSDTDYCRQQS
                     EANSQ"
     misc_feature    complement(364999..365817)
                     /gene="phnJ"
                     /locus_tag="ECL_00355"
                     /note="Phosphonate metabolism protein PhnJ; Region: PhnJ;
                     pfam06007"
                     /db_xref="CDD:310533"
     gene            complement(365822..366886)
                     /gene="phnI"
                     /locus_tag="ECL_00356"
                     /db_xref="GeneID:9122865"
     CDS             complement(365822..366886)
                     /gene="phnI"
                     /locus_tag="ECL_00356"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism PhnI"
                     /protein_id="YP_003610871.1"
                     /db_xref="GeneID:9122865"
                     /translation="MYVAVKGGEKAIAAAHALQAHRRRGDEQLPELSVAQIEQQLNLA
                     VDRVMTEGGVADRELAALALKQASGDNVEAIFLLRAWRTTVPRLAVSEPVNTAEMRLE
                     RRISAVYKDIPGGQLLGPTYDYTHRLLDFTLLANGETPTLSTTETGQEASPHVFSLLA
                     KQGLAKAEEETGAQPDDITRTPPVYPCSRSSRLQQLMRGDEGYLLALAYSTQRGYGRN
                     HPFAAEIRSGYLDVEIIPEELGFAVNVGELLMTECEMVNGFVAPDDDTPHFTRGYGLV
                     FGMSERKAMAMALVDRALQAPDYGEQISGPAQDEEFVLAHADNVEAAGFVSHLKLPHY
                     VDFQAELELLKRLQRERENG"
     misc_feature    complement(365831..366886)
                     /gene="phnI"
                     /locus_tag="ECL_00356"
                     /note="Bacterial phosphonate metabolism protein (PhnI);
                     Region: PhnI; cl01456"
                     /db_xref="CDD:321512"
     gene            complement(366886..367470)
                     /locus_tag="ECL_00357"
                     /db_xref="GeneID:9122866"
     CDS             complement(366886..367470)
                     /locus_tag="ECL_00357"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon-phosphorus lyase complex subunit"
                     /protein_id="YP_003610872.1"
                     /db_xref="GeneID:9122866"
                     /translation="MTLQPAFTLAVQDAQHSFRRLLKAMSEPGVIVSLHQLSQGWLPL
                     NLATTSVLLTLADNDTPVWLSGTLSNDIASQNLRFHTNAPLVEQPRQAVFAVADEQIS
                     HEQLNALSEGSAVAPETSATLLLQVASLSGGRMLRLTGAGIADERMVAPQLPECIIHE
                     LTERPHPFPLGIDLILTCGERLLAIPRTTHVEVC"
     misc_feature    complement(366889..367470)
                     /locus_tag="ECL_00357"
                     /note="carbon-phosphorus lyase complex subunit; Validated;
                     Region: phnH; PRK10147"
                     /db_xref="CDD:236655"
     gene            complement(367467..367919)
                     /locus_tag="ECL_00358"
                     /db_xref="GeneID:9122867"
     CDS             complement(367467..367919)
                     /locus_tag="ECL_00358"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610873.1"
                     /db_xref="GeneID:9122867"
                     /translation="MHFDTSTRQRWMRALAHSQPAALASRMNALNLTPDYETLRAPEI
                     GLVQIQARMGGTGERFFGGDAALTRAVIRLSSGTLGYSYVLGRDKPHAERCAVIDALL
                     QEQPHFQTLMETLIAPLEANLAARTAARQAQVNTSRVDFFTLVRGDNA"
     misc_feature    complement(367473..367919)
                     /locus_tag="ECL_00358"
                     /note="Phosphonate metabolism protein PhnG; Region: PhnG;
                     cl01454"
                     /db_xref="CDD:321510"
     gene            complement(367920..368645)
                     /gene="phnF"
                     /locus_tag="ECL_00359"
                     /db_xref="GeneID:9122868"
     CDS             complement(367920..368645)
                     /gene="phnF"
                     /locus_tag="ECL_00359"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate metabolism transcriptional regulator
                     PhnF"
                     /protein_id="YP_003610874.1"
                     /db_xref="GeneID:9122868"
                     /translation="MHLSRHPTSYPTRWQEIAAKLEVELRTHYRCGDYLPAEQQLADR
                     YEVNRHTLRRAIDQLVERGWVQRRQGVGVLVLMRPFDYPLNAQARFSQNLLDQGSHPT
                     SEKLLSVLRPASSHVADALGIQEGDNVVHLRTLRRVNGVAVCQIDHYFSDLSLWPVLQ
                     HFSSGSLHDFLQDATGLVLKRTQTRISARRAQAKESKVLEIPNMAPLLCVRTLNHRDG
                     EINATEYSVSLTRADMIEFTMEH"
     misc_feature    complement(367923..368645)
                     /gene="phnF"
                     /locus_tag="ECL_00359"
                     /note="phosphonate metabolism transcriptional regulator
                     PhnF; Provisional; Region: PRK10079"
                     /db_xref="CDD:182227"
     gene            complement(368666..369445)
                     /gene="phnE"
                     /locus_tag="ECL_00360"
                     /db_xref="GeneID:9122869"
     CDS             complement(368666..369445)
                     /gene="phnE"
                     /locus_tag="ECL_00360"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter inner membrane
                     subunit PhnE"
                     /protein_id="YP_003610875.1"
                     /db_xref="GeneID:9122869"
                     /translation="MQTITLPPPKRSWFSLFSWAILLAVLVISWKGAEMDPLLLFKDA
                     GNMATFAADFFPPDFSQWQDYLGEMAVTLQIAVWGTALAVILSIPFGLMSAENIVPWW
                     IYQPMRRLMDACRAINEMVFAMLFVVAVGLGPFAGVMALFIHTTGVLSKLLSEAVEAI
                     EPGPVEGIRATGANKIEEILYGVLPQVMPLLISYSLYRFESNVRSATVVGMVGAGGIG
                     VTLWEAIRGFQFQQTCALMVLIIITVSLLDFLSQRLRKHFI"
     misc_feature    complement(368672..369388)
                     /gene="phnE"
                     /locus_tag="ECL_00360"
                     /note="phosphonate ABC transporter, permease protein PhnE;
                     Region: PhnE; TIGR01097"
                     /db_xref="CDD:273441"
     gene            complement(369562..370578)
                     /gene="phnD"
                     /locus_tag="ECL_00361"
                     /db_xref="GeneID:9122870"
     CDS             complement(369562..370578)
                     /gene="phnD"
                     /locus_tag="ECL_00361"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate ABC transporter periplasmic
                     phosphonate-binding protein"
                     /protein_id="YP_003610876.1"
                     /db_xref="GeneID:9122870"
                     /translation="MSYKTVAALAFTSMFSISTLLSPAYAEEQEKALNFGIISTESQQ
                     NLKPQWEPFLKDMETKLGIKVNAFFAPDYAGIIQGMRFNKVDIAWYGNLSAMEAVDRA
                     NGQVFAQTVAADGSPGYWSVLIVNKDSPINNLNDMLAKRKELTFGNGDPNSTSGFLVP
                     GYYVFAKNNASASDFKRTVNASHETNALAVANKQVDVATNNTENLDKLKTSAPDKLKE
                     LKVIWKSPLIPGDPIVWRKNLSESTKDKVYDFFMTYGKTPEEKAVLTRLGWAPFRPSS
                     DLQLVPIRQLALFKEMQGVKDNKGLKDEEKTSKVAAIQAQLEDLDRLTAALGAMTSVN
                     KAVQ"
     misc_feature    complement(369727..370497)
                     /gene="phnD"
                     /locus_tag="ECL_00361"
                     /note="Substrate binding domain of ABC-type phosphonate
                     uptake system; contains the type 2 periplasmic binding
                     fold; Region: PBP2_PnhD; cd13575"
                     /db_xref="CDD:270293"
     misc_feature    complement(order(369886..369888,369976..369978,
                     370030..370032,370114..370122,370222..370224,
                     370306..370308,370312..370314,370360..370362))
                     /gene="phnD"
                     /locus_tag="ECL_00361"
                     /note="chemical substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:270293"
     gene            complement(370602..371390)
                     /locus_tag="ECL_00362"
                     /db_xref="GeneID:9122871"
     CDS             complement(370602..371390)
                     /locus_tag="ECL_00362"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphonate/organophosphate ester transporter
                     subunit PhnC"
                     /protein_id="YP_003610877.1"
                     /db_xref="GeneID:9122871"
                     /translation="MQTVIRVEKLSKTFHHNKALHAVDLTVQQGDMVALLGPSGSGKS
                     TLLRHLSGLITGDSIPESHVELLGNTVQRAGRLARDIRKSRAQTGCIFQQFNLVNRLT
                     VLENVLIGALGSTPFWRTCLRWFSPLQKQEALRALTRVGMAHFAHQRVSTLSGGQQQR
                     VAIARALMQKAKIILADEPIASLDPESARIVMETLHDINQNDGITVVVTLHQVDYALR
                     YCERIVALRQGHVFFDGASHQFDNERFDHLYRSINRVEENAKAA"
     misc_feature    complement(370605..371390)
                     /locus_tag="ECL_00362"
                     /note="phosphonate/organophosphate ester transporter
                     subunit; Provisional; Region: PRK09984"
                     /db_xref="CDD:182182"
     gene            complement(371564..372007)
                     /locus_tag="ECL_00363"
                     /db_xref="GeneID:9122872"
     CDS             complement(371564..372007)
                     /locus_tag="ECL_00363"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phnB protein"
                     /protein_id="YP_003610878.1"
                     /db_xref="GeneID:9122872"
                     /translation="MPLSPYISFAGNCAEATAFYQQAVGAELLYKITFGEMPKSESSE
                     EGCPSGMQFPDSAIAHSNVRIAGSDIMMSDGLPPGSKAQYAGFTLVLDTQDVNEGQRW
                     FDNLADGGNIEMAWQETFWAHGFGKVTDKYGVPWMINVVKQQQSS"
     misc_feature    complement(371567..372007)
                     /locus_tag="ECL_00363"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10148"
                     /db_xref="CDD:236656"
     misc_feature    complement(order(371597..371599,371627..371629,
                     371714..371716,371726..371728,371732..371749,
                     371795..371797,371804..371809,371984..372001))
                     /locus_tag="ECL_00363"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:319899"
     gene            complement(372088..372423)
                     /gene="phnA"
                     /locus_tag="ECL_00364"
                     /db_xref="GeneID:9122873"
     CDS             complement(372088..372423)
                     /gene="phnA"
                     /locus_tag="ECL_00364"
                     /codon_start=1
                     /transl_table=11
                     /product="alkylphosphonate utilization operon protein
                     PhnA"
                     /protein_id="YP_003610879.1"
                     /db_xref="GeneID:9122873"
                     /translation="MQLPHCPKCNSEYTYEDNGMFICPECAHEWNDAEPSQDADVLIV
                     KDANGNLLADGDSVTVVKDLKVKGSSSMLKIGTKVKNIRLVEGDHNIDCKIDGFGPMK
                     LKSEFVKKN"
     misc_feature    complement(372091..372423)
                     /gene="phnA"
                     /locus_tag="ECL_00364"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10220"
                     /db_xref="CDD:182315"
     gene            373024..375378
                     /locus_tag="ECL_00365"
                     /db_xref="GeneID:9122874"
     CDS             373024..375378
                     /locus_tag="ECL_00365"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610880.1"
                     /db_xref="GeneID:9122874"
                     /translation="MHTQTIFELSQEAERLLQLALQNLDTLKSMPIAMLESTATAITG
                     EKNNVLPLHFSARGVEAQQAMLNSELRKITRLEMVLAIVGTMKAGKSTTINAIVGTEV
                     LPNRNRPMTALPTLIRHTPGQKEPVLHFTHVSPIDDLIQLLQKKLCDDDRGKLAQRLE
                     IDKDMNTLLERIERGEAFEKHHLGAQPIFHCLKSLNDLVRLSQALDVAFPFSEYAAIE
                     HIPVIEVEFVHLAGLDAHLGQLTLLDTPGPNEAGQPHLQKMLTEQLSRASAVLAVMDY
                     TQLKSISDEEVRQAISVAGKSVPLYALVNKFDQKDRNSDDEEQVRAMISGTLMKGNIS
                     PGQIYPVSSMWAYLANRARYEMANHGQLPDHQEQRWVQDFAEAALGRRWRTADLDDIE
                     HIRHAADLLWEDSLFEQPIRKLIYAAYANASLFALRSASHKLLNYAQNAREYLDFRYQ
                     ALTVAFESLELNITRLEEDMALLQTRQRVASEEVKHEVEQALHATDDFMALQKGALQQ
                     AIGHIFNSHTLLDLAGIDPLNHRQDAPEALTQLVLDDERQAQTVLNSIRSACEQVMLD
                     AQTKISRELALRFDQLESTLARSLNEAMRPIELRIKEQLSHAGFRARISFPAFQANQL
                     NFNTRALFTDAIAEDTRPAGQPSAAGSVRETVSRWLNNPGWGWEDYVATRTRYVIDIA
                     QLHDKFMQHIDQFCEQIRKALTAQVDVSVTAGMATFFAEFSLCLAGLQESLRDSLAVR
                     QQNEHSTRSLSQLLKQSITTATWIQEDTRLLRDDIQTLFAAEQP"
     misc_feature    373024..375372
                     /locus_tag="ECL_00365"
                     /note="hypothetical protein; Provisional; Region:
                     PRK09866"
                     /db_xref="CDD:182123"
     misc_feature    373687..373689
                     /locus_tag="ECL_00365"
                     /note="G2 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    373699..373707
                     /locus_tag="ECL_00365"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206648"
     misc_feature    373753..373764
                     /locus_tag="ECL_00365"
                     /note="G3 box; other site"
                     /db_xref="CDD:206648"
     misc_feature    order(373759..373764,373825..373830)
                     /locus_tag="ECL_00365"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206648"
     misc_feature    373936..373947
                     /locus_tag="ECL_00365"
                     /note="G4 box; other site"
                     /db_xref="CDD:206648"
     gene            375435..376250
                     /locus_tag="ECL_00366"
                     /db_xref="GeneID:9122875"
     CDS             375435..376250
                     /locus_tag="ECL_00366"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610881.1"
                     /db_xref="GeneID:9122875"
                     /translation="MVDLVQGVDAPRHTHLGPQQLQFRERLTQEIMTHTRLRPWAMAG
                     MLNENAALRLGLAEKLAGMLDPGHLALTRMADKLVALRQQTSLRTQPSPGLVQQYAEL
                     SSHFLQRAAYKEKALSQRGLTVQAGDHSEQIFTRWRAGHYDGWSLAGRCYIVLEELRW
                     GAFGDACRLANADVAAMLKDNLRSMAANYLAQGINASPTTRHFYHQWLTTPSTPGSID
                     HKDMLGWLGDWCQADSHPVSWSVTQNWQTVALGMPRLCSAKRLVDGMVEEIFG"
     misc_feature    375435..376244
                     /locus_tag="ECL_00366"
                     /note="YjcZ-like protein; Region: YjcZ; pfam13990"
                     /db_xref="CDD:316504"
     gene            complement(376294..377286)
                     /locus_tag="ECL_00367"
                     /db_xref="GeneID:9122876"
     CDS             complement(376294..377286)
                     /locus_tag="ECL_00367"
                     /codon_start=1
                     /transl_table=11
                     /product="2-keto-3-deoxygluconate transporter"
                     /protein_id="YP_003610882.1"
                     /db_xref="GeneID:9122876"
                     /translation="MKIKATIERIPGGMMLVPLVLGAILNTLAPDTGAYFGGFTKGMI
                     TGTVPILAVWFFCIGASINLRATGTVLRKSGTLVITKIAVAWVVAMVCALFIPENGIQ
                     TGFFAGLSVLAIVSAMDMTNGGLYASLMNQYGTKEESGAFVLMSLESGPLMTMLILGS
                     AGLASFEPHHFVGAILPFLIGFALGNLDHDLRDFFSKATPVLIPFFGFALGNTINLKV
                     ILDTGLLGIVLGVAVIIITGIPLIIADRVIGGGNGTAGVAASSAAGAAVANPVIIAQI
                     NPAFEPVAASATALVAASVIVTAILVPIITALYAKRFGNLPEPDTEPKAVELHH"
     misc_feature    complement(376315..377286)
                     /locus_tag="ECL_00367"
                     /note="2-keto-3-deoxygluconate permease; Provisional;
                     Region: PRK05274"
                     /db_xref="CDD:235384"
     gene            377936..379438
                     /locus_tag="ECL_00368"
                     /db_xref="GeneID:9122877"
     CDS             377936..379438
                     /locus_tag="ECL_00368"
                     /codon_start=1
                     /transl_table=11
                     /product="proline/glycine betaine transporter"
                     /protein_id="YP_003610883.1"
                     /db_xref="GeneID:9122877"
                     /translation="MLRRKKIKPITLRDVTIIDDAKLRKAITAASLGNAMEWFDFGVY
                     GFVAYALGKVFFPGADPSLQMIAALGTFSVPFLIRPLGGLFFGMLGDKYGRQKILAIT
                     IVIMSISTFCIGLIPSYASIGIWAPILLLLCKMAQGFSVGGEYTGASIFVAEYSPDRK
                     RGFMGSWLDFGSIAGFVMGAGVVVLISTVVGEANFLEWGWRIPFFLALPLGIIGLYLR
                     HALEETPAFQQHVDKLEQGDREGLQDGPKVSFKEIATKHWRSLLVCIGLVISTNVTYY
                     MLLTYMPSYLSHNLHYSEDHGVLIIIAIMVGMLFVQPIMGLLSDRFGRRPFIILGSVA
                     LFALAIPAFILINSNVLGLIFAGLLMLAVILNCFIGVMASTLPAMFPTHIRYSALAAA
                     FNISVLIAGLTPTLAASLVESTQNLMMPAYYLMVIAVIGLITGITMKETANRPLKGAT
                     PAASDIQEAKEILREHYDNVEQKIEDIDAEIEELQKKRSRLVDQHPRINE"
     misc_feature    377963..379432
                     /locus_tag="ECL_00368"
                     /note="proline/glycine betaine transporter; Provisional;
                     Region: PRK10642"
                     /db_xref="CDD:182611"
     gene            complement(379472..380374)
                     /locus_tag="ECL_00369"
                     /db_xref="GeneID:9122878"
     CDS             complement(379472..380374)
                     /locus_tag="ECL_00369"
                     /codon_start=1
                     /transl_table=11
                     /product="high-affinity nickel-transporter"
                     /protein_id="YP_003610884.1"
                     /db_xref="GeneID:9122878"
                     /translation="MTLLLLIAGFTLHAHWGAFIQWCLATQITLHRYLVMYLLQLNNH
                     QYSGGLWLLTGAFFYGVLHAIGPGHGKFIVTTYLSTNKESELAARVVPFFGSMLQGVS
                     AILFVFILAVGFNLASGDISTSRWYVEKISAVLIGAFGAFIIYQALKSLRPRRMAISA
                     ITPLHQHDEHCGCGHHGVGADLAQGDWKTRLGVILAIGARPCSGAIMILMFSNALGIV
                     TWGMAAVMTMSLGTALSIMGLSLAVRYARERTVAWFGGDTSLKWLVPAVKIAGGIVLI
                     LFATILFLTVIPISANGDYIAAGC"
     misc_feature    complement(379523..380368)
                     /locus_tag="ECL_00369"
                     /note="ABC-type nickel/cobalt efflux system, permease
                     component RcnA [Inorganic ion transport and metabolism];
                     Region: RcnA; COG2215"
                     /db_xref="CDD:225125"
     gene            380924..382468
                     /locus_tag="ECL_16S02"
                     /db_xref="GeneID:9122879"
     rRNA            380924..382468
                     /locus_tag="ECL_16S02"
                     /product="16S ribosomal RNA"
                     /db_xref="GeneID:9122879"
     gene            382534..382610
                     /locus_tag="ECL_tRNA007"
                     /db_xref="GeneID:9127645"
     tRNA            382534..382610
                     /locus_tag="ECL_tRNA007"
                     /product="tRNA-Ile"
                     /db_xref="GeneID:9127645"
     gene            382647..382722
                     /locus_tag="ECL_tRNA008"
                     /db_xref="GeneID:9127675"
     tRNA            382647..382722
                     /locus_tag="ECL_tRNA008"
                     /product="tRNA-Ala"
                     /db_xref="GeneID:9127675"
     gene            382894..385803
                     /locus_tag="ECL_23S02"
                     /db_xref="GeneID:9127676"
     rRNA            382894..385803
                     /locus_tag="ECL_23S02"
                     /product="23S ribosomal RNA"
                     /db_xref="GeneID:9127676"
     gene            385862..385985
                     /locus_tag="ECL_5S02"
                     /db_xref="GeneID:9127653"
     rRNA            385862..385985
                     /locus_tag="ECL_5S02"
                     /product="5S ribosomal RNA"
                     /db_xref="GeneID:9127653"
     gene            386456..386986
                     /locus_tag="ECL_00370"
                     /db_xref="GeneID:9127661"
     CDS             386456..386986
                     /locus_tag="ECL_00370"
                     /codon_start=1
                     /transl_table=11
                     /product="major fimbrial subunit PmfA"
                     /protein_id="YP_003610885.1"
                     /db_xref="GeneID:9127661"
                     /translation="MKLNKVAMAVALTAALSSMSAFADTTNGQIEFQGELVNTACGLA
                     PGSSPVSVDFGQIPVSALANGARAGNVHQNIELQHCDTTVAQTAEVTYSPTSVNPTDA
                     SLAAFTSGTASGAGIGLRDSASQDVVWGNATTPVQLVDGTNTIPFVAYVKAESASATV
                     TAGSFQSTVNFEIAYQ"
     misc_feature    386456..386983
                     /locus_tag="ECL_00370"
                     /note="Pilin (type 1 fimbria component protein) [Cell
                     motility]; Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            387206..389623
                     /locus_tag="ECL_00371"
                     /db_xref="GeneID:9122880"
     CDS             387206..389623
                     /locus_tag="ECL_00371"
                     /codon_start=1
                     /transl_table=11
                     /product="Outer membrane usher protein PmfC"
                     /protein_id="YP_003610886.1"
                     /db_xref="GeneID:9122880"
                     /translation="MSVKLKTNLTIIALLVMNCCYAATARGEERVEFNTDVLDASDRT
                     RIDLSRFATDNYVTPGDYLLDIRINGQSVGQEKIRYVESPEGNRTLPCISGDLLNKLA
                     LKEDARSQIAQIYENCYSLQRLSGAKLSNYAGVLDITVPQAWMKYNDPDWTPPERWDE
                     GIAGLIFDYSINGQLTRQFSDNKNYSAISGYGQAGANIGGWRIRGEYQTSYYSQHHQS
                     SFDWNQIYAYRPLPMMAAKLTLGEIYLNSQVFDTLRFTGINLASDERMLPPALQGYAP
                     EIHGIARSNAKVTVSQSGRVIYETTVPAGPFNIQDLRSSVRGTLDVRVEEQDGSVSLF
                     QVNTASIPYLTRPGYVRYNLSGGTPSRYNHSLKGPTFLSGDFSWGISNAWSLYGGLQS
                     SGEAYTAASLGIGRDLNALGAISLDATESWSREPDGKRLKGTSYKLSYAKTFDEYNSS
                     ITFAGYRFSQEDFRTMAQYLDERYQGYDHVGREKQLYTITGSKTFWAGEAGKATTVFL
                     TWTHQNYWNQRSQDRYGMSVGRAFRVGDINGITANLSAYRTDYKGRKDDSISFSLSVP
                     IGDNKWAGLDVQTNNGKTSPMASYTDNSDFNNLWRVRAGASQNSNASVDGYYLHRSQW
                     AEINTNASYQQNEFMALSTTLRGGFTATRHGAAMHNSGATMNTARVMVDTNGIGGVPL
                     NGEKSRTNRFGIAVVPDVVSYNSFDTRVDVDAMDGDIEPARAISTSTLTEGAIGYQAF
                     GMAKGMKMMGTLRLVDNSVPPFGAEIYNADGVSVAMVLEDGKAWLAGINANETLNVMW
                     GVNSSAK"
     misc_feature    387248..389602
                     /locus_tag="ECL_00371"
                     /note="putative fimbrial outer membrane usher protein
                     StfC; Provisional; Region: PRK15284"
                     /db_xref="CDD:185184"
     misc_feature    387299..387724
                     /locus_tag="ECL_00371"
                     /note="PapC N-terminal domain; Region: PapC_N; pfam13954"
                     /db_xref="CDD:290663"
     misc_feature    387770..389425
                     /locus_tag="ECL_00371"
                     /note="Outer membrane usher protein; Region: Usher;
                     pfam00577"
                     /db_xref="CDD:278974"
     misc_feature    389456..>389602
                     /locus_tag="ECL_00371"
                     /note="PapC C-terminal domain; Region: PapC_C; pfam13953"
                     /db_xref="CDD:290662"
     gene            389751..390464
                     /locus_tag="ECL_00372"
                     /db_xref="GeneID:9122881"
     CDS             389751..390464
                     /locus_tag="ECL_00372"
                     /codon_start=1
                     /transl_table=11
                     /product="Chaperone protein PmfD"
                     /protein_id="YP_003610887.1"
                     /db_xref="GeneID:9122881"
                     /translation="MAACALSLVAGYAQAGVSLDRTRIIITEKESSSSANLSNTSPDI
                     PFLAQSWVEDEKGNKIASPLIVLPPLQRINGGQKGIARVTKTAGIEKLPKDRESLFYL
                     NVREIPPKPEKPNTLQLAMQSRIKLFYRPEAVIPKTKGEVWQDRVVFQKSGSEMTVQN
                     PTPYYVTILSLTKGDGVKITRFPGIMVAPKSSQTFAVTDAGVSQFSMKFVNDYGGHPE
                     LKFRCDGNTCKALPPAQQG"
     misc_feature    389754..390419
                     /locus_tag="ECL_00372"
                     /note="P pilus assembly protein, chaperone PapD
                     [Extracellular structures]; Region: FimC; COG3121"
                     /db_xref="CDD:225663"
     gene            390483..391526
                     /locus_tag="ECL_00373"
                     /db_xref="GeneID:9122882"
     CDS             390483..391526
                     /locus_tag="ECL_00373"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative minor fimbrial subunit PmfE"
                     /protein_id="YP_003610888.1"
                     /db_xref="GeneID:9122882"
                     /translation="MQHPYPYAALLAMCALGFSGAARSVVDGEIKAVNGTYEYLININ
                     NHDITSNQVGAVVIDEFDLAGMFQGRAYCAQPMISQPVYYTSQATLTQSGMTAGYLKL
                     NDYMDVKIEIYIGGNLQQYKTVPFDNVSNNVNQNYCNPPSTILDNQFASGAKGKVTFM
                     ITNPIINGVNLQGSEIATLYGRLGPGAMGQTPLSRVTIASGVITVPDKCIVNQGTPIV
                     VDFGNIPGTGSRLDGINYSQNVPIHVKCQGGSFSQGELNIKLGIQQANPAFSDGKYLS
                     TQGAVDRSELGIALRDSKGNPVVPNTFYNVPGFSHNEGDWNLIAAPVAKNTTSVIPEG
                     EFHASATVVAEFQ"
     misc_feature    390501..391523
                     /locus_tag="ECL_00373"
                     /note="Fimbrial protein; Region: Fimbrial; cl01416"
                     /db_xref="CDD:321493"
     gene            391536..392084
                     /locus_tag="ECL_00374"
                     /db_xref="GeneID:9122883"
     CDS             391536..392084
                     /locus_tag="ECL_00374"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative minor fimbrial subunit PmfF"
                     /protein_id="YP_003610889.1"
                     /db_xref="GeneID:9122883"
                     /translation="MHRMIIILTCYLTVFAAAPAWARGELIGGDLSFKGVVMAYPCSI
                     APESGRILVDFGEISTKSLYIKGKTTPVPFAIKLQDCNPNVFNAVTVTFSGIANANMA
                     DRLAINATAPGNAGGVGIGLLEEDDTPVRLNVATRPTLINDTLLRLSFQAFVEAEPDA
                     VASGTLTTGPFTATAHYTLDYQ"
     misc_feature    391536..392081
                     /locus_tag="ECL_00374"
                     /note="Pilin (type 1 fimbria component protein) [Cell
                     motility]; Region: FimA; COG3539"
                     /db_xref="CDD:226069"
     gene            392108..392767
                     /locus_tag="ECL_00375"
                     /db_xref="GeneID:9122884"
     CDS             392108..392767
                     /locus_tag="ECL_00375"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610890.1"
                     /db_xref="GeneID:9122884"
                     /translation="MRYQFFLYDKNIFYSQGIKMVITSLLAEQADVLYSLTDDYDQLL
                     VQLQRQVNDEGCMWILCDLDSLPRERLHTLQLMKEFYQQENKNLIILLSKHNMPLFFA
                     LYSLLPTAHWLLKTENMESITPFFQRLLDKTRQGCCFSASLVNYTKKKLYDRSVEPTI
                     SGSEWWLMEELFKGKSLSQISDEVNVDIRRLSYIKRHLMKRLNIRSNIALFSAFRGIM
                     P"
     misc_feature    <392318..392743
                     /locus_tag="ECL_00375"
                     /note="DNA-binding response regulator, NarL/FixJ family,
                     contains REC and HTH domains [Signal transduction
                     mechanisms, Transcription]; Region: CitB; cl28474"
                     /db_xref="CDD:333294"
     misc_feature    392597..392737
                     /locus_tag="ECL_00375"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     gene            392857..393057
                     /locus_tag="ECL_00376"
                     /db_xref="GeneID:9122885"
     CDS             392857..393057
                     /locus_tag="ECL_00376"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610891.1"
                     /db_xref="GeneID:9122885"
                     /translation="MKKLTAFEAARIVGGTCKTCEITYQNVTVGGVTSCKQITTCTDK
                     HGCTTTMRDADSSKCGGIPNRY"
     misc_feature    392857..393048
                     /locus_tag="ECL_00376"
                     /note="Domain of unknown function (DUF4762); Region:
                     DUF4762; pfam15959"
                     /db_xref="CDD:318224"
     gene            393277..393789
                     /locus_tag="ECL_00377"
                     /db_xref="GeneID:9122886"
     CDS             393277..393789
                     /locus_tag="ECL_00377"
                     /codon_start=1
                     /transl_table=11
                     /product="Thiol:disulfide interchange protein DsbA"
                     /protein_id="YP_003610892.1"
                     /db_xref="GeneID:9122886"
                     /translation="MQANSPIKNDRSIIEVMSYGCHYCAANEENLAEFSRTLPPDSTF
                     TSIHIADEDNGLAAYAPLFATLEAMGIEKQIRDSAYNAIITRNVDLTDEKKLNGWLVK
                     NNIDVVKFNTFRLSKAVKERLSEMAAITAYYDINATPMFIINKRYVVAQDREFPAFAQ
                     RIRELLEEDK"
     misc_feature    393286..393723
                     /locus_tag="ECL_00377"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:320948"
     gene            393824..394750
                     /locus_tag="ECL_00378"
                     /db_xref="GeneID:9122887"
     CDS             393824..394750
                     /locus_tag="ECL_00378"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ABC transporter protein"
                     /protein_id="YP_003610893.1"
                     /db_xref="GeneID:9122887"
                     /translation="MSFKNSTGKIEDIQQRLTQCGVFFLRKIVRVVPLPVTLTVAKGL
                     CATRLFGRAFRLRNAVANENVRCLTGQKVRLNVAWLTVRRRLLEEAATWAQKPALLQQ
                     MRTCAAELNAVVTPLYEQNAPYILAPLHTVSDVLAAIIGASVTPGKASVVVSSSAELY
                     SAPARAFGGVALDYCSIHQENKTLASNLMDLITDVAAGQRNMIIFPDITPDYTSQAEG
                     MLVAKQPCRLFGRSARLHGGLVRLSGAIAAQVVFYHLSYDNRLHIHIHPPVSSQHVAS
                     ALPDIIESTLQASPQEWLLWHSHSLYFINHSR"
     gene            394753..396867
                     /locus_tag="ECL_00379"
                     /db_xref="GeneID:9122888"
     CDS             394753..396867
                     /locus_tag="ECL_00379"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003610894.1"
                     /db_xref="GeneID:9122888"
                     /translation="MKNTIPNLIFQEETNECGLACVAMLAQTQGQTISLETLRDIFPA
                     SDHGTSLDTLMAILARLGIATAPVLFEHHELSELPLPAILHYGASHYVLLAWRKGNHV
                     CVMNPAIGEQWLPFAALKQEISGYALIVEPEQRLAADPALARPTAGQSMPRVMSMKET
                     ADVPGIYRLMLLTFMVSLTLFLMPTMVSSAINKAFSSVESSGFPYGWFILAFVVSSLM
                     ALGVRAIAERYIKRFVLIHSGVGFSRMLQNPLRFFEKRAPGEIFSRFTAWQMGLLQKI
                     ELDNGLRSDWVIGAIALAIMFWIAPILAAISAIGVTVMGIISVWAVIRDRWFTQQLQL
                     KSAALNDFFMETLQGILTVKTAGLEGQRQAQFAALSRELYTCLQRQKVYQQVKEGLYQ
                     LCGSLEMVAFMLVVLPMVHGKQISLGDFFAYSFLRQIFTSYVTRIFYAIIQKTQLHVI
                     DTRAHALFAPGGERAPAPLIAVPTADTTPALAFEALGYGYDPAVPVLSSVSLSLPAGE
                     QIAIVGESGAGKSTLLRLIAGLFSPQAGGCYAAGRALPAAHLAQYVCLQSQEDILFNA
                     SVRENITLFDAHYRERDRGRIEALLDALMLGDVVRALPGGLDALIRESHAALSLGQRQ
                     RLLLARALYSSRPVLLLDEPTANLDDETAAIVMATVHAHCRRAGKSLIVVTHSEQVLS
                     GFQQVYHLVDGRLSLREGSDEA"
     misc_feature    394771..396861
                     /locus_tag="ECL_00379"
                     /note="ABC-type bacteriocin/lantibiotic exporters, contain
                     an N-terminal double-glycine peptidase domain [Defense
                     mechanisms]; Region: SunT; cl26602"
                     /db_xref="CDD:331423"
     gene            396857..398008
                     /locus_tag="ECL_00380"
                     /db_xref="GeneID:9122889"
     CDS             396857..398008
                     /locus_tag="ECL_00380"
                     /codon_start=1
                     /transl_table=11
                     /product="Macrolide-specific efflux protein"
                     /protein_id="YP_003610895.1"
                     /db_xref="GeneID:9122889"
                     /translation="MKHKSRWVMLGCGLAFVAAMAGVWVSMASPSPHTRLPVDTVGTG
                     DIEKVVLVTGILKPAVQVNVGAQVNGQLRKLYVRQGERVKKGQLLAEIDPTLQESELR
                     NTKAQLASARAQKRSAQAMLLRYRQELDRQRLMQRDGSGVRSEFEQARSQYAVQVQQI
                     AVSEAQIAQAEMAVKTAQANLSYTRIVAPVDGEVLGIVTREGQTIVSSQTAPTILVLA
                     DLDTMQVQTRISEADVQKIHPGQPLSFYVIANPDKRYASTMGYVQPAPQDAMEASGER
                     GMGGNAQAMAVYYTGTFEVPNAGRELKTSMTAQVFIQIARASNVLRVPVAALGQAQDA
                     DRYTITTVKDGNTQSRTIRIGIQDRQYAEVLEGLQAGEQVVLEQETERG"
     misc_feature    396857..397984
                     /locus_tag="ECL_00380"
                     /note="HlyD membrane-fusion protein of T1SS; Region: HlyD;
                     cl25633"
                     /db_xref="CDD:330454"
     gene            398012..399943
                     /locus_tag="ECL_00381"
                     /db_xref="GeneID:9122890"
     CDS             398012..399943
                     /locus_tag="ECL_00381"
                     /codon_start=1
                     /transl_table=11
                     /product="Macrolide-specific ABC-type efflux carrier"
                     /protein_id="YP_003610896.1"
                     /db_xref="GeneID:9122890"
                     /translation="MEPIIVLRRVCRRFHAGTQTLAVLSDISLTFHRGEMVAIVGASG
                     SGKSTLMNIIGCLDKPTSGEVLINGTPVHNADSLYLADLRSRYLGFIFQRYHLMPYLT
                     AEENIAIPALYTAMSEQERTVRVQRLAVQLGLENRLQHRPAELSGGQQQRVSICRALI
                     NGAHIILADEPTGALDSTRGKALMGVLHQLHASGHTVIIVTHDRDIARQAQRIIEISD
                     GRIISDVRHAEVHPSTLLPEQDNGRASLVSRFRESVRMAWRALLGHRMRAFLSMLGII
                     IGIASVVSSMAVGEGARRAIVDEIGKLGNTTLEIRPGTGWGNARPDMARALSMEDVRS
                     LQALPWVMGVSPVVSSTALAVRKGLDSSMMLSGVSQDFFTLQGLRVVQGNGFTARDVA
                     EGEPVMILDETGRDTLFPGGENPLGALVQIAGAPWRVIGVATRPGPKVVGGFMAAWVP
                     HTALQQRLTGQIPLESLVLRFQPPLTSQEAAQRVERHLLREHGRKDFFIQTDDRLANA
                     MQKTSDSMSLLITAIAAISLLVGGVGVMNIMLVSVTERTHEIGIRLSVGARPADIMNQ
                     FLIEAVMICVLGGLVGVSGAWLAGHIFAFVTDAFSMVFTVFPVLMACGFSAAIGLTFG
                     YFPARSAARLSPTEALARE"
     misc_feature    398012..399940
                     /locus_tag="ECL_00381"
                     /note="macrolide transporter ATP-binding /permease
                     protein; Provisional; Region: PRK10535; cl28180"
                     /db_xref="CDD:333000"
     gene            399994..401322
                     /locus_tag="ECL_00382"
                     /db_xref="GeneID:9122891"
     CDS             399994..401322
                     /locus_tag="ECL_00382"
                     /codon_start=1
                     /transl_table=11
                     /product="Putative RND efflux system, outer membrane
                     lipoprotein"
                     /protein_id="YP_003610897.1"
                     /db_xref="GeneID:9122891"
                     /translation="MTRSDYQRPLLSLPTQWPTMAEKGTENGWRFSDPRLSRVIEQVL
                     ESNNDLAAAALTLQQARVAAGLTSTNISPDVRVSGAASNSKNVRRGAPPQENYSGSVA
                     IAWELDLWGKLARTREQSEWQARASEQDYRATVLSTMGLTAQLYWRIALYNQQIRHQR
                     DGLTVSEQTVQQVSSWFNAGKVGQLDVLQAQQALLARQNQLRTLIQQRQNTRSALALM
                     LNRPAEQHADELRELDVHQQVPVAQKTPLRVIAQRPDIQAAESRLRAALAGYDAARLQ
                     FYPTLSLDASLNAGSQVFSQWFRDPIRTTGAALALPFIQWNTRQLTVAQADLAIKQAA
                     IAFRSTAYTALAEVDEAMENRLSADEQRSRLHQSLALSQRRLSLTESRYRAGAVDFQT
                     LLNAQDDLLNTENALAQTQYDYLYATLQLWLAQGGDTQNRMIKDEAEKWR"
     misc_feature    399994..401289
                     /locus_tag="ECL_00382"
                     /note="Outer membrane protein TolC [Cell
                     wall/membrane/envelope biogenesis]; Region: TolC; COG1538"
                     /db_xref="CDD:224455"
     gene            401300..402553
                     /locus_tag="ECL_00383"
                     /db_xref="GeneID:9122892"
     CDS             401300..402553
                     /locus_tag="ECL_00383"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP synthase"
                     /protein_id="YP_003610898.1"
                     /db_xref="GeneID:9122892"
                     /translation="MKLKNGDNRVVVTGYGAVTPLGVTADESWQAIMDYRLGYRYVDY
                     TARNIKTHFLGLVDNEPSLIGVPAAVRRRLPRFARLTFGAARQAMAMAFGGQPPQEFY
                     SPLDCGAIMGTGWGGLDESYDAQSDFSATGFASPFNCFYSMPSVTTAACSQFWGLNGF
                     QNTVVAACATGTIAIGEAYEVIRTGRAQMMLAGAGESLTSPCAIWNIDVLGALSKETQ
                     DPQRASCPFSAHRNGFVLSEGAAVLCLESREGALARGATILGEITGYANFSDAWDFTS
                     PAEDCLARVQTIISALRQAGLEPEHLDYINAHGTSTPLNDINETQSLKMALGEAVWTV
                     PISSTKSYSGHLISAAGAFESIVCLQAIANGIIPATTNFQHADECCDLDYVVEGHRHA
                     TIRRTLNLSFGFGGANAALILEKHS"
     misc_feature    401321..402538
                     /locus_tag="ECL_00383"
                     /note="Beta-ketoacyl-acyl carrier protein (ACP) synthase
                     (KAS), type I and II. KASs are responsible for the
                     elongation steps in fatty acid biosynthesis. KASIII
                     catalyses the initial condensation and KAS I and II
                     catalyze further elongation steps by Claisen...; Region:
                     KAS_I_II; cd00834"
                     /db_xref="CDD:238430"
     misc_feature    order(401639..401641,401660..401665,401675..401677,
                     401681..401686,401714..401716,401732..401734,
                     401744..401746,401756..401758,401774..401776,
                     401780..401782,401786..401794,401828..401830,
                     401837..401842,401849..401851,401912..401917,
                     401924..401929,402101..402115,402155..402157,
                     402512..402514,402518..402520)
                     /locus_tag="ECL_00383"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238430"
     misc_feature    order(401801..401803,402221..402223,402332..402334)
                     /locus_tag="ECL_00383"
                     /note="active site"
                     /db_xref="CDD:238430"
     gene            402550..403353
                     /locus_tag="ECL_00384"
                     /db_xref="GeneID:9122893"
     CDS             402550..403353
                     /locus_tag="ECL_00384"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610899.1"
                     /db_xref="GeneID:9122893"
                     /translation="MMTLRYSQQDARLWAAFSGDYNPVHFDKAWVKSQGGSRLSVHGM
                     RALLDVKRFISPEVRRSSFLKCTVRLRRPLWRDTTYLLMCDPNKPVSASVYDLTAQTV
                     CLSCAIAPVNLFAVAEAESQRELGASTIAALHQTFLPLLPHAQQWHFLDALLFRHLLQ
                     DTALLHQKDIAPLIPSGHTLEALFTRYPVVQTHQEVVFDSHLLAPWQTVPLPEPLEIE
                     TLPATVVGDLRYGAVVRIAAQTRYQQHYISSAVTLKVGPLTKGNANELV"
     misc_feature    402562..>402681
                     /locus_tag="ECL_00384"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:321012"
     gene            403340..403591
                     /locus_tag="ECL_00385"
                     /db_xref="GeneID:9122894"
     CDS             403340..403591
                     /locus_tag="ECL_00385"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610900.1"
                     /db_xref="GeneID:9122894"
                     /translation="MNSYEIIYSKISEMIADAKDLPLEALTPDTTLPQLELDSLDYVE
                     LMVLAKREFNVTLTAEMFMKKPHMTLRDLSLYIDQEMAG"
     misc_feature    403364..403570
                     /locus_tag="ECL_00385"
                     /note="Phosphopantetheine attachment site; Region:
                     PP-binding; pfam00550"
                     /db_xref="CDD:306928"
     gene            403608..404330
                     /locus_tag="ECL_00386"
                     /db_xref="GeneID:9122895"
     CDS             403608..404330
                     /locus_tag="ECL_00386"
                     /codon_start=1
                     /transl_table=11
                     /product="3-oxoacyl-ACP reductase"
                     /protein_id="YP_003610901.1"
                     /db_xref="GeneID:9122895"
                     /translation="MLITGGSRGIGQALVSHLLPEWNIVFTGRNEAGIGRTLAQAKGL
                     RTATWVKGYRCDGRDEADVQRLATSLLDEFGAPAAIVHNAGMTRDALHIHQTARDWQD
                     VLTNNLVALVNWNRTLLPAMMMQGSGAVVLMSSVTAIKGNSGQTAYAASKAAMIGLTR
                     SLAQEMGRFGIRVNCLAPGLIEGEMVEAIPEARLKAMRQSIPLRRLGQTQDVAHAVAF
                     LAGEGSRYLTGQTLVLDGGLSA"
     misc_feature    403611..404321
                     /locus_tag="ECL_00386"
                     /note="Short-chain dehydrogenases/reductases (SDR);
                     Region: SDR; cl25409"
                     /db_xref="CDD:330230"
     misc_feature    order(403620..403622,403626..403631,403635..403637,
                     403689..403697,403854..403862,404004..404012,
                     404049..404051,404061..404063,404139..404150)
                     /locus_tag="ECL_00386"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(403926..403928,404010..404012,404049..404051,
                     404061..404063)
                     /locus_tag="ECL_00386"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(404367..405539)
                     /locus_tag="ECL_00387"
                     /db_xref="GeneID:9122896"
     CDS             complement(404367..405539)
                     /locus_tag="ECL_00387"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610902.1"
                     /db_xref="GeneID:9122896"
                     /translation="MNINLIESLACISKIIDMINPRLNLHHVRTAYIAWLLARESQFT
                     PAQCRKTLLAALLHDIGGLNEESRLQPMSYYDNELNNHAAVGAELLASVPLLNPLNAI
                     VRYHHTHWNNGRGACVNGIKTPKESHIIYLADRLDVLISHYRASDIITAQEEIIKIIV
                     SGENDLFQPDYIHAFQRVASRDHFWLRIQSTEFDDYIKEIPRIHNDPLSLHNFRDIAG
                     MLAFIIDGFSQHGVQHSLVVGRISGYLAREMGIPPVQCLKIEIGGLLHNLPSLALCAT
                     PAQTDEGKAVWDELYPIEAIRDIAGWCQLQKSVDAKSAYPPEVTIIKASIWLASLLQG
                     VTLSSEFKARVGETAEIAPALAGVVQQHSAILLQIFHESVKERRALVQRINQLTLS"
     misc_feature    complement(405000..>405464)
                     /locus_tag="ECL_00387"
                     /note="Domain of unknown function (DUF3391); Region:
                     DUF3391; cl26425"
                     /db_xref="CDD:331246"
     misc_feature    complement(<404652..404963)
                     /locus_tag="ECL_00387"
                     /note="HD superfamily phosphodieaserase, includes HD
                     domain of RNase Y [Translation, ribosomal structure and
                     biogenesis, General function prediction only]; Region:
                     RnaY; COG1418"
                     /db_xref="CDD:224336"
     gene            complement(405591..406001)
                     /locus_tag="ECL_00388"
                     /db_xref="GeneID:9122897"
     CDS             complement(405591..406001)
                     /locus_tag="ECL_00388"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610903.1"
                     /db_xref="GeneID:9122897"
                     /translation="MYSFTSPAVFSCESQFSVVQNINGKSVHAEGLIFINMANDHILM
                     NIDGLLSHDNKNQLISRTLKIKYKKFNPSANLYQVTSVRTLRDSTDNIDDTVAINLLF
                     GKGPDDKIIYLNKLNNNTLLFGNHTFPQYGCKRK"
     gene            complement(407634..407712)
                     /locus_tag="ECL_tRNA009"
                     /db_xref="GeneID:9122898"
     tRNA            complement(407634..407712)
                     /locus_tag="ECL_tRNA009"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:9122898"
     gene            complement(408385..409197)
                     /locus_tag="ECL_00389"
                     /db_xref="GeneID:9127677"
     CDS             complement(408385..409197)
                     /locus_tag="ECL_00389"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_003610904.1"
                     /db_xref="GeneID:9127677"
                     /translation="MLDVHPSGFYAWLQQPHSQRHQADLRLTGQIKQFWLESGCVYGY
                     RKIHLDLRDSGQQCGVNRVWRLMKRVGIKAQVGYRSPRARKGEASIVSPNRLQRQFNP
                     DAPDKRWVTDITYIRTHEGWLYLAVVVDLFSRKIIGWSMQSRMTKDIVLNALLMAVWR
                     RNPQKQVLVHSDQGSQYTSHEWQSFLKSHGLEGSMSRRGNCHDNAVAESFFQLLKRER
                     IKKKSYGTREEARSDIFDYIEMFYNSKRRHGSSDQMSPTEYENQYYQRLGSV"
     misc_feature    complement(408391..409194)
                     /locus_tag="ECL_00389"
                     /note="HTH-like domain; Region: HTH_21; cl26233"
                     /db_xref="CDD:331054"
     gene            complement(409254..409532)
                     /locus_tag="ECL_00390"
                     /db_xref="GeneID:9122899"
     CDS             complement(409254..409532)
                     /locus_tag="ECL_00390"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_003610905.1"
                     /db_xref="GeneID:9122899"
                     /translation="MSGKRYPEEFKTEAVKQVVDRGYSVASVATRLDITTHSLYAWIK
                     KYGPDSSANKEQSDAQAEIRRLQKELKRVTDERDILKKAAAYFAKLSD"
     misc_feature    complement(409266..409532)
                     /locus_tag="ECL_00390"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            409807..410283
                     /locus_tag="ECL_00391"
                     /db_xref="GeneID:9122900"
     CDS             409807..410283
                     /locus_tag="ECL_00391"
                     /codon_start=1
                     /transl_table=11
                     /product="IS5 transposase"
                     /protein_id="YP_003610906.1"
                     /db_xref="GeneID:9122900"
                     /translation="MSHQLTFADSEFSSKRRQTRKEIFLSRMEQILPWQNMVEVIEPF
                     YPKAGNGRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDR
                     TTIMNFRHLLEQHQLARQLFKTINRWLAEAGVMMTQGTLVDATIIEAPSSTKNKEQ"
     misc_feature    409957..410172
                     /locus_tag="ECL_00391"
                     /note="Transposase domain (DUF772); Region: DUF772;
                     pfam05598"
                     /db_xref="CDD:283292"
     misc_feature    409993..>410232
                     /locus_tag="ECL_00391"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [Mobilome: prophages, transposons]; Region: IS5; COG3039"
                     /db_xref="CDD:225581"
     gene            410296..410787
                     /locus_tag="ECL_00392"
                     /db_xref="GeneID:9122901"
     CDS             410296..410787
                     /locus_tag="ECL_00392"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_003610907.1"
                     /db_xref="GeneID:9122901"
                     /translation="MHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLG
                     NLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERSGKVRTLKQHPRKNKTAINIE
                     YMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANLFRADQMIRQWE
                     RSH"
     misc_feature    <410296..410772
                     /locus_tag="ECL_00392"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [Mobilome: prophages, transposons]; Region: IS5; COG3039"
                     /db_xref="CDD:225581"
     misc_feature    <410536..410748
                     /locus_tag="ECL_00392"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:290469"
     gene            410999..412246
                     /locus_tag="ECL_00393"
                     /db_xref="GeneID:9122902"
     CDS             410999..412246
                     /locus_tag="ECL_00393"
                     /codon_start=1
                     /transl_table=11
                     /product="PAS/PAC sensor-containing diguanylate cyclase"
                     /protein_id="YP_003610908.1"
                     /db_xref="GeneID:9122902"
                     /translation="MGSSELSLLQMAVMQSWNAVVITSADRAAGYPVKIANPAFCQMT
                     GYAIDELYGQSLKMLQGPATDQEVINRLRNCLSSGEYFEGMTTNYRKDGLPYLVRWNI
                     SPVRDEEGDITHFVSVQQDMTAYAKVEETSKILGQALDAAAQPILVTDAQAKIIFANQ
                     AFCQVSDYEESELIGNTPSLFKSGLQDDDFYKNVKASLMTAKTFQAIFINKRKDGTLY
                     HSEQSISAIKDHAGNITNYVSVGKDVTERLREEQALRESATVDQLTGLFNRNHGKALL
                     SEAYSFTLSREEPMSLILCDIDHFKQINDSFGHPVGDQILAQVSGLLRKSVRGNDRVI
                     RWGGEEFLILLENCTDMVAAELAERLRLRIASEQFQNVGKVTVSLGVASLFQKESLEQ
                     LISRCDEALYKSKRNGRNQLTLA"
     misc_feature    411020..>411472
                     /locus_tag="ECL_00393"
                     /note="bacterio-opsin activator; Provisional; Region:
                     PRK13558; cl25987"
                     /db_xref="CDD:330808"
     misc_feature    <411266..>412240
                     /locus_tag="ECL_00393"
                     /note="Predicted signal transduction protein containing a
                     membrane domain, an EAL and a GGDEF domain [Signal
                     transduction mechanisms]; Region: COG5001; cl25447"
                     /db_xref="CDD:330268"
     misc_feature    411779..412231
                     /locus_tag="ECL_00393"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(411884..411886,412013..412015)
                     /locus_tag="ECL_00393"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(411899..411901,411908..411913,411923..411925,
                     411935..411937,412001..412003,412007..412018)
                     /locus_tag="ECL_00393"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(411989..411991,412073..412075)
                     /locus_tag="ECL_00393"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            complement(412296..413129)
                     /locus_tag="ECL_00394"
                     /db_xref="GeneID:9122903"
     CDS             complement(412296..413129)
                     /locus_tag="ECL_00394"
                     /codon_start=1
                     /transl_table=11
                     /product="putative IS3 family transposase orfB"
                     /protein_id="YP_003610909.1"
                     /db_xref="GeneID:9122903"
                     /translation="MMLMCDATGLSQRRACRLTGLSLSTCRYEAHRPAADAHLSGRIT
                     ELALERRRFGYRRIWQLLRREGLHVNHKRVYRLYHLSGLGVKRRRRRKGLATERLPLL
                     RPAAPNLTWSMDFVMDALSTGRRIKCLTCVDDFTKECLTVTVAFGISGVQVTRILDSI
                     ALFRGYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDE
                     CLNEHWFSDIVHARKIINDWRQDYNECRPHSTLNYQTPSEFAAGWRKGHSENEDSDVT
                     N"
     misc_feature    complement(412881..413006)
                     /locus_tag="ECL_00394"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:315857"
     misc_feature    complement(412473..412811)
                     /locus_tag="ECL_00394"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:307008"
     misc_feature    complement(412362..412562)
                     /locus_tag="ECL_00394"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:316225"
     gene            complement(413153..413416)
                     /locus_tag="ECL_00395"
                     /db_xref="GeneID:9122904"
     CDS             complement(413153..413416)
                     /locus_tag="ECL_00395"
                     /codon_start=1
                     /transl_table=11
                     /product="putative IS3 family transposase orfA"
                     /protein_id="YP_003610910.1"
                     /db_xref="GeneID:9122904"
                     /translation="MKKRFSDEQIISILREAEAGVPARELCRKHAISDATFYTWRKKY
                     GSMEVPEVKRLKSLEEENARLKKLLAEAMLDKEALQVALGRKY"
     misc_feature    complement(413207..413413)
                     /locus_tag="ECL_00395"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:307599"
     gene            complement(413466..414662)
                     /locus_tag="ECL_00396"
                     /db_xref="GeneID:9122905"
     CDS             complement(413466..414662)
                     /locus_tag="ECL_00396"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integrase"
                     /protein_id="YP_003610911.1"
                     /db_xref="GeneID:9122905"
                     /translation="MSSPKRFRFTNQLIKSLPPNTSDARSTDAEYSDTEISGLKCLVS
                     RREGRKKFLLRYLYHGRKRAIAIGHWPEVDVNLARQIAIEHKRSLATGTDPKQERENK
                     RMELTFDELFNQHYLPWAKSAKRSWGKDVQRYRDHIRPAIGQRLLSDITPASILRLQQ
                     TLSTSLSAATCNRVIVLIKAVFTWAGRQSMTSVHPARVVQLLRENNARQRYFTEDEIR
                     RIFLSADNDTSPVAARYVKLLLLTGLRRDELRLAKWEHVDPVKRTLWLPETKNGYGRI
                     VHLNSLAMDVIRTLPTQRGNPWLFIGKKQGMPLSNPVKAFQRIVRRAGIFDKEVCIHT
                     CRHSVAALIVSYGGTLYDVQAQLGHRSSQSSQRYAHLHPQRLQNTSQLLAERITAQLP
                     DLLPVD"
     misc_feature    complement(414381..414638)
                     /locus_tag="ECL_00396"
                     /note="Domain of unknown function (DUF4102); Region:
                     DUF4102; pfam13356"
                     /db_xref="CDD:315922"
     misc_feature    complement(413553..414041)
                     /locus_tag="ECL_00396"
                     /note="Shufflon-specific DNA recombinase Rci and
                     Bacteriophage Hp1_like integrase, C-terminal catalytic
                     domain; Region: INT_Rci_Hp1_C; cd00796"
                     /db_xref="CDD:271177"
     misc_feature    complement(order(413556..413558,413565..413567,
                     413595..413597,413625..413630,413634..413639,
                     413646..413651,413823..413825,413829..413831,
                     413835..413837,413940..413945,413952..413954,
                     414000..414002,414009..414014))
                     /locus_tag="ECL_00396"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:271177"
     misc_feature    complement(order(413559..413561,413652..413657,
                     413664..413666,413928..413930))
                     /locus_tag="ECL_00396"
                     /note="active site"
                     /db_xref="CDD:271177"
     gene            416426..417310
                     /locus_tag="ECL_00397"
                     /db_xref="GeneID:9122906"
     CDS             416426..417310
                     /locus_tag="ECL_00397"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610912.1"
                     /db_xref="GeneID:9122906"
                     /translation="MHSKTKVVPVVSTKGGEGKSTQAANLGGFLADAGIKTLIIDGDH
                     AQPTASSIYPLAYEAPCGLYELLMQTVDLSKAENIISRTTIDNLDVIVSNDPRNLLPT
                     YMLNVPDGRVRLRNALSNQVFSQYDVILIDSQGSRSVMSELIILAATGEMIGMVKPVL
                     PDVREFMRGTVALMEELIPYMAFGISLPRIHMLVNCMDYTLLAKTTVEQAENIIVSGD
                     YSQHADKIVIDMLQTRIYDLDVYKQGHAAGQPVHRLEKKTSRKSDSAFDSMHGLACEL
                     FPEWVSLFDTLAKGGERV"
     misc_feature    416435..417280
                     /locus_tag="ECL_00397"
                     /note="Cellulose biosynthesis protein BcsQ [Cell
                     motility]; Region: BcsQ; COG1192"
                     /db_xref="CDD:224113"
     gene            417375..418667
                     /locus_tag="ECL_00398"
                     /db_xref="GeneID:9122907"
     CDS             417375..418667
                     /locus_tag="ECL_00398"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA helicase"
                     /protein_id="YP_003610913.1"
                     /db_xref="GeneID:9122907"
                     /translation="MLDNDRWDEVALRLSADDFFQKVHKVIYQEMTRLVAAGKPLDLI
                     TLSESIESRGKDALEQLGGFAYLAELSKNTPSAANIVAYCDIVARTSRARQLASIGAE
                     ITESVRTPGTDIDRVMETAEQKITRLAERAEPEQGVTLLEGMERLLPELERRCNVPDG
                     ITGTPTGFEELDAMTSGLQAGDLVLIAARPSMGKTALLISLLLNSLMKKSGSKGQLYS
                     MEQPTEQILMRMLASLGSIDLTHLKSGLMDDEDWARATDASALLMGDLNDSLIIDDTG
                     SLTPAMLRIRARRNARRYGHPSIIGLDYLQLMRCPDQENRTQEIAEISRSLKALAKEM
                     MCPVVALSQLNRQLESRADKRPNNGDLRDSGALEQDADVIVFIYRDEVYHENTEDKGI
                     AEIIISKQRQGPTGTIRLQYEGRFTRFSDVAGRPGRSA"
     misc_feature    417375..418643
                     /locus_tag="ECL_00398"
                     /note="replicative DNA helicase; Region: DnaB; TIGR00665"
                     /db_xref="CDD:273206"
     misc_feature    417375..417641
                     /locus_tag="ECL_00398"
                     /note="DnaB-like helicase N terminal domain; Region: DnaB;
                     pfam00772"
                     /db_xref="CDD:279156"
     misc_feature    417882..418616
                     /locus_tag="ECL_00398"
                     /note="DnaB helicase C terminal domain. The hexameric
                     helicase DnaB unwinds the DNA duplex at the chromosome
                     replication fork. Although the mechanism by which DnaB
                     both couples ATP hydrolysis to translocation along DNA and
                     denatures the duplex is unknown, a...; Region: DnaB_C;
                     cd00984"
                     /db_xref="CDD:238484"
     misc_feature    417939..417959
                     /locus_tag="ECL_00398"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    order(417954..417959,418281..418283,418401..418403,
                     418509..418511,418575..418577,418608..418610)
                     /locus_tag="ECL_00398"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238484"
     misc_feature    418272..418283
                     /locus_tag="ECL_00398"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238484"
     misc_feature    order(418296..418301,418317..418325,418398..418424,
                     418506..418511,418545..418550)
                     /locus_tag="ECL_00398"
                     /note="DNA binding loops [nucleotide binding]"
                     /db_xref="CDD:238484"
     gene            418664..420370
                     /locus_tag="ECL_00399"
                     /db_xref="GeneID:9122908"
     CDS             418664..420370
                     /locus_tag="ECL_00399"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610914.1"
                     /db_xref="GeneID:9122908"
                     /translation="MSNVRNLNLGAAMLQRGKTPAQGDAVPAAVPLPVSEMAMVLTLD
                     QLRPNPDNPRKSRNPHFDEIKASIRACGLVQVPKVTRDPDGEDVYIFSDGGNTRYQIL
                     CELWQETGDERFYRVHTIFKPWPGRLKCLVGHLAENEVRGDLSYIDKAFGVHSARAIQ
                     EELMGRPVTLRELSDLLNLEGYPIDYSTISRMEDTIKYLWPCIPNLLNSGLARLQVLS
                     LLRIRSQAGKVWSQFAHESSPQCSFDQVFEASCQGFDDPDSYAYETFRDEFIGQLVKA
                     LPHPSLNYDRWMIELDPREQKRREQFGEPPPLPVLTPPQEKAAGREPPEPQVTVLPPD
                     TASETPVTGLRSGTLTTPGRPEPAPELPADAELPVNALMTAGSEPRREVQNDLFGGRP
                     VISGETADPDSISLPDFSPDTLMSAFGEENASPAASVSSVAFAATGLEPVSDIWHIPA
                     LQDDIEHLQDMAYRLVFEIAEAMGCADNVREDKNPQSAGFAVSETGSEFVLFLAGLSG
                     SLPNRQFNMFMFCLNFFGSQSPADMAVFDDITVVKTMRLIRVIRRLRELQRLAAKGGE
                     NV"
     misc_feature    418754..419542
                     /locus_tag="ECL_00399"
                     /note="integrating conjugative element, PFGI_1 class, ParB
                     family protein; Region: ICE_PFGI_1_parB; TIGR03764"
                     /db_xref="CDD:213858"
     gene            420363..420620
                     /locus_tag="ECL_00400"
                     /db_xref="GeneID:9122909"
     CDS             420363..420620
                     /locus_tag="ECL_00400"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610915.1"
                     /db_xref="GeneID:9122909"
                     /translation="MSDDLNDEMAQASTALFIQHGIDAIRAKVNSATPSKAFCECCGA
                     AIPVARQLAVPGVELCAGCQEVKEMKNRHRADGGRGMRHVG"
     misc_feature    <420363..420590
                     /locus_tag="ECL_00400"
                     /note="RNA polymerase-binding transcription factor DksA
                     [Translation, ribosomal structure and biogenesis]; Region:
                     DksA; COG1734"
                     /db_xref="CDD:224648"
     gene            420610..421353
                     /locus_tag="ECL_00401"
                     /db_xref="GeneID:9122910"
     CDS             420610..421353
                     /locus_tag="ECL_00401"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610916.1"
                     /db_xref="GeneID:9122910"
                     /translation="MSDNAKITARIRRLMALGTRNSNPHEAARAVALAQRLMQRHGLT
                     PDMLSLSDVSESVCFSLTSDAEKVPAWLSSLATVVCMATGCRCWFGWHVHVSPQGVSS
                     VRRSLHFYGFSERPEVALYIYTVLQRQLRAATDAHMSGYRTRRILLRTRRRRADQFRE
                     GWVSGVWQVLQSFAPSGEENAVLQRWLVRRHAGEPLEDMAVRSAGKCRGDRTARVAGF
                     FAGRDIDLHHGLSGAQASRQITAGGHAHD"
     misc_feature    420625..420741
                     /locus_tag="ECL_00401"
                     /note="Protein of unknown function (DUF2786); Region:
                     DUF2786; pfam10979"
                     /db_xref="CDD:314021"
     gene            421438..422037
                     /locus_tag="ECL_00402"
                     /db_xref="GeneID:9122911"
     CDS             421438..422037
                     /locus_tag="ECL_00402"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610917.1"
                     /db_xref="GeneID:9122911"
                     /translation="MSQHNLSQATTAILSSLLMDVKNGNIRRCESLGMSVEEIRALSH
                     LSLDELHYLSQSHVSVLDVTLNHENFWLMLNQARNEQKRFMMIDRALELGGSMELIDR
                     YFGLSPSEVSARRRLMGIESRQGRTQALTEPQDAALWAEWKAAGLSSPDSHQALEAMM
                     LAAEQLGLSLTAVWSRVCQWCREANAAGRRAEIPVRKEA"
     misc_feature    421465..421986
                     /locus_tag="ECL_00402"
                     /note="Protein of unknown function (DUF2857); Region:
                     DUF2857; pfam11198"
                     /db_xref="CDD:314196"
     gene            422037..422267
                     /locus_tag="ECL_00403"
                     /db_xref="GeneID:9122912"
     CDS             422037..422267
                     /locus_tag="ECL_00403"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610918.1"
                     /db_xref="GeneID:9122912"
                     /translation="MEMGDFSPRQQVSPAVRRRAQQLFRAACGGQKVFRRLTMNGYLK
                     IDVGPFWRILSKDGCRQWWLMDHETYNREIRR"
     gene            422236..422349
                     /locus_tag="ECL_00404"
                     /db_xref="GeneID:9122913"
     CDS             422236..422349
                     /locus_tag="ECL_00404"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610919.1"
                     /db_xref="GeneID:9122913"
                     /translation="MRPTTVKYGGNGLPLMTRQCRVYPGTVLSQAEEESIK"
     gene            422346..423584
                     /locus_tag="ECL_00405"
                     /db_xref="GeneID:9122914"
     CDS             422346..423584
                     /locus_tag="ECL_00405"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610920.1"
                     /db_xref="GeneID:9122914"
                     /translation="MTIPADSIVAHTLARMQQNLERRTDTGDVSQERSGLLFMGNVHD
                     AFPRRLFLDTRLSPLDKTAWVMIRLYAQQNEGAIFPTYDELQVQLASAHSEKASRDTV
                     SRVLLMLRLTGWLSLCKRVRDDRGRVRGNIYAQHDEPLGYRDAETFDPGWLKLVEESC
                     LSRNKAVRMTALAVVNDILQDPGMRHRHSRLALIESRLSAPSTPRQMVSHRRAVNRSP
                     ESGLSQKSTKNIPESLSPENGLSTPSVDKTQSPESGLSLKSTSYTGVRNPDCNVRSFT
                     QSVNKKTYVPGGEHFLPDDFVNGLNSDDRQMLTTQMASLPEAVAKTLADMLREQLRLG
                     RLNNPVGWLFTMLRRARSGELNLPEAAAPAPAGSGSNNPPTTGTRAVPAAIIPVQPAR
                     RPSRDEVRAMIESIRQNVGR"
     misc_feature    422505..422690
                     /locus_tag="ECL_00405"
                     /note="Helix-turn-helix domain; Region: HTH_36; pfam13730"
                     /db_xref="CDD:316269"
     gene            423831..424553
                     /locus_tag="ECL_00406"
                     /db_xref="GeneID:9122915"
     CDS             423831..424553
                     /locus_tag="ECL_00406"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610921.1"
                     /db_xref="GeneID:9122915"
                     /translation="MADKQVTKTGSLQSEMTIALHTNYAIGLWLGRKREKQEDNTPVK
                     HGIIGMPQFFVRATLINQDSLNNNPWADEAMYRLEEKLRSATETMTGLIKQLDEEMSM
                     LPAGITLTEVTSVEPLDIHVFTRTPLGYRCVFLLVGFDQFAKKVLQASHYGLITRNGR
                     DNYLSEGGRLLRQIYGTVLSYRRVDATRLDAAENNEVWQKACQEAGEPDRAVLLGEKR
                     SAFSPPVNEASVNLLRLRYQTV"
     misc_feature    423858..424517
                     /locus_tag="ECL_00406"
                     /note="integrating conjugative element protein, PFL_4669
                     family; Region: ICE_PFL4669; TIGR03761"
                     /db_xref="CDD:274771"
     gene            424571..426724
                     /locus_tag="ECL_00407"
                     /db_xref="GeneID:9122916"
     CDS             424571..426724
                     /locus_tag="ECL_00407"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase III"
                     /protein_id="YP_003610922.1"
                     /db_xref="GeneID:9122916"
                     /translation="MRLFICEKPSQGRDLAGVLGATRRGDGFLTGSGVTVTWAVGHLL
                     ETAPPEAYGQQYGKPWSLSALPILPAPWRVVVKKETQDQFKVIERLLRQVDDVVIATD
                     ADREGEVIARELLEYCRWEGPVQRLWLSALDELSIRAALQDLRPGQATLGMYHAGLGR
                     ARADWLIGMNLSRLYTLRAAESGFDGVVSVGRVQTPTLALVVRRDREIAAFVPKPFWQ
                     VKALISAGDLTFPAQWVPAKVYTDEEKRCVHQNIAQQVAQLCRQTGHAVVTECDTKRE
                     KAAAPLAFSLGSLQQACGRLWDMSPQQVLDTAQSLYEKHKATTYPRTDCGYLPESMRE
                     EISGVLDAIGRTDPECAPVLARLDRTFVSRIWNDKKITAHHGIIPTRNAFQLSALTET
                     ERNVYMLIRRNYLAQFLPLHESDFTRLQFDTGGQLFRATGRTEVIKGWKVLFENAGDN
                     EVDDGDEADIALPPLAQNDRCAVTGAEVVQLMTRPPAHYTFATLIGAMMNAAAFVTDV
                     ALRKVLKDNAGLGTEATRAGIVEQLLNRHFIVRKGSKIMATELGADVIDALPPQLTEP
                     GMTALWEQALDEVAAGRMSLDDFLQRQTGWTRNLVSQGTQQQVRIRVPPTPACPLCGG
                     KPVCAGERKGNSGAASAGRNAKVSSTSGAPERNDRAGLSLLNQRRINPLYPIAGRCGL
                     CYCDPGSEAAPRDCGFRQHLMHVLPEYSLAGPVHT"
     misc_feature    424571..426541
                     /locus_tag="ECL_00407"
                     /note="DNA topoisomerase III; Provisional; Region:
                     PRK07726"
                     /db_xref="CDD:236078"
     misc_feature    424571..425002
                     /locus_tag="ECL_00407"
                     /note="TOPRIM_TopoIA_TopoIII: The topoisomerase-primase
                     (TORPIM) domain found in members of the type IA family of
                     DNA topoisomerases (Topo IA) similar to topoisomerase III.
                     Type IA DNA topoisomerases remove (relax) negative
                     supercoils in the DNA by: cleaving...; Region:
                     TOPRIM_TopoIA_TopoIII; cd03362"
                     /db_xref="CDD:173782"
     misc_feature    order(424589..424594,424601..424603,424874..424876,
                     424880..424882,424886..424888)
                     /locus_tag="ECL_00407"
                     /note="active site"
                     /db_xref="CDD:173782"
     misc_feature    order(424610..424612,424877..424879,424883..424885,
                     424904..424909,424913..424918)
                     /locus_tag="ECL_00407"
                     /note="putative interdomain interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:173782"
     misc_feature    order(424874..424876,424880..424882)
                     /locus_tag="ECL_00407"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173782"
     misc_feature    424883..424885
                     /locus_tag="ECL_00407"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:173782"
     misc_feature    425024..426343
                     /locus_tag="ECL_00407"
                     /note="DNA Topoisomerase, subtype IA; DNA-binding,
                     ATP-binding and catalytic domain of bacterial DNA
                     topoisomerases I and III, and eukaryotic DNA topoisomerase
                     III and eubacterial and archael reverse gyrases.
                     Topoisomerases clevage single or double stranded DNA...;
                     Region: TOP1Ac; cd00186"
                     /db_xref="CDD:238110"
     misc_feature    order(425024..425104,425132..425194)
                     /locus_tag="ECL_00407"
                     /note="domain I; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(425048..425053,425060..425062,425072..425074,
                     425084..425086,425495..425497,425507..425509,
                     425534..425536,426140..426145,426152..426157,
                     426161..426163,426173..426178)
                     /locus_tag="ECL_00407"
                     /note="DNA binding groove [nucleotide binding]"
                     /db_xref="CDD:238110"
     misc_feature    order(425165..425167,425177..425179,426248..426250)
                     /locus_tag="ECL_00407"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(425207..425233,425366..425407,425798..425842,
                     425846..425902,425990..426022)
                     /locus_tag="ECL_00407"
                     /note="domain II; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(425408..425428,425432..425518,425522..425602,
                     425687..425713,425735..425797)
                     /locus_tag="ECL_00407"
                     /note="domain III; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(425441..425443,425453..425461,425690..425692,
                     425753..425755,425762..425764,425774..425776,
                     426134..426136,426140..426142,426206..426208)
                     /locus_tag="ECL_00407"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238110"
     misc_feature    order(425528..425530,425534..425536,425690..425692)
                     /locus_tag="ECL_00407"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238110"
     misc_feature    order(426023..426064,426116..426196,426206..426250,
                     426257..426343)
                     /locus_tag="ECL_00407"
                     /note="domain IV; other site"
                     /db_xref="CDD:238110"
     gene            426753..426905
                     /locus_tag="ECL_00408"
                     /db_xref="GeneID:9122917"
     CDS             426753..426905
                     /locus_tag="ECL_00408"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610923.1"
                     /db_xref="GeneID:9122917"
                     /translation="MKPVPGPFSQRSHCDKQVYLRSMVQTSEGGVARHRFFYFCVLMI
                     FCTLRR"
     gene            427215..427706
                     /locus_tag="ECL_00409"
                     /db_xref="GeneID:9122918"
     CDS             427215..427706
                     /locus_tag="ECL_00409"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610924.1"
                     /db_xref="GeneID:9122918"
                     /translation="MTATTTTPASTGSASASQKKEFFNLNVNGIGYLSSIRRVQGGNG
                     EFTCAVINALTGPTDNASYTRFDVTIAGAETTKLINRCQKAVDEEEKVLIGFVLSGLK
                     ADVFTLQTGDHAGESRPSLKARLIKVEFIKKGQDVVYQAPNASQTPESGSSAQKEYDP
                     NSF"
     misc_feature    427260..427655
                     /locus_tag="ECL_00409"
                     /note="Protein of unknown function (DUF3577); Region:
                     DUF3577; pfam12101"
                     /db_xref="CDD:314905"
     gene            427782..428282
                     /locus_tag="ECL_00410"
                     /db_xref="GeneID:9122919"
     CDS             427782..428282
                     /locus_tag="ECL_00410"
                     /codon_start=1
                     /transl_table=11
                     /product="single-strand DNA-binding protein"
                     /protein_id="YP_003610925.1"
                     /db_xref="GeneID:9122919"
                     /translation="MSARGVNKVILVGHLGQDPEVRYMPDSTAVTTLSVATSETWRDK
                     QTGENRENTEWHRVVLFGKLAEVAGEYLRKGSQVYIEGQLRTRKWTDTNGIERWTTEV
                     RVGVNGTMQMLGGGRNNSTNTSGNNAQSGQQGGWGQPQQPQQTPSAPQNPQNEPPMDF
                     DDDIPF"
     misc_feature    427782..428279
                     /locus_tag="ECL_00410"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:324543"
     misc_feature    order(427806..427817,427890..427898,427941..427943,
                     427947..427949,428010..428012,428037..428039,
                     428070..428072,428079..428081)
                     /locus_tag="ECL_00410"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239942"
     misc_feature    order(427821..427829,427845..427847,427875..427877,
                     427896..427901,427935..427940,427944..427946,
                     427950..427952,427956..427958,427962..427964,
                     428001..428006,428028..428030,428034..428036,
                     428040..428045,428082..428084,428088..428090)
                     /locus_tag="ECL_00410"
                     /note="ssDNA binding site [nucleotide binding]; other
                     site"
                     /db_xref="CDD:239942"
     gene            428438..428722
                     /locus_tag="ECL_00411"
                     /db_xref="GeneID:9122920"
     CDS             428438..428722
                     /locus_tag="ECL_00411"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610926.1"
                     /db_xref="GeneID:9122920"
                     /translation="MQTPVRKSVRDKQINIRATDEERAVIDYAASLVNKNRTDFIIER
                     AVHEAQNIILDQRVFVLDDARYQAFIRQLEAPVQNVEGRQRLMDVKPEWK"
     misc_feature    428459..428719
                     /locus_tag="ECL_00411"
                     /note="Uncharacterized conserved protein, DUF1778 family
                     [Function unknown]; Region: COG4453"
                     /db_xref="CDD:226860"
     gene            428953..429195
                     /locus_tag="ECL_00412"
                     /db_xref="GeneID:9122921"
     CDS             428953..429195
                     /locus_tag="ECL_00412"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="YP_003610927.1"
                     /db_xref="GeneID:9122921"
                     /translation="MPDPVPVVLLGRLAVDVSTQGNNFGKWLLNDAVMRVSNLADQVG
                     IKAIMVHAIDERAKAFYEYFGFVQSPVAANTLFYKI"
     misc_feature    <428974..429156
                     /locus_tag="ECL_00412"
                     /note="Acetyltransferase (GNAT) domain; Region:
                     Acetyltransf_7; pfam13508"
                     /db_xref="CDD:290242"
     gene            complement(429273..429455)
                     /locus_tag="ECL_00413"
                     /db_xref="GeneID:9122922"
     CDS             complement(429273..429455)
                     /locus_tag="ECL_00413"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610928.1"
                     /db_xref="GeneID:9122922"
                     /translation="MPHVWKVLPSGFTPGLVLIRSAILAGMKKRAMRNSFRKLKKNIA
                     EPVRLNQLTKPFTLIR"
     gene            429428..430714
                     /locus_tag="ECL_00414"
                     /db_xref="GeneID:9122923"
     CDS             429428..430714
                     /locus_tag="ECL_00414"
                     /codon_start=1
                     /transl_table=11
                     /product="pilus biogenesis protein PilL"
                     /protein_id="YP_003610929.1"
                     /db_xref="GeneID:9122923"
                     /translation="MAVPSRRVATGAALLACSVIQAGCSSAVSDPAPFANGRYQQPTR
                     FDDIYRNRAPDVVRYDRYTLVSTRPDDAQRDPLNQIVDITMPAQLVKTVGEGFRYLLL
                     ESGYSLCSATTSAFSELLSRPLPAVQRDIGPVRLSEALQIVAGPAWRLKVDDVNREIC
                     FELRDQYRSFAAPLPAPVSLVSQHAPVSLPPVIQPARTGGAAGTVNAVPRNPFTGDTS
                     INSTPGTLQKPVLTAQNQSVPSPVLTVAKTPAAQKSAALSPAGRPPVPPPAAAPKAAS
                     SQKTPVTAVHPVTVQPATVNAARQTVPVRPVTSLPPAPPVSGQTASSYIPGAPVTPQP
                     VGQTWRAEPGSTLKETLTGWASKATCSNGGNWVVIWPVSLDYRIDAPLVFHGNFESVL
                     VQVFDLYRKAEKPLFAEANRIQCLISVSDTPTGGGH"
     misc_feature    429596..429910
                     /locus_tag="ECL_00414"
                     /note="conjugative transfer region protein, TIGR03748
                     family; Region: conj_PilL"
                     /db_xref="CDD:163460"
     misc_feature    <429944..430462
                     /locus_tag="ECL_00414"
                     /note="Atrophin-1 family; Region: Atrophin-1; cl26464"
                     /db_xref="CDD:331285"
     misc_feature    430436..430690
                     /locus_tag="ECL_00414"
                     /note="Toxin co-regulated pilus biosynthesis protein Q;
                     Region: TcpQ; pfam10671"
                     /db_xref="CDD:313808"
     gene            430716..431159
                     /locus_tag="ECL_00415"
                     /db_xref="GeneID:9122924"
     CDS             430716..431159
                     /locus_tag="ECL_00415"
                     /codon_start=1
                     /transl_table=11
                     /product="PilM protein"
                     /protein_id="YP_003610930.1"
                     /db_xref="GeneID:9122924"
                     /translation="MGYALPVFVFCLVIALMAGDAQRHSAEHVRLSLQQTLPDQLATD
                     MLRTADAVNNWRHGRTVADGTVTPAQAGIVPAPDSRIQTVIQGGRLWVWVPATDGVYA
                     ALRTQSVTSALALTVSGGRLRMADGTDMNLSLPSGVTEGSIVYLN"
     misc_feature    430815..431153
                     /locus_tag="ECL_00415"
                     /note="PilM; Region: PilM; pfam07419"
                     /db_xref="CDD:311389"
     gene            431179..432852
                     /locus_tag="ECL_00416"
                     /db_xref="GeneID:9122925"
     CDS             431179..432852
                     /locus_tag="ECL_00416"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus formation outer membrane protein"
                     /protein_id="YP_003610931.1"
                     /db_xref="GeneID:9122925"
                     /translation="MPRLPFCLTALVAALALSSCSLNEISKMDKEASGQADTAQRVLQ
                     SRQTLTQPTVVWSDKPWVNLQPVTPVISTPDEKNLPACQITINRPEGISLPELGQRIT
                     ALCGIRVSITPDAFAALSSISTGSVVTSQMNGQLPAPDDNGRVPLSQMGTTSAQPVSV
                     QSSPSLIRGLKYQGDIRGLLDMAASGLGLSWRIDSSGVYFYQQDTRTFQLVILNTKVN
                     SSASINSGSGNQLGSGGGTSGGTTGDISSNQKTDYGMNSDLYDDIKKTVEQMVTPKSG
                     RFWLSSATGTLSVTDTPDVLNRIGRYIEYQNKVLSRQVQLNIQIVSVNQTRNEQMGLD
                     WGLVYKSLQNVGASLTGSMANASSSAASAGISILDTASGNAAKFSGSSLLIHALSEQG
                     NVSMALNQTDPTANLTPVAYQLSKSTGMLTSSSSTATANVGVTSTMTTTNVTTGLFMT
                     MLPFIQENGDVQLQFAFSYTSPPDIKSFVSRDGNTRNDTADTSTEGLARKVNLRSGQT
                     LVLTGSEQQNVSADKQGTFTPGNFILGGGQTGSRGRTTLVIMITPVLLR"
     misc_feature    431338..432843
                     /locus_tag="ECL_00416"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; cl27726"
                     /db_xref="CDD:332547"
     gene            433029..434135
                     /locus_tag="ECL_00417"
                     /db_xref="GeneID:9122926"
     CDS             433029..434135
                     /locus_tag="ECL_00417"
                     /codon_start=1
                     /transl_table=11
                     /product="pilin accessory protein PilO"
                     /protein_id="YP_003610932.1"
                     /db_xref="GeneID:9122926"
                     /translation="MAGVVSPGRVRHRLYALAVAFQLSEGGNAWGIYRLSRDEDLWVF
                     FAASGGQLSVMGDVTGTRAFIESAAQNFLRFNDADAPGLRCAATAEDGRDATTLTDRL
                     SGAQLRRCRLRKRLAPMSLILPAVVLTLATAAGVYWHDTVQQQADRDKAMEASRSRVA
                     PKNDKPALPARAPHPWASQPPVSVLLSNCWLTREPVFASVAGWRFTDGECVPEGLRLR
                     FVATPGSTVEDFSRRARELLGHAAVFNLQEGGKNGDVFIPFRKYLAGEYTDEALPGAE
                     AQLMRFISHLQRRNLDVKFTEVKPPAVAPGQEKNTPVQDWREFTFSVSSRLQPERLLQ
                     DFDAAGLRLTSVSITMSPQGQFGYTMKGSIYAQN"
     misc_feature    433032..434123
                     /locus_tag="ECL_00417"
                     /note="Pilin accessory protein (PilO); Region: PAP_PilO;
                     pfam06864"
                     /db_xref="CDD:284320"
     gene            434122..434619
                     /locus_tag="ECL_00418"
                     /db_xref="GeneID:9122927"
     CDS             434122..434619
                     /locus_tag="ECL_00418"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus biogenesis protein PilP"
                     /protein_id="YP_003610933.1"
                     /db_xref="GeneID:9122927"
                     /translation="MRRINPARTGLLLSVLLSGPALSATTADALPPNVTLGELEATQA
                     RNLILEQKVQTARLEQQLRESQSGQSTDRNYLATSLQPSAPLMTQPVPSQTAATSGTE
                     KRAGSVRLQEIYGRGTQLRARIVLPDGGVTEVAKGDQIPGTAKRVTEVTSTLVRLSDN
                     SELSF"
     misc_feature    434218..434595
                     /locus_tag="ECL_00418"
                     /note="Type II secretion system protein C; Region: T2SSC;
                     cl21712"
                     /db_xref="CDD:328866"
     gene            434627..436201
                     /locus_tag="ECL_00419"
                     /db_xref="GeneID:9122928"
     CDS             434627..436201
                     /locus_tag="ECL_00419"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV secretion system protein"
                     /protein_id="YP_003610934.1"
                     /db_xref="GeneID:9122928"
                     /translation="MTPDKDIMDFVFAEQHPSGGVTLLIDGNRRKEPAIQRWVMDVTR
                     EYPTAKTEFVTLSELNRRREVAERQGLALSRSVSESDLNSRDISVSQDKVISYMKLGN
                     EFSASDIHIEISADRKLSIVQLRIHGELEVVDEVKDVEGMTLASTSYLSMCDVREQSF
                     FAGREQSGRIDAKFARRAGLYGARYEHRPTPDGLIVVMRLIPDDGDNIPGLPQLGFLP
                     EQITLIMQILRLPEGMVLLTGPTGSGKSATLRVFSDIWLKLTGGKKRLLTLENPPEGR
                     IPGAIQTPVMPADNSPEAISRAWSNANASALRLDPDAILNGEMRDLYSLIAAIYASET
                     GHALFSTLHTQSPIGSLRRMEHFGIDRHLLADAALITGLIGQRLVPLLCEKCRIPWQV
                     KAPELDGETRARLEKYCTVEGVCDTGKLFFRNHEGCSHCQKTVPLTGRIVSRGVTGRT
                     AIAEVVRTDARLMQLWLSHGPAVARQYWVNQGGITRRMHLLRYLAQGRVDPVEGDLIC
                     PLDEDDIMQCEVPNVG"
     misc_feature    <434933..436135
                     /locus_tag="ECL_00419"
                     /note="Type II secretory pathway ATPase GspE/PulE or T4P
                     pilus assembly pathway ATPase PilB [Cell motility,
                     Intracellular trafficking, secretion, and vesicular
                     transport, Extracellular structures]; Region: PulE;
                     cl28318"
                     /db_xref="CDD:333138"
     gene            436191..437306
                     /locus_tag="ECL_00420"
                     /db_xref="GeneID:9122929"
     CDS             436191..437306
                     /locus_tag="ECL_00420"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV pilus biogenesis protein PilR"
                     /protein_id="YP_003610935.1"
                     /db_xref="GeneID:9122929"
                     /translation="MSVKTRFSPERDMSLAEMLRYRLVRATFTGQYRQPFYETLRFLL
                     ENRKALEEALAMIGEVHTDFGRRWHPYYELVQDCLEGVKDNREGRSLKDVLAAWAPYE
                     EAALISAGMETGNIPGALMQADKLIVARRLILGQVVFASVFPSALALLSAGLLLANNM
                     ALVPTLSKMSDPARWTGALGLMNGVAQWTDRWGVTAAGATVGGVILAFWSLPRWRGRL
                     RRVADFLMPWSVYQDLQGAVFLMNIGALLGAGVQELKALQILNEFAPPWLQERIEAAM
                     ECMSDGDSLGMALRQSGYDFPSREAVNYLSLLDKGNSAASLITNYADRWLEQALTRVA
                     RRANVTKLFSLVLIMSFFLLILLMVMQIQDMNTFNIH"
     misc_feature    436338..437288
                     /locus_tag="ECL_00420"
                     /note="Type II secretory pathway, component PulF [Cell
                     motility, Intracellular trafficking, secretion, and
                     vesicular transport, Extracellular structures]; Region:
                     PulF; cl28336"
                     /db_xref="CDD:333156"
     gene            437316..437912
                     /locus_tag="ECL_00421"
                     /db_xref="GeneID:9122930"
     CDS             437316..437912
                     /locus_tag="ECL_00421"
                     /codon_start=1
                     /transl_table=11
                     /product="type IV prepilin"
                     /protein_id="YP_003610936.1"
                     /db_xref="GeneID:9122930"
                     /translation="MSSQTSHYHQRQPDRGWGILEHGSIALFTVIVICIVGALVWGLS
                     GKKSVAVETSNIQTVVTNAQQLKQTQGGYNFTSGTTMTGTLIQQGGAPKAGWTIQGTA
                     SSGTGTMWNSYGGQVVMAPVASNGFNNGFSVTTQKVPQADCISIATQLGSGGAFSAIS
                     INSTDYSDGLVSAEDAGKACTADTGMTGNNTLVFTHNG"
     misc_feature    437463..437906
                     /locus_tag="ECL_00421"
                     /note="PilS N terminal; Region: PilS; cl27040"
                     /db_xref="CDD:331861"
     gene            437917..438396
                     /locus_tag="ECL_00422"
                     /db_xref="GeneID:9122931"
     CDS             437917..438396
                     /locus_tag="ECL_00422"
                     /codon_start=1
                     /transl_table=11
                     /product="PilT protein"
                     /protein_id="YP_003610937.1"
                     /db_xref="GeneID:9122931"
                     /translation="MLRLTVLLLFILLSPRAGAFCFDAAGAKYHIDPLLIQAIATGES
                     SLRPGITNVNRDKKTGRALSTDYGLMQVNSSHIPALMAQGVIRSPQDLLTRPCLNVQI
                     GTWILAKHFQVCGISWNCLGSYNAGFRQDRHETRESYANRIYAIYRRLLLKERGIRL"
     misc_feature    437917..438381
                     /locus_tag="ECL_00422"
                     /note="lysozyme_like domain. This contains several members
                     including Soluble Lytic Transglycosylases (SLT), Goose
                     Egg-White Lysozymes (GEWL), Hen Egg-White Lysozymes
                     (HEWL), chitinases, bacteriophage lambda lysozymes,
                     endolysins, autolysins, and chitosanases; Region:
                     lysozyme_like; cl00222"
                     /db_xref="CDD:320832"
     misc_feature    order(438043..438045,438133..438135,438232..438234,
                     438286..438288)
                     /locus_tag="ECL_00422"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    438043..438045
                     /locus_tag="ECL_00422"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            438393..439049
                     /locus_tag="ECL_00423"
                     /db_xref="GeneID:9122932"
     CDS             438393..439049
                     /locus_tag="ECL_00423"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610938.1"
                     /db_xref="GeneID:9122932"
                     /translation="MTLLTLSMPWPTLGILFPLSLGLFNVMAILVRINLVISGHRNGG
                     SSPVRPAIVWLYAAAVSVMLLAPAPAILRLLSFFLSLFLFRMTLTDALTGLLPREMTV
                     SCLTAGLAAALLHPGFTEHLLSAVTAMLIFGGWRYGSTKIQGRECLGLGDVWLAGAIA
                     AWLGGASGLYALLTGVMFFVLWQLTVRRIREGGPMGPWLCAGAMSVTLLKLYQPLITW
                     "
     gene            439055..440320
                     /locus_tag="ECL_00424"
                     /db_xref="GeneID:9122933"
     CDS             439055..440320
                     /locus_tag="ECL_00424"
                     /codon_start=1
                     /transl_table=11
                     /product="shufflon protein"
                     /protein_id="YP_003610939.1"
                     /db_xref="GeneID:9122933"
                     /translation="MNVTKTTDRGWAILSTGAALVILLLVSVWGYSLISDWMQRRTWM
                     NTSAQVSRFTQAVKSYTGRYYDTLLASATTTAPVIVTPAMLKNTGFLEQGFSETTIDG
                     QAYSAAVIRNATNTDQLQAMIYTQNGSALPFLALRQISMDISAGMGGYIWTSGIATGA
                     MGSWTVPLAQFGVSSTQGHIATLLTADELGVARGESDRLYRFSVTGKPDLNTMHTSID
                     MGGNNLNNTGTVNAVTGTFSGNVTAGGNMTANGTVTGQNVAAGTNVTAGNTITASNDI
                     RSNNGWFITRDGKGWLDETHGGGFYMSDNDWVRVVNNKNIYTAGQVRGGSVRADGRLS
                     TGEVLQLDGVNTAGATCSPNGLVSRDASGAILSCQSGVWTGAGKIIIRPVNGYQRQMQ
                     MMTLLVINSLLSYRMDCSVCTLVSDSILC"
     misc_feature    439067..440167
                     /locus_tag="ECL_00424"
                     /note="Bacterial shufflon protein, N-terminal constant
                     region; Region: Shufflon_N; pfam04917"
                     /db_xref="CDD:113681"
     gene            complement(440746..440889)
                     /locus_tag="ECL_00425"
                     /db_xref="GeneID:9122934"
     CDS             complement(440746..440889)
                     /locus_tag="ECL_00425"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610940.1"
                     /db_xref="GeneID:9122934"
                     /translation="MLKVNYLPVNPVCGEKAQLHYSEPHGQYQERVRIMAMCVRHIFS
                     HPE"
     gene            441412..442572
                     /locus_tag="ECL_00426"
                     /db_xref="GeneID:9122935"
     CDS             441412..442572
                     /locus_tag="ECL_00426"
                     /codon_start=1
                     /transl_table=11
                     /product="shufflon-specific DNA recombinase"
                     /protein_id="YP_003610941.1"
                     /db_xref="GeneID:9122935"
                     /translation="MAVRNRIKKMPLAKALDKYFSAVSVHKRGHLQEFYRINVIKRST
                     LSLKCMDEITSVDIADYRDMRLNTVSDRTGRTVSPNTVRLELALLSALYNLARIEWGT
                     CSHNPVEHVRKPAASPGRTRRLTSTEERRIARALRQKNPQLLAIFHLALETAMRQGEI
                     LSLRWEYVDLHLGIAHLPLTKNGTARDVPLSWKARQVLKEFAGPVTGPVFDYTSNGFK
                     SAWRVLLAELEIHDLHFHDLRHEAVSRLFELGTLNVMEVAAISGHKSMNMLKRYTHLR
                     ASQLVSKLDARRRQAQKLATLFVPYPAEISESGGLFRVQFSDLEHTAITAVNRDEALA
                     NAASHLLRIQALAARAGKRLPPPGEIGVREAHRVLINPFHKGGEAAGTDNGT"
     misc_feature    441769..442233
                     /locus_tag="ECL_00426"
                     /note="Shufflon-specific DNA recombinase Rci and
                     Bacteriophage Hp1_like integrase, C-terminal catalytic
                     domain; Region: INT_Rci_Hp1_C; cd00796"
                     /db_xref="CDD:271177"
     misc_feature    order(441796..441801,441808..441810,441853..441855,
                     441862..441867,441970..441972,441976..441978,
                     441982..441984,442132..442137,442144..442149,
                     442153..442158,442189..442191,442219..442221,
                     442228..442230)
                     /locus_tag="ECL_00426"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:271177"
     misc_feature    order(441877..441879,442117..442119,442126..442131,
                     442225..442227)
                     /locus_tag="ECL_00426"
                     /note="active site"
                     /db_xref="CDD:271177"
     gene            442691..443548
                     /locus_tag="ECL_00427"
                     /db_xref="GeneID:9122936"
     CDS             442691..443548
                     /locus_tag="ECL_00427"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610942.1"
                     /db_xref="GeneID:9122936"
                     /translation="MSLSHASPDELLPEAPEHQVSAPEVQSAAAVKPRIRLPFSPRKI
                     LQTGSIILLTVSLTGSLIALVVMGRQVSDLTIRVNTLDAAFRSGQIGQLTSNISAMEA
                     RLKTLEQQAATLASLPAAMQSADEQQSALRTSVSQLQEAGNDNTRAVTQLQSRVGSLE
                     HDVQQSRAELDEINRKAELTQKTPAPEKPRTSTGAVPPRVGAAVKKTDRSARRTVTPA
                     APFVLTGIERRGGQTFAVVIPRGVSQISAMRLLSPGDAMLGWTLRSTEGSGAAVFLVN
                     GREHRIQVE"
     misc_feature    442985..>443239
                     /locus_tag="ECL_00427"
                     /note="Tropomyosin like; Region: Tropomyosin_1; cl26315"
                     /db_xref="CDD:331136"
     gene            443566..444279
                     /locus_tag="ECL_00428"
                     /db_xref="GeneID:9122937"
     CDS             443566..444279
                     /locus_tag="ECL_00428"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610943.1"
                     /db_xref="GeneID:9122937"
                     /translation="MKKTLMASLFLVPLMTSAATVRTSSAQSSISTSQESSTGVLSAQ
                     QQAQQWGLSDSDWSRYQTLMEGDRGIMSPGLDPLTALGVETDNSAERRRLAELWVRHE
                     YQRSEKELAFQREINAAWLRLYPETLAVNMGSNAAGIAHDTQGRLALFVKENCSRCDA
                     RLAAVLADDRPVDIYLVGGNSDEAIRTWAIRHNIPVEKVRSRQITLNHDGGLWLRYGQ
                     GQMPVILQQGENGWQLAAF"
     misc_feature    443689..444264
                     /locus_tag="ECL_00428"
                     /note="integrating conjugative element protein, PFL_4693
                     family; Region: conj_TIGR03759"
                     /db_xref="CDD:274770"
     gene            444258..444869
                     /locus_tag="ECL_00429"
                     /db_xref="GeneID:9122938"
     CDS             444258..444869
                     /locus_tag="ECL_00429"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610944.1"
                     /db_xref="GeneID:9122938"
                     /translation="MAARRILMLGAGILFATAASGATDLQVIPDAYRQIAAAERVPAE
                     SLYSLAMAESTRKTAWGAKPWPWTINVAGRGYHYSTREEAFTALLGFMQRWPLKNIDV
                     GVAQVNLGWNGHFFPTYRDAFDPYTNLRAAARILRACYDARPGSWLRAAGCYHHPSGG
                     AHAATYMAIVRRKLSQIAMTGTPAAVGQPGLLARNSLSWIEPQ"
     misc_feature    444549..>444725
                     /locus_tag="ECL_00429"
                     /note="Lytic Transglycosylase (LT) and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL). LTs catalyze...; Region:
                     LT_GEWL; cd00254"
                     /db_xref="CDD:238157"
     gene            444866..445396
                     /locus_tag="ECL_00430"
                     /db_xref="GeneID:9122939"
     CDS             444866..445396
                     /locus_tag="ECL_00430"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610945.1"
                     /db_xref="GeneID:9122939"
                     /translation="MKNTLRYTLVFTLFSGLLTSAFSASATLTVVGDLGGESTGPLFD
                     AINAGPGQSATESPVLPPPPASLSLSDMLPVSTPEMSPGAVAARPLNLPGMPPVFVLG
                     DDASSRHWLTHHATTLSRMQATGMVISVRDEQGLNALRQLAPGVAMVPVSGGDLARRL
                     ALTHYPALITATGISQ"
     misc_feature    444962..445387
                     /locus_tag="ECL_00430"
                     /note="Protein of unknown function (DUF2859); Region:
                     DUF2859; pfam11072"
                     /db_xref="CDD:314099"
     gene            445396..446040
                     /locus_tag="ECL_00431"
                     /db_xref="GeneID:9122940"
     CDS             445396..446040
                     /locus_tag="ECL_00431"
                     /codon_start=1
                     /transl_table=11
                     /product="restriction endonuclease"
                     /protein_id="YP_003610946.1"
                     /db_xref="GeneID:9122940"
                     /translation="MPASLIAELLNPHRGLSVLAMTGAVVLAFLALKPRTVSQRRHRR
                     YQKQAARALLRLPQLRDEAARMAWLRKMNPYVFEEMLLTALSRQGLRIQRNARYSGDN
                     GADGQVWINGRRWLIQAKRYSATISAAHVSVFGLLTEREGCPGLFVHTGRTGEVSREA
                     FRRYDGIILISGQRLLWLLSGDRRWMDTLTRPPHRSLTPQSQRKEPAPSPVIRD"
     misc_feature    445600..445932
                     /locus_tag="ECL_00431"
                     /note="Restriction endonuclease; Region: Mrr_cat;
                     pfam04471"
                     /db_xref="CDD:309566"
     gene            446055..446429
                     /locus_tag="ECL_00432"
                     /db_xref="GeneID:9122941"
     CDS             446055..446429
                     /locus_tag="ECL_00432"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610947.1"
                     /db_xref="GeneID:9122941"
                     /translation="MPRMLYSLTDRIVDLVTSQAAKTAPMVIFVLVQCVLRICILRPL
                     IIFCCMVLAVLIAVPVAVFISPSFTPDVLAQGLLRVIHLLPGAYTPLCVAGALSELVY
                     LIRRFTVLPDFWPDNAAQRKGR"
     gene            446433..447209
                     /locus_tag="ECL_00433"
                     /db_xref="GeneID:9122942"
     CDS             446433..447209
                     /locus_tag="ECL_00433"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610948.1"
                     /db_xref="GeneID:9122942"
                     /translation="MSDFLARTDANPPHWAGEVIGKWDDHKLRLYGGFLRRHYWTDQG
                     SINVFCIKGTDHPDYQGLTWHEFLHRGKRMDRNIPMLERNPGYYLETDRKKPSMYYNS
                     YDGIDWYIGADGNHRSGLARFLFHEREMAYLHGVHLNHYEFDEPLLAVYLALREELSQ
                     HAAQGFHMDLNVNRVHRAREDTAGWKTDIYSTSLYFSVGSWCREHADNLDISALAAPR
                     DFSCPDEGWQLLVSLMAWRDKRTATKRPGFFSRLTSRGRI"
     gene            447206..449323
                     /locus_tag="ECL_00434"
                     /db_xref="GeneID:9122943"
     CDS             447206..449323
                     /locus_tag="ECL_00434"
                     /codon_start=1
                     /transl_table=11
                     /product="TraG-family protein"
                     /protein_id="YP_003610949.1"
                     /db_xref="GeneID:9122943"
                     /translation="MSDRYVMESLLRPAVELYSATVAASATCICLTAPWAVALSPSVS
                     WVTAAGFGVLALKRTREGMKILRYRQNIRRLPRYVLTSEQIPVSRRHLFLGKGFQWSV
                     RHTQRLIEARRPECEIYVQPSVLYRMAREMEKKMEYSLPWLCRLTCTDSALNPFRPLP
                     PVGGSPVYHGVEPDETTVTYDLGERVGHMLVIGTTRVGKTRLAELLITQDIRRTNAAG
                     EHEVVIVFDPKGDADLLRRMYAESHRAGRQDNFWVFHLGWPDISARYNAVGRFSRISE
                     VASRVAGQLSGEGNSAAFREFAWRFVNIITRALVALGQRPDYGLILRYVTNIGELYET
                     YVDNLLSEKAPQLMNTTEAMMQSGISDKDLPRHLQGRPNGVKIWVSEQVLGSPEGKKL
                     WDPVLDGLRSAVQYDRTYFDKIVASLLPLLEKLTTGKTAALLAPDYTDLDDPRPILDW
                     HNIIKSRGVVYVGLDALSDPVVAAAVGNSMFADLVSEGGHIYKFGLGDEEEGKSAKVA
                     INLHCDEFNELMGDEFIPLINKGGGAGFQVTAYTQTLSDIEARIGSTAKANQVVGNFN
                     TLVMLRVREKNTAMLLTDQLPEVDVYQKTLTSGVTDVSRPGEGTDFNSNVNDQVSLVK
                     VPMIRPADIINLPKGQAFALLEGGRLWKIRMPLPADNNDPHMPASLKHLADSMEKNYH
                     TGETWWTGGDITYAGGPDATAGQ"
     misc_feature    447224..449179
                     /locus_tag="ECL_00434"
                     /note="conjugative coupling factor TraD, TOL family;
                     Region: conj_TOL_TraD; TIGR03754"
                     /db_xref="CDD:274767"
     gene            449304..450065
                     /locus_tag="ECL_00435"
                     /db_xref="GeneID:9122944"
     CDS             449304..450065
                     /locus_tag="ECL_00435"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_003610950.1"
                     /db_xref="GeneID:9122944"
                     /translation="MPQQDSENGQRSATPRQRQSGPIGLLLWDFPMGLIGVLLGSLLV
                     SLLIEYVCIALLWPEEGAAHSYQVMVAESHWLSEGYTRSLLMAAPVETVSRWVHVAWQ
                     WLFVDSGFSGWLQSFKSLSEKGSGLIPALNGIGATLVSWLGVYLQATVWVTLIFFIRV
                     MILFLSLPLFALVVITGVVDGLVRRDLRRYGAGYESSFVYHHAKRFIKPALYGPCMLY
                     LAWPTAVWPNLLLLPSALLVGGVLAVVTGSFKKYL"
     misc_feature    449358..450062
                     /locus_tag="ECL_00435"
                     /note="integrating conjugative element membrane protein,
                     PFL_4697 family; Region: conj_TIGR03747"
                     /db_xref="CDD:163459"
     gene            450271..450588
                     /locus_tag="ECL_00436"
                     /db_xref="GeneID:9122945"
     CDS             450271..450588
                     /locus_tag="ECL_00436"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610951.1"
                     /db_xref="GeneID:9122945"
                     /translation="MPHTRILTALLMAVLPALQCHASEKDELALVMRQLDQVQAGLDR
                     ARVVANQTQDARFYFDYQQATRDITTMKQGISTYLEPSRAQPASPSSSVTGQYRAQAP
                     AWR"
     misc_feature    450286..450561
                     /locus_tag="ECL_00436"
                     /note="Plasmid protein of unknown function
                     (Plasmid_RAQPRD); Region: Plasmid_RAQPRD; cl19622"
                     /db_xref="CDD:327600"
     gene            450579..450824
                     /locus_tag="ECL_00437"
                     /db_xref="GeneID:9122946"
     CDS             450579..450824
                     /locus_tag="ECL_00437"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610952.1"
                     /db_xref="GeneID:9122946"
                     /translation="MAMNGAQLNGWSAGTGSSLTPSQLNTLILGTLAVVILLFSAWAL
                     VQAYRGVASKSVTFRQFNELAVRLIVLYLAMLFLFFH"
     misc_feature    450588..450788
                     /locus_tag="ECL_00437"
                     /note="integrating conjugative element protein, PFL_4701
                     family; Region: conj_TIGR03758"
                     /db_xref="CDD:163470"
     gene            450838..451203
                     /locus_tag="ECL_00438"
                     /db_xref="GeneID:9122947"
     CDS             450838..451203
                     /locus_tag="ECL_00438"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610953.1"
                     /db_xref="GeneID:9122947"
                     /translation="MISTLLRRYRAIRARAKHILLTGLFFTGNALADLPPIEQPTTGG
                     GGGTYNIMMGYAKMGGLALGLLVSVGAFLAVAHAVITSFHDIRKGKGSWTEFLLYGVV
                     GIILILVVIFLATKASDIL"
     misc_feature    450937..451194
                     /locus_tag="ECL_00438"
                     /note="Protein of unknown function (DUF2976); Region:
                     DUF2976; pfam11190"
                     /db_xref="CDD:314190"
     gene            451213..451587
                     /locus_tag="ECL_00439"
                     /db_xref="GeneID:9122948"
     CDS             451213..451587
                     /locus_tag="ECL_00439"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610954.1"
                     /db_xref="GeneID:9122948"
                     /translation="MAVIDFLPDRLNNPPVVWKGFTSGEFLLAAITGVIAGIPLAVPL
                     ALVPFIGWLAFPTCMLLMPMFVIFFGGGWIAGYKRGKPENYIWQRLEEIRCRTGLSRA
                     LILNSRAWEMKRTTAIKRGGLS"
     misc_feature    451222..451554
                     /locus_tag="ECL_00439"
                     /note="conjugative transfer region protein, TIGR03750
                     family; Region: conj_TIGR03750"
                     /db_xref="CDD:274763"
     gene            451584..452228
                     /locus_tag="ECL_00440"
                     /db_xref="GeneID:9122949"
     CDS             451584..452228
                     /locus_tag="ECL_00440"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610955.1"
                     /db_xref="GeneID:9122949"
                     /translation="MSRFRNGMTARDNHIFSLRIACALLFAGMLMAGIGWMRAPSELT
                     IHNPPDLRSGSTRKWWEVPPSTVYSFAFYIFQQLNSWPKNGEVDYPAKIAQMSPYLTP
                     SCQDFLNKDAEMRKNSDELRDRVRVVYEIPRRGYSSRSVTILDQDHWIAQLDLVADEY
                     YHTEPVKRALVRYPLKVVRWEGDPERNPFGLALDCYAATPQRLEAVTLPEPEKK"
     misc_feature    451593..452198
                     /locus_tag="ECL_00440"
                     /note="integrating conjugative element protein, PFL_4703
                     family; Region: conj_TIGR03746"
                     /db_xref="CDD:163458"
     gene            452228..453136
                     /locus_tag="ECL_00441"
                     /db_xref="GeneID:9122950"
     CDS             452228..453136
                     /locus_tag="ECL_00441"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610956.1"
                     /db_xref="GeneID:9122950"
                     /translation="MKNPLKKCRLLLLAGLILSGAADAVELMKWERIPLQVPLTVGQE
                     RIVFVNKNVRVGFPPALNNKLRIQSTGGVVYLDASEAFPVTRLELQNKENGEIILLDV
                     SAAPGKTTREPVKIVYDGEVATATASDRQSVSSEGDSTGRSAQQADTETTKPDRKPAK
                     LNAPLPVVLTRYAAQNMYGPLRTVEPVPGISPVSLKLPSVITTLMPAEPVTVTPMAAW
                     SLQGSSVVALQVRNRSAGKVILDPRALEGQFTTATFQHRWLGRAGTPEDTTVLYLVTP
                     GRPEGAFIAEPPSLQPADGHKRRAKK"
     misc_feature    452282..453106
                     /locus_tag="ECL_00441"
                     /note="Protein of unknown function (DUF3438); Region:
                     DUF3438; pfam11920"
                     /db_xref="CDD:314746"
     gene            453133..454656
                     /locus_tag="ECL_00442"
                     /db_xref="GeneID:9122951"
     CDS             453133..454656
                     /locus_tag="ECL_00442"
                     /codon_start=1
                     /transl_table=11
                     /product="putative secreted protein"
                     /protein_id="YP_003610957.1"
                     /db_xref="GeneID:9122951"
                     /translation="MKAPSSNLLVKVAVPVVLASAVVVGVKSCSGGGNQTAAPHTASN
                     VALKDLSPEDLKALGIEGDTPQDTLRTVVGNFRKVQDRLDTLADDNKKLSDENKALKT
                     TNSNVDTQINQAVSNARAEEAQKRQQLSAEVTDLSTQVKQLMDQLRNGGAGTESGKNS
                     GSGSDIPIGLGYDSGLNSGAAGVSSSADGLHWVEPKDGVPVDASGRPVTDSNKNNATG
                     FSFATSFADTADAGKQAVGNTTAAVQTQLTDAQKATDPVYTLPENSTLVGSRAMTALL
                     GRIPVDGKVTDPYPFKVMIGKDNLTANGIELPDVQGAIVSGTATGDWTLSCVRGSITS
                     ITFVFSDGTVRTLPSPDGQGQNGNSSNQNSQGGNSSSIGWLSDDNGIPCISGTRKSNA
                     STYLPTIAALAAASAAGDAVAENQSTGQTNAYGGVTSTLTGNAGQAVLGKALSGGMRE
                     TVDWVKARYGQTFDAIYVPPGQTVALHITRQLAIDYEEKGRRVKYDFSLAGSGTGMD"
     misc_feature    453145..454620
                     /locus_tag="ECL_00442"
                     /note="integrating conjugative element protein, PFL_4705
                     family; Region: conj_TIGR03752"
                     /db_xref="CDD:274765"
     gene            454668..455117
                     /locus_tag="ECL_00443"
                     /db_xref="GeneID:9122952"
     CDS             454668..455117
                     /locus_tag="ECL_00443"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610958.1"
                     /db_xref="GeneID:9122952"
                     /translation="MQNDIPDTAVMRWRSLRPVTLFLTGAVALLLAGCSTSKDEMLPP
                     GDSTMLELWNDGASATHATGESRTTLRRPVTDSERVISRQTRDSYSRTQENEIQQTFP
                     RLPNPDLVMYVFPHLADGNTPVPGYSTVFPFYSQVQYALPGERTEDL"
     misc_feature    454743..455105
                     /locus_tag="ECL_00443"
                     /note="conjugative transfer region lipoprotein, TIGR03751
                     family; Region: conj_TIGR03751"
                     /db_xref="CDD:274764"
     gene            455117..457915
                     /locus_tag="ECL_00444"
                     /db_xref="GeneID:9122953"
     CDS             455117..457915
                     /locus_tag="ECL_00444"
                     /codon_start=1
                     /transl_table=11
                     /product="putative plasmid-like protein"
                     /protein_id="YP_003610959.1"
                     /db_xref="GeneID:9122953"
                     /translation="MAFSLFRRRAEAQEAHQYGDGPFSVNGHEPLTREGRLTRSEEAK
                     LYETAPSIIDHIPWGEYLPEHQCILLDDGVSVGAVYEIIPVGTEGRPDSRLEEIRDVV
                     ENALQDSLPELDTHQWVVQFYCQDESDLMVYMDKIRGYVKPRAQGTDFTDAWLREQAR
                     HLQNVATEKGLFVDEAVTGAPWRGQIRRTRMVIYRWVESPYRDPMAPEVLLKQVCDRL
                     TAAMSGAGIQCQRQNGEQIHSWLLRWFNPEPTWVDKATLYRCARHTDDAPGELPLLND
                     FSESLWFTRPRSDAEKGVWWFDDVAHRAVPVARLRSAPTTGHLTGEVRRGDNINAIMD
                     LLPEGTVLVMTLVIHPQDKLEENFARLSRDSMGENVDSLRAREDAATARTYLGNKHKL
                     YRAAITLLIKARDLPSLDSRYLDLSSKLLNCGLEPVNPEHDIGPLSTYMRALPMCFNP
                     EQDRHNWYTRLMFVQHFACLAPVYGRDTGTGNPGFTFFNRGGGPLSVDPLNKNDRTQN
                     AHLLLFGPTGAGKSATALDKLAQMIAIYRSRIFLLEAGNSFGLAGDYFESLGLTVHRV
                     SIKPGKAISLAPFGDSHLLMQEKPDELIISEDALPDIDDDEDKDEKRDVLGEMEIAAR
                     LMITGGEPAEEQRMTRADRGMIREAIMIAARSTFEAGRQMLPEDLMFALQGIARDAGM
                     GEDGRERRTAARRARAEEMSEALRMFTEGFEGELFNRPGTPWPEADVTIVDLGTLARE
                     GYEAQMAVAVISLLNTINNIAEREQYSDRDIIVSIDEAHIVTANPLMGPYATKIVKMW
                     RKLGAWLWLFTQNLADFPDTAKKMLNMAEWWICLVMPPDEVEQIARFKTLNSEQKAML
                     LSATKLPKKYTEGVILSRKVQALFRAVPPSLYLALGMTEKEEKAERRLIMNELQCSEL
                     EAAFHVARRLDENRGLSI"
     misc_feature    455228..457903
                     /locus_tag="ECL_00444"
                     /note="F pilus assembly Type-IV secretion system for
                     plasmid transfer; Region: TraC_F_IV; cl26477"
                     /db_xref="CDD:331298"
     gene            457927..458331
                     /locus_tag="ECL_00445"
                     /db_xref="GeneID:9122954"
     CDS             457927..458331
                     /locus_tag="ECL_00445"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610960.1"
                     /db_xref="GeneID:9122954"
                     /translation="MKKLTMAPPMVVADKALIASVIFTVPPQGMASIGQSDSVSLDTL
                     LREILKRLKTPFLLSVYPHRVGRRSCVAVHLTDENEKKLDILITVTGNTLWPGEAEFR
                     NGLRWNVCVPDATDLLWVLKEIDRVTGGEICS"
     gene            complement(458493..458726)
                     /locus_tag="ECL_00446"
                     /db_xref="GeneID:9122955"
     CDS             complement(458493..458726)
                     /locus_tag="ECL_00446"
                     /codon_start=1
                     /transl_table=11
                     /product="PerC family transcriptional regulator"
                     /protein_id="YP_003610961.1"
                     /db_xref="GeneID:9122955"
                     /translation="MELKDSIAESLEHRGQWRRAARRWLAVMDLSDDDAVREAIARRR
                     EHCISMGANIAPDGRRNETRRLYKMQSRYNNGY"
     misc_feature    complement(<458583..458720)
                     /locus_tag="ECL_00446"
                     /note="PerC transcriptional activator; Region: PerC;
                     pfam06069"
                     /db_xref="CDD:310570"
     gene            458854..461280
                     /locus_tag="ECL_00447"
                     /db_xref="GeneID:9122956"
     CDS             458854..461280
                     /locus_tag="ECL_00447"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610962.1"
                     /db_xref="GeneID:9122956"
                     /translation="MRYPFELDPQIIHHIIYSQAGSIGKAVIELIMNSVDAGAGAVII
                     DITPEGFSCRDDGRGFASYDDVKRYFGRFGTPHQEGDATYGRFRLGRGQIMAHARTLW
                     RSQRWQMSVDTREMGYHYDLEELTQPIQGCIISGEWYEPLTSQERMSCLQEIRDLVRY
                     TPVTVHLNGTIITRNPALEKWDMEDDEAWYRLREDGAVSIYNQGVLVRHDPAHIWGVG
                     GLVVSKKPLALNVSRTEILRKTCPVWASIAARFGRLAATFSDNQGKHRKTEARREKTA
                     RSLLSGEGDMQSLFNGEEVITLLPGKQHVTLEHFIRKCCHYPSAVDKNCFTLIRYAGD
                     VPRGELIARAGIAPVVHPVTLSRFGCYEPEEFMECLSRVRENLMAYREPLPREQRWGS
                     GWLSELALVDFETLSTNFIDSTQMVSEKQLDKETRRAWTALRWCLARYAAVCSGGEAG
                     YQSRSYGGKCFQILLGESTSSDAWTDGETYIAYNIDIVRRLKPDALRTASLLFSLTEH
                     EVAHEGDSLDCGHDEAFYQRFHDISTLCAPDRQRYMHVWLMKYTTSLEAESKRAKGTA
                     WRERYLTERASTGREKKGLPGVISHEGIEDAVNAPAEPEDVARLSFLNLQLNGAGTVA
                     PAETDWNSVVAAGIEQTRVNQDIRGQQKKLLEEWYASDKDETDILTDEQQADEAEEQM
                     WLESRKLHYLSILPGATEENLHDRAVAFLAYMTDSEEEELAAWAMRAWENSDQWYARN
                     TLSCSEADFLYEQDFDQPLGENVPADWLPFMQEGETRWSIERNAAAAGFIREMDYLEW
                     RRDSAIDDIP"
     misc_feature    458926..>459123
                     /locus_tag="ECL_00447"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cl00075"
                     /db_xref="CDD:320747"
     misc_feature    458950..458952
                     /locus_tag="ECL_00447"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(459022..459024,459028..459030,459115..459117,
                     459121..459123)
                     /locus_tag="ECL_00447"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            461448..461855
                     /locus_tag="ECL_00448"
                     /db_xref="GeneID:9122957"
     CDS             461448..461855
                     /locus_tag="ECL_00448"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610963.1"
                     /db_xref="GeneID:9122957"
                     /translation="MKLPVCCLAALFLTAGVRAGTVIYTDSTHPVTGNPGPEVTVVLL
                     DAPDRLQAQLFGPLPADPAQAEQQARTVIGSPDFQRRQQDLAGAYAGLTRAWSLGLEK
                     YPAVVFDDKWVVYGTSDVDVATQKLNVWKEKAQ"
     misc_feature    461502..461840
                     /locus_tag="ECL_00448"
                     /note="integrating conjugative element protein, PFL_4709
                     family; Region: conj_TIGR03757"
                     /db_xref="CDD:163469"
     gene            461852..462823
                     /locus_tag="ECL_00449"
                     /db_xref="GeneID:9122958"
     CDS             461852..462823
                     /locus_tag="ECL_00449"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610964.1"
                     /db_xref="GeneID:9122958"
                     /translation="MKMSFSRPRRLALATLMVCTGTMASVNTASLLSSATSPDCISWR
                     ISGICYWLFCTPFGCSVKTSVKVTHFIPEAVVSAYLSPGANPWTEMSAVSSLADSTES
                     TLLGSAAGVATGGGRQEMKAPGERKQNLHFYYGDAYGHPATRLIGGMVPGYSCDSAAT
                     PFMPYFTSALDALAWRTGVPESLYPEALIPGQREIGSTIGGNMWGNVYPRSGFVTQTD
                     SYKSAAMVVQRVADIITRQGQLHVYSPLTGQRSPGYWPPDPVQENTGTKNHKWQRLSP
                     QLSQSCAVFPDTGGQEAQDGNYAWALWQPYSCCKRRGQTFLYSTDFS"
     misc_feature    461927..462814
                     /locus_tag="ECL_00449"
                     /note="integrating conjugative element protein, PFL_4710
                     family; Region: conj_TIGR03756"
                     /db_xref="CDD:274769"
     gene            462835..464259
                     /locus_tag="ECL_00450"
                     /db_xref="GeneID:9122959"
     CDS             462835..464259
                     /locus_tag="ECL_00450"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610965.1"
                     /db_xref="GeneID:9122959"
                     /translation="MKQQYPQRLRRPLATLALFAALSLPALAVNTSLSSDGASVSGAI
                     NDGLFYSIGGGSVISPPPSRSNMSRLGLNDGWSSDLMCGNFDLKTTVGNQLNGITSGF
                     KDLMGNVIQGATGAVMSMPAMAIQRANPGLYEMLTNGVLQAGLSYDKALLNCQNMSKK
                     LADYTVGSKWQQAAVSEEYKDIVASSGGDAVSSDQQLQKATGEEGVTWVGGQKRGGKG
                     QQAIQPTRDLAKAGYNMMNSLPVTSNSSVGSASCNGTACQRWPSSDDAAAAVVKVLGD
                     RSIRTCRETSECTSGGTDNQPGSTVAGTGFSPVLEDATKTNLEQLDKLVGGQIQPTAE
                     NLGALKTGSLVVTRGVIQSLRDDPDKAALVQRLAGELAMADTVETALTMRRMLTTGES
                     EPNAAEQPEAIAEGDRRIDALDRELNALRNEMELRKAISNNSLLTTLERQGARNQDNQ
                     LQQKAGNQDQGFSQMNQTQSSGAK"
     misc_feature    462970..464181
                     /locus_tag="ECL_00450"
                     /note="integrating conjugative element protein, PFL_4711
                     family; Region: conj_TIGR03755"
                     /db_xref="CDD:274768"
     gene            464261..464599
                     /locus_tag="ECL_00451"
                     /db_xref="GeneID:9122960"
     CDS             464261..464599
                     /locus_tag="ECL_00451"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610966.1"
                     /db_xref="GeneID:9122960"
                     /translation="MKRSFLRGRTGRIVLMIAALLLITVAMFALASVFMAYDPDGHLT
                     RRWLHDSRWALFTWRLLMYAGIAVVWRMKVRPQMLARWPEVRARLPRTELLGVLFIAA
                     TECVAWAGVA"
     gene            464613..466157
                     /locus_tag="ECL_00452"
                     /db_xref="GeneID:9122961"
     CDS             464613..466157
                     /locus_tag="ECL_00452"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610967.1"
                     /db_xref="GeneID:9122961"
                     /translation="MTANSFLEYFLILFGWVMNNAMWTILGSTGLFALPLVFKVMGVW
                     LKVREEGADEGNKGLLALPRIEHALYVSFVVMLFCCIPLLPVDISTIKFDSSRAKQCG
                     VSVPTPQNSGYSGLVNDFDGRTAEVPIWWYLLHMISKGTTQAMIASIPCGTELRQMRF
                     DVQNTKLRDPVLLQEVQDFANQCYSRAYFRLKNSNSQLSDATINSVGWIGSDYFLNTS
                     GYYDYYTATTPRGQWPYDSTRDSGYPDTGQGGYPTCKTWWSDGSSGLRKRVLASFGDN
                     TRKEMQRSFPGTQWEEVALRWLVSPRNAGLSGDGTTYAVGSSDNVTGVVGNMTRLTST
                     IGLGLKQAEALPGFDALKQALPMIQALLQMMIITVIPVLMMFSAYEPKTVVTISFALF
                     ALQFITFWWELAGWLDDRLITILYDNMAQQGLASSVPFANFISSTNDGWIMNLVLGMM
                     YVVFPVFWIGMLSWIGVNLGTAISTGLEKGGSLPQKAGAEAGRDAQKIATDKAGGALK
                     GGLKLK"
     misc_feature    464634..466043
                     /locus_tag="ECL_00452"
                     /note="TraG-like protein, N-terminal region; Region:
                     TraG_N; pfam07916"
                     /db_xref="CDD:311735"
     gene            complement(466201..466491)
                     /locus_tag="ECL_00453"
                     /db_xref="GeneID:9122962"
     CDS             complement(466201..466491)
                     /locus_tag="ECL_00453"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610968.1"
                     /db_xref="GeneID:9122962"
                     /translation="MSKDGFRADDIASTFARFANKRRNIVCDESKLQRKKPEPLEFSS
                     ATNACGTAVLAGIADLMIITPERKKQNEEWSESWDAEREDWESQDRQWNDNR"
     gene            complement(466686..469352)
                     /locus_tag="ECL_00454"
                     /db_xref="GeneID:9122963"
     CDS             complement(466686..469352)
                     /locus_tag="ECL_00454"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair ATPase"
                     /protein_id="YP_003610969.1"
                     /db_xref="GeneID:9122963"
                     /translation="MKGSEWNKWDLHIHSPMTWLANVYADNCDIETYVRKLGEQQLSL
                     IGLTNYFYFQENELEIIRSEIGRQGLNITVLGNVEFRLDQQNKDEAFINVHVLFSDKL
                     STSKINEILSRLPLKLTDDSGKKVYACESSVRDSGHNVDTIVVNLSDLLEHLSSALRP
                     FIDYIVAVCPNGYGGYRPGATGRSAAIATEIDRQGHIIFGDPNDRDYFLTTTRYPGAS
                     LKPVFHCSDAHRAEHIGRAYTWVKAKPTFEGLRQALLEPEARLQLGADWLAQRPPKVH
                     FSHIAVEGTIFDGQAIRFKKQSIPLNQDMVAIIGGRGTGKSLLLDALRSRFAGATAYG
                     IEEREVNVEHLSIELDKTNGEKTLFDTRTDSYDYLHVSQGEIKTLCQQPGLISDEIKK
                     MLRLADCEVADEQRRGLGENLNAFQTFREYYVAQDERQYYINTPGYQDEVIKVAQDKI
                     NTLTSEKNKALIERFRANSLRATALTRGINAGNAFLREATAAETSLNSRLTEMNTVSA
                     GVVPVPPLDLSELMARVKAYMEALQTQLMETGEDNLRITAEFREQGIEQDITGVLDKI
                     QGYQREIQQAQLRHGEIQQRITQYNNDVRQRGNLVETYVRQLLEQKTAIDSCFAALAE
                     KPHLKPDQQELIKEILTDIRIYGQPHFDTARFYNGILERLNRGRFRTAGEQSGTEKLT
                     QVLGVRSIDDFVALVRGDAIIELPEEPGNKITLEAFLWRSEYFNNQGPYALQRFLCSP
                     EHISSYLTVRAEFEYKGKTVEKLSAGQRGTFYVCLKLATDAFGSPFVFDQPEDDLDND
                     FIMRQLVPLFRKIKLYRQVIIVTHNANLVVNCDAEQVIVASNEDEVISYRSGALEHGD
                     HGQKNSMRKAICDVLEGGRQAFEAREQKYGML"
     misc_feature    complement(468585..>468695)
                     /locus_tag="ECL_00454"
                     /note="PHP-associated; Region: PHP_C; pfam13263"
                     /db_xref="CDD:315844"
     misc_feature    complement(467964..468473)
                     /locus_tag="ECL_00454"
                     /note="AAA domain; Region: AAA_23; pfam13476"
                     /db_xref="CDD:316037"
     misc_feature    complement(466872..>467075)
                     /locus_tag="ECL_00454"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl25403"
                     /db_xref="CDD:330224"
     misc_feature    complement(467037..467066)
                     /locus_tag="ECL_00454"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(466983..467000)
                     /locus_tag="ECL_00454"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(466965..466976)
                     /locus_tag="ECL_00454"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(466881..466901)
                     /locus_tag="ECL_00454"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(469385..469588)
                     /locus_tag="ECL_00455"
                     /db_xref="GeneID:9122964"
     CDS             complement(469385..469588)
                     /locus_tag="ECL_00455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610970.1"
                     /db_xref="GeneID:9122964"
                     /translation="MAPHPVFFRLKRLTESQERCQFNSSFSGRFHPIYSSVSVSVYDF
                     PDTLMLIIAQKHGKLKTLSLLSQ"
     gene            469649..469864
                     /locus_tag="ECL_00456"
                     /db_xref="GeneID:9122965"
     CDS             469649..469864
                     /locus_tag="ECL_00456"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610971.1"
                     /db_xref="GeneID:9122965"
                     /translation="MYTKMLNYLLPMHSQLVTVGDEMERQSKIRVNASESYARVALDH
                     LLAQYLPGQSRINDCVAALPAFSVPLM"
     gene            complement(470012..470128)
                     /locus_tag="ECL_00457"
                     /db_xref="GeneID:9122966"
     CDS             complement(470012..470128)
                     /locus_tag="ECL_00457"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610972.1"
                     /db_xref="GeneID:9122966"
                     /translation="MLITPISKYFIRIQPRANSDELMKVLDGINHSGLGKCE"
     misc_feature    complement(470021..>470101)
                     /locus_tag="ECL_00457"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     gene            470195..470725
                     /locus_tag="ECL_00458"
                     /db_xref="GeneID:9122967"
     CDS             470195..470725
                     /locus_tag="ECL_00458"
                     /codon_start=1
                     /transl_table=11
                     /product="putative acetyltransferase"
                     /protein_id="YP_003610973.1"
                     /db_xref="GeneID:9122967"
                     /translation="MEITEADERHISAIQQIYAWHVLHGTATFETEPPDVAEMTARQK
                     NIHAAGLPWFVATENGEVLGYCYLSLYRERCAYRFTLEDSVYIAPAFQGRGIGTLLLS
                     RVVAWAEEHGFRQLIAVVGNSENIASLSLHRSAGFRHTGTLKSVGFKHGRWLDTVILQ
                     RTLGAGDVTLPDIPTG"
     misc_feature    470195..470695
                     /locus_tag="ECL_00458"
                     /note="L-amino acid N-acyltransferase YncA [Amino acid
                     transport and metabolism]; Region: YncA; COG1247"
                     /db_xref="CDD:224168"
     gene            complement(470808..471530)
                     /locus_tag="ECL_00459"
                     /db_xref="GeneID:9122968"
     CDS             complement(470808..471530)
                     /locus_tag="ECL_00459"
                     /codon_start=1
                     /transl_table=11
                     /product="putative arsenic resistance protein"
                     /protein_id="YP_003610974.1"
                     /db_xref="GeneID:9122968"
                     /translation="MNELNDSLPNIIPDIFDTPDFTGKPLSETPGHAPRILMLYGSVR
                     ERSYSRLTTEEGARLLTAMGAEVRIFNPSGLPLPDDAPDTHPKVAELRELVRWSEGMV
                     WCSPERHGAMTGIMKAQIDWLPLSEGAVRPSQGKTLAVMQVSGGSQSFNAVNQMRILG
                     RWMRMITIPNQSSVAKAWQEFDEEGRMKPSAYYDRIVDVMEELMKFTLLTRGRTAYLV
                     DRYSERKESASALSGRVNQRSI"
     misc_feature    complement(470853..471509)
                     /locus_tag="ECL_00459"
                     /note="NADPH-dependent FMN reductase; Region: FMN_red;
                     cl00438"
                     /db_xref="CDD:320973"
     gene            complement(471829..472200)
                     /locus_tag="ECL_00460"
                     /db_xref="GeneID:9122969"
     CDS             complement(471829..472200)
                     /locus_tag="ECL_00460"
                     /codon_start=1
                     /transl_table=11
                     /product="putative phosphatase"
                     /protein_id="YP_003610975.1"
                     /db_xref="GeneID:9122969"
                     /translation="MCHYMMTLAELSENQADALPSLCADLHMDWFHLPVQDSCAPEEP
                     FEQAFAREKKSLLALVRSGGTLVIHCHGGSGRTGMMAAVLMLESGYQPAQVKKQVQLI
                     RPKSLTSPVQVNYLCKRYGYQ"
     misc_feature    complement(471853..>472119)
                     /locus_tag="ECL_00460"
                     /note="Protein-tyrosine phosphatase [Signal transduction
                     mechanisms]; Region: CDC14; cl25998"
                     /db_xref="CDD:330819"
     gene            472260..472571
                     /locus_tag="ECL_00461"
                     /db_xref="GeneID:9122970"
     CDS             472260..472571
                     /locus_tag="ECL_00461"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase orfA"
                     /protein_id="YP_003610976.1"
                     /db_xref="GeneID:9122970"
                     /translation="MNKKTKRTFPPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLES
                     WVRQLRRERQGITPSATPITPDQQRIRELEKQVRRLEEQNTILKKATALLMSDSLNGS
                     R"
     misc_feature    472260..472553
                     /locus_tag="ECL_00461"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            472760..473437
                     /locus_tag="ECL_00462"
                     /db_xref="GeneID:9122971"
     CDS             472760..473437
                     /locus_tag="ECL_00462"
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase orfB"
                     /protein_id="YP_003610977.1"
                     /db_xref="GeneID:9122971"
                     /translation="MLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQEHTSLP
                     NLLERQFAVPEPDRVWCGDITYLWAGNRWCYLAVVMDLFARRVIGWSLSAHADTALIS
                     SALRMAYETRGQPRDVMFHSDQGSQYTGLKYQQLLWRCRINQSVSRRGNCWDNSPMER
                     FFRSLKTEWVPTNGYAGKDEARQQINDYILNYYNSVRPHHYNGGLTPEESENRYHFYC
                     KTVASIT"
     misc_feature    472760..473401
                     /locus_tag="ECL_00462"
                     /note="HTH-like domain; Region: HTH_21; cl26233"
                     /db_xref="CDD:331054"
     gene            complement(473441..473587)
                     /locus_tag="ECL_00463"
                     /db_xref="GeneID:9122972"
     CDS             complement(473441..473587)
                     /locus_tag="ECL_00463"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610978.1"
                     /db_xref="GeneID:9122972"
                     /translation="MFHPFDILTLDNGARLIFTPCPGTRGVSLADSLKSLKEAGAQAV
                     ITMM"
     gene            complement(473727..474236)
                     /locus_tag="ECL_00464"
                     /db_xref="GeneID:9122973"
     CDS             complement(473727..474236)
                     /locus_tag="ECL_00464"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610979.1"
                     /db_xref="GeneID:9122973"
                     /translation="MMSKTYNVLFLCSGNSARSLFAEVLMNQLGGGKFRAFSAGTQPA
                     SSPHPLTLRVLNDQGFSTESLKSKHLQNFRHPDAPQMDFIFTLCDRMAGEGCPVFPGS
                     PITAHWGFRDPALAAGTDTEKYHAFVEVEKQIATRIRLFLSLPLDKIDRLSLQKQLQA
                     MGNTGSDEH"
     misc_feature    complement(473808..474218)
                     /locus_tag="ECL_00464"
                     /note="Arsenate reductase of the LMWP family; Region:
                     LMWP_ArsC; cd16345"
                     /db_xref="CDD:319973"
     misc_feature    complement(order(473895..473897,473901..473903,
                     474180..474197,474201..474203))
                     /locus_tag="ECL_00464"
                     /note="active site"
                     /db_xref="CDD:319973"
     gene            complement(474309..474737)
                     /locus_tag="ECL_00465"
                     /db_xref="GeneID:9122974"
     CDS             complement(474309..474737)
                     /locus_tag="ECL_00465"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="YP_003610980.1"
                     /db_xref="GeneID:9122974"
                     /translation="MSAITIYHNPACGTSRNTLELIRNSGVEPTVILYLETPPARAEL
                     VTLIADMGICVRDLLRKNVEPYEQLGLAEDKWSDDELIDFMLQHPILINRPVVVTPLG
                     TRLCRPSEVVLDILPDAQKGAFSKEDGEQVIDAQGQRVVK"
     misc_feature    complement(474318..474737)
                     /locus_tag="ECL_00465"
                     /note="Protein Disulfide Oxidoreductases and Other
                     Proteins with a Thioredoxin fold; Region:
                     Thioredoxin_like; cl00388"
                     /db_xref="CDD:320948"
     misc_feature    complement(order(474417..474419,474456..474458,
                     474558..474560,474702..474704))
                     /locus_tag="ECL_00465"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239332"
     gene            complement(474795..476084)
                     /locus_tag="ECL_00466"
                     /db_xref="GeneID:9122975"
     CDS             complement(474795..476084)
                     /locus_tag="ECL_00466"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenite/antimonite transporter"
                     /protein_id="YP_003610981.1"
                     /db_xref="GeneID:9122975"
                     /translation="MWLAAAIFILTIVLVIWQPRGLGIGWSAMLGALLALITGVVHPG
                     DIPAVWHIVWNATAAFIAVIIISLLLDESGFFEWAALHVARWGNGRGRWLFSWIVLLG
                     AAVAALFANDGAALILTPIVIAMLLALGFSKGTTLAFVMAAGFIADSASLPLIVSNLV
                     NIVSADFFKLGFNEYASVMVPVDIAAIIATLVMLHLYFRKDIPATYEISRLKAPEEAI
                     RDRNTFRTGWGILALLLLGFFGLEPLGIPVSAVAAVGALILFLVAKKGHAINTGKVLR
                     GAPWQIVIFSLGMYLVVYGLRNAGLTDYLSAVLNQFASQGLWAATLGTGFLTAFLSSI
                     MNNMPTVLVGALSIDGSTATGVIKEAMIYANVIGSDLGPKITPIGSLATLLWLHVLAQ
                     KDIRITWGYYFRVGIVMTLPVLFVTLVALALRLSVSF"
     misc_feature    complement(474804..476081)
                     /locus_tag="ECL_00466"
                     /note="arsenical pump membrane protein; Provisional;
                     Region: PRK15445"
                     /db_xref="CDD:185342"
     misc_feature    complement(order(474828..474866,474942..475001,
                     475080..475127,475197..475253,475296..475340,
                     475371..475409,475497..475541,475605..475676,
                     475695..475748,475752..475802,475872..475925,
                     475974..476015,476034..476045))
                     /locus_tag="ECL_00466"
                     /note="transmembrane helices; other site"
                     /db_xref="CDD:238538"
     gene            complement(476125..477891)
                     /locus_tag="ECL_00467"
                     /db_xref="GeneID:9122976"
     CDS             complement(476125..477891)
                     /locus_tag="ECL_00467"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical pump-driving ATPase"
                     /protein_id="YP_003610982.1"
                     /db_xref="GeneID:9122976"
                     /translation="MNYLNTIPKFLFFTGKGGVGKTSLSCATAIRLADEGKRILLVST
                     DPASNVGQVFGQQIGNTLTVISDVPGLTALEIDPQAAAQQYRARIVDPVKGILPEDVV
                     RSIEEQLSGACTTEIAAFDEFTGLLTDDALLNDFDHVIFDTAPTGHTIRLLQLPGAWS
                     SFIETNPDGASCLGPLAGLEKQRERYSHALSVLADGEKTRLILVARAQQSTLAEVART
                     HDELLHVGLKHQYLVINGIMPAGEASEDSLASALYQREQRILSHMPQVLASLPTDRLS
                     LQQENLVGVTALRRLLTGENKPCSLPAAKPVSEPLSVPSLEMLIDDIARGGHGLVMLM
                     GKGGVGKTTLAAAVAVALADKGFDVHLTTSDPAAHLESTLNGQLPHLQVSRIDPHAET
                     ARYREHVLATKGKELDPQGRALLEEDLRSPCTEEIAVFQAFSRVIREAGKRFVVMDTA
                     PTGHTLLLLDATGAYHREVVKRMGEKGHYLTPMMQLQDPERTKIMLVTLPETTPVLEA
                     AGLQEDLRRAGIEPWAWLINNSLVATETTSPLLLTRAAHEAAQINKVRTELASRMALI
                     PLQQEEPTGIEQLKRLTRQAGK"
     misc_feature    complement(476176..477876)
                     /locus_tag="ECL_00467"
                     /note="arsenical pump-driving ATPase; Region:
                     arsen_driv_ArsA; TIGR04291"
                     /db_xref="CDD:275109"
     gene            complement(477915..478202)
                     /locus_tag="ECL_00468"
                     /db_xref="GeneID:9122977"
     CDS             complement(477915..478202)
                     /locus_tag="ECL_00468"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenical resistance operon trans-acting
                     repressor"
                     /protein_id="YP_003610983.1"
                     /db_xref="GeneID:9122977"
                     /translation="MSFSADVTWLKQQGVSVERFNLSQQPLAFAENPSVKAFLERSGA
                     ESLPLILLDGEFVLSGRYPTRQDLARWFGLNQEKTGMAPGKSCCGGNTSCC"
     misc_feature    complement(477918..>478202)
                     /locus_tag="ECL_00468"
                     /note="Arsenical resistance operon trans-acting repressor
                     ArsD; Region: ArsD; pfam06953"
                     /db_xref="CDD:284391"
     gene            complement(478303..478782)
                     /locus_tag="ECL_00469"
                     /db_xref="GeneID:9122978"
     CDS             complement(478303..478782)
                     /locus_tag="ECL_00469"
                     /codon_start=1
                     /transl_table=11
                     /product="arsenate reductase"
                     /protein_id="YP_003610984.1"
                     /db_xref="GeneID:9122978"
                     /translation="MNILFLCTGNSCRSILAEATFNALSPEAHHAFSAGSQPKGEVHP
                     RALALLRKEGIPTDGYYSKSWNNLPVTPDVVITVCGNAAGETCPAYLAPAVRAHWGVE
                     DPDKTTGSDEEIDAAFEQAWHILRRRIEAFLLLAPSVLSGPEERLQAELNRIGETIF"
     misc_feature    complement(478384..478779)
                     /locus_tag="ECL_00469"
                     /note="Arsenate reductase of the LMWP family; Region:
                     LMWP_ArsC; cd16345"
                     /db_xref="CDD:319973"
     misc_feature    complement(order(478468..478470,478474..478476,
                     478741..478758,478762..478764))
                     /locus_tag="ECL_00469"
                     /note="active site"
                     /db_xref="CDD:319973"
     gene            complement(478839..479192)
                     /locus_tag="ECL_00470"
                     /db_xref="GeneID:9122979"
     CDS             complement(478839..479192)
                     /locus_tag="ECL_00470"
                     /codon_start=1
                     /transl_table=11
                     /product="Arsenical resistance operon repressor"
                     /protein_id="YP_003610985.1"
                     /db_xref="GeneID:9122979"
                     /translation="MAPITALQLFKNLSDETRLKIVLLLRASGELCVCELCGTLEESQ
                     PKISRHLSMLRESGLLIDRREGKWIHYRLSAHMPAWAAAVIEQAYLSQKEDISLLAGR
                     IARNSATTGGRAVCL"
     misc_feature    complement(478845..479192)
                     /locus_tag="ECL_00470"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     misc_feature    complement(order(478980..478988,479001..479009,
                     479025..479030,479034..479039,479046..479051,
                     479055..479066,479091..479099,479139..479147,
                     479157..479162))
                     /locus_tag="ECL_00470"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     gene            479312..479494
                     /locus_tag="ECL_00471"
                     /db_xref="GeneID:9122980"
     CDS             479312..479494
                     /locus_tag="ECL_00471"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610986.1"
                     /db_xref="GeneID:9122980"
                     /translation="MRIEKVTGWLFRLIPERVFDALSGIVCAEMDGIARDRLPEQTER
                     KATLPAAGQERRKRNN"
     gene            complement(479541..479660)
                     /locus_tag="ECL_00472"
                     /db_xref="GeneID:9122981"
     CDS             complement(479541..479660)
                     /locus_tag="ECL_00472"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610987.1"
                     /db_xref="GeneID:9122981"
                     /translation="MPSSGKVVSLSVAPLKRSLDMSVIAGEMLSDSPEGLTAD"
     gene            complement(479693..479875)
                     /locus_tag="ECL_00473"
                     /db_xref="GeneID:9122982"
     CDS             complement(479693..479875)
                     /locus_tag="ECL_00473"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610988.1"
                     /db_xref="GeneID:9122982"
                     /translation="MERLIWALPPAFINNQMPGNLKQPGSCIYNGTEFSLLTYCPEEG
                     FLYQIISISLITRLSE"
     gene            480123..480239
                     /locus_tag="ECL_00474"
                     /db_xref="GeneID:9122983"
     CDS             480123..480239
                     /locus_tag="ECL_00474"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610989.1"
                     /db_xref="GeneID:9122983"
                     /translation="MSMVGYVVLLPDEDFRTQKETISVALHMYIAQVVTLSE"
     gene            480365..481366
                     /locus_tag="ECL_00475"
                     /db_xref="GeneID:9122984"
     CDS             480365..481366
                     /locus_tag="ECL_00475"
                     /codon_start=1
                     /transl_table=11
                     /product="putative permease"
                     /protein_id="YP_003610990.1"
                     /db_xref="GeneID:9122984"
                     /translation="MFQIFTDFATWLVYQRLNLSPATKLGDALHFFVEDVSKIFVLLL
                     VLIYFVAMLRASLDVGRVRDYLAGKHRGVGYLLGSCFGAITPFCSCSSIPVFLGFTSA
                     GIPLGITMAFLITSPLINEVAVLLLVSLLGWRFTLIYIVVGMAVGIAGGAFLDRIKAE
                     RWLADFAADALRDGQQHQTAVIRQSTGTPHMSLSKRHAFAKDETLTIFKRVWLWVILG
                     VGLGAALHGFVPDGWIASHLGAGQWWSVPVAVLVGIPLYSNATGVIPVMESLITNGLP
                     VGTALAFCMSTVAVSFPEFVLLKQVMKWQLLCILLLLLLTSFTLVGWVFNVVFPLVS"
     misc_feature    480428..481351
                     /locus_tag="ECL_00475"
                     /note="Uncharacterized membrane protein YraQ, UPF0718
                     family [Function unknown]; Region: YraQ; COG0701"
                     /db_xref="CDD:223773"
     gene            481380..481610
                     /locus_tag="ECL_00476"
                     /db_xref="GeneID:9122985"
     CDS             481380..481610
                     /locus_tag="ECL_00476"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol-disulfide isomerase and thioredoxins
                     family protein"
                     /protein_id="YP_003610991.1"
                     /db_xref="GeneID:9122985"
                     /translation="MKHVKVLGTGCSSCKTTIRLIQQVADERGVAIQLEKVESLPEIM
                     KYKVMSTPAVVINDIVVHAGGIPSKDIIESWL"
     misc_feature    481398..481607
                     /locus_tag="ECL_00476"
                     /note="Thioredoxin domain; Region: Thioredoxin_3;
                     pfam13192"
                     /db_xref="CDD:315783"
     gene            complement(481721..481924)
                     /locus_tag="ECL_00477"
                     /db_xref="GeneID:9122986"
     CDS             complement(481721..481924)
                     /locus_tag="ECL_00477"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610992.1"
                     /db_xref="GeneID:9122986"
                     /translation="MQKALMTAELLALARLSIMAFKKPLKYMDDTDAEVIARFKKTFT
                     PELIEQMCLRILGLEAERQSLNE"
     gene            complement(482006..482833)
                     /locus_tag="ECL_00478"
                     /db_xref="GeneID:9122987"
     CDS             complement(482006..482833)
                     /locus_tag="ECL_00478"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610993.1"
                     /db_xref="GeneID:9122987"
                     /translation="MNNTIIACVDGSSSTRAVCEYAAWVAGKLDVPLALLHVLEKNEQ
                     PAVSDLTGAIGIDSREQLTQELVRIEGERNRLLMTQGRAILAGCAELLSQIGIPDVQQ
                     LQKHGALDIILADLKDIRLMILGRRGTQNPVGSNLESIIRLQKKPVLIVPETFTPPSK
                     AMFAFDGSEESRRNLRRLTLSPLLLGMECHVVMVNGDAHTLEEARRSLQTSGISAISR
                     LAEGRSVPEALCRYASDNNVDLIVMGAYGHSSLRRFFIGSNTTAMIEQTRVPLLMLR"
     misc_feature    complement(482378..482824)
                     /locus_tag="ECL_00478"
                     /note="Universal stress protein family; Region: Usp;
                     pfam00582"
                     /db_xref="CDD:306953"
     misc_feature    complement(order(482423..482434,482450..482455,
                     482459..482464,482720..482722,482804..482812))
                     /locus_tag="ECL_00478"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     misc_feature    complement(482015..482350)
                     /locus_tag="ECL_00478"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    complement(order(482054..482065,482093..482098,
                     482102..482107,482252..482254,482336..482344))
                     /locus_tag="ECL_00478"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(482851..484329)
                     /locus_tag="ECL_00479"
                     /db_xref="GeneID:9122988"
     CDS             complement(482851..484329)
                     /locus_tag="ECL_00479"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfate permease"
                     /protein_id="YP_003610994.1"
                     /db_xref="GeneID:9122988"
                     /translation="MLLSSTRRDWLGNVRGDVLAGIVVALALIPEAIAFSIIAGVDPQ
                     VGLYSAFCIPLVMAFFGGRPAMISSSTGAMALLMVTLVKDHGLQYLLAASILTGVFQL
                     IAGYLKLGGLMRFVSRSVVTGFVNALAILIFMAQLPELTNVTWHVYAMTAGGLAIIYL
                     FPYLNKTIPSPLVCIVVLTAIAMWLHLDVRTVGDMGKLPDSLPVFLLPDIPLNLDTLL
                     IILPYSAGLAVVGLLESMMTATIVDDMTDTPSDKNRECKAQGIANICTPFIGGMAGCA
                     MIGQSVINVKSGGRGRLSTLTAGVVLLCMVVFLRDLVSQIPMAALVAVMIMVSIGTFS
                     WRSVADLKSHPISTSVVMLATVVVVVATHNLAFGVLTGVLIASLNFATKVARFLVVSS
                     ELKKDTRFYKVTGQVFFASADRFMAYFDFREAVEKVVIDVAQAHFWDITSVSALDKVV
                     IKFRREGTEVEIRGMNEATRTIVDRFGVHDKPEEVEKLMGGH"
     misc_feature    complement(482875..484296)
                     /locus_tag="ECL_00479"
                     /note="Sulfate permease or related transporter, MFS
                     superfamily [Inorganic ion transport and metabolism];
                     Region: SUL1; COG0659"
                     /db_xref="CDD:223732"
     gene            485670..485915
                     /locus_tag="ECL_00480"
                     /db_xref="GeneID:9122989"
     CDS             485670..485915
                     /locus_tag="ECL_00480"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding protein"
                     /protein_id="YP_003610995.1"
                     /db_xref="GeneID:9122989"
                     /translation="MSQLEHVHLKEDEFEALRLVDLLGMQQQEAAVAMGVSRQTLANV
                     LKAARFKVVDCLTQGKALIMHSEREGVTQDDHSHSSE"
     misc_feature    <485673..485858
                     /locus_tag="ECL_00480"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cl22854"
                     /db_xref="CDD:328931"
     gene            485890..486351
                     /locus_tag="ECL_00481"
                     /db_xref="GeneID:9122990"
     CDS             485890..486351
                     /locus_tag="ECL_00481"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610996.1"
                     /db_xref="GeneID:9122990"
                     /translation="MITAIPVNDDRVANHFTKASHLVFVDKRGAELSRTENPALGADC
                     SGKRKLVDLLVQQQVSRVVVRNIGERMLGKLLGHQIAVYQTDCGRRLFTELCDPDTRV
                     LTELNKPEQGRQSLNHEAKGKKCCHSDGNTAENACLRGHQHHHGNGRCCHS"
     misc_feature    485890..486147
                     /locus_tag="ECL_00481"
                     /note="This CD represents a family of iron-molybdenum
                     cluster-binding proteins that includes NifB, NifX, and
                     NifY, all of which are involved in the synthesis of an
                     iron-molybdenum cofactor (FeMo-co) that binds the active
                     site of the dinitrogenase enzyme. This...; Region:
                     NifX_NifB; cl00252"
                     /db_xref="CDD:320858"
     gene            complement(486378..487178)
                     /locus_tag="ECL_00482"
                     /db_xref="GeneID:9122991"
     CDS             complement(486378..487178)
                     /locus_tag="ECL_00482"
                     /codon_start=1
                     /transl_table=11
                     /product="integrase core subunit"
                     /protein_id="YP_003610997.1"
                     /db_xref="GeneID:9122991"
                     /translation="MLTQNGVPMSRYRAGRLMKYLNLSSCQPGKHQYKNARQEHTSLP
                     NLLERQFAVPEPDRVWCGDITYLWAGNRWCYLAVVMDLFARRVIGWSLSAHADTALIS
                     SALRMAYETRGQPRDVMFHSDQGSQYTGLKYQQLLWRCRINQSVSRRGNCWDNSPMER
                     FFRSLKTEWVPTNGYAGKDEARQQINDYILNYYNSVRPHHYNGGLTPEESENRIPFFT
                     VKLWPVLLDHYILTGGIRNSVRWGSHTRQSLLPPPHIPAPGLYTIRVG"
     misc_feature    complement(486672..487013)
                     /locus_tag="ECL_00482"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:279057"
     misc_feature    complement(486582..487007)
                     /locus_tag="ECL_00482"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:290341"
     misc_feature    complement(486558..486758)
                     /locus_tag="ECL_00482"
                     /note="Integrase core domain; Region: rve_3; cl22978"
                     /db_xref="CDD:304669"
     gene            complement(487409..487681)
                     /locus_tag="ECL_00483"
                     /db_xref="GeneID:9122992"
     CDS             complement(487409..487681)
                     /locus_tag="ECL_00483"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610998.1"
                     /db_xref="GeneID:9122992"
                     /translation="MNKKTKRTFPPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLES
                     WVRQLRRERQGDYALCHTHYSRPATYPRAGKQVRRLEERKYDIKKG"
     misc_feature    complement(<487415..487681)
                     /locus_tag="ECL_00483"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(<487532..487675)
                     /locus_tag="ECL_00483"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:304362"
     gene            487958..488218
                     /locus_tag="ECL_00484"
                     /db_xref="GeneID:9122993"
     CDS             487958..488218
                     /locus_tag="ECL_00484"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003610999.1"
                     /db_xref="GeneID:9122993"
                     /translation="MTSTLLDAAMTHCLFMQGVQALTAELTVRFISPVCTGEKLMVCA
                     RLLGQRRGIYQLEAWLTKGQQKVARATAKFIVPSQDIALAHR"
     misc_feature    <487958..488185
                     /locus_tag="ECL_00484"
                     /note="The hotdog fold was initially identified in the E.
                     coli FabA (beta-hydroxydecanoyl-acyl carrier protein
                     (ACP)-dehydratase) structure and subsequently in 4HBT
                     (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A
                     number of other seemingly unrelated...; Region: hot_dog;
                     cl00509"
                     /db_xref="CDD:294345"
     misc_feature    order(487967..487969,487976..487981,487988..487990,
                     488021..488029)
                     /locus_tag="ECL_00484"
                     /note="active site 1 [active]"
                     /db_xref="CDD:239524"
     gene            488332..488808
                     /locus_tag="ECL_00485"
                     /db_xref="GeneID:9122994"
     CDS             488332..488808
                     /locus_tag="ECL_00485"
                     /codon_start=1
                     /transl_table=11
                     /product="ferritin Dps family protein"
                     /protein_id="YP_003611000.1"
                     /db_xref="GeneID:9122994"
                     /translation="MSKQIIDIGIAESSRVEIADGLARLLADTYTLYIKTHYYHWNVT
                     GPMFNSLHLMFENQYNELATAVDDIAERIRSLGCFAPGTYHEFSRLTAVNEDKDIPAA
                     KNMIENLVQGQETVVKTARSLFPVVNNANDEATADLLTQRIQLHEKTAWMLRSLLE"
     misc_feature    488347..488805
                     /locus_tag="ECL_00485"
                     /note="DNA-binding ferritin-like protein (oxidative damage
                     protectant) [Inorganic ion transport and metabolism,
                     Defense mechanisms]; Region: Dps; COG0783"
                     /db_xref="CDD:223854"
     misc_feature    order(488428..488433,488443..488445,488449..488454,
                     488485..488487,488518..488520,488530..488532,
                     488539..488544)
                     /locus_tag="ECL_00485"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(488449..488451,488485..488487,488497..488499,
                     488530..488532,488542..488544)
                     /locus_tag="ECL_00485"
                     /note="DPS ferroxidase diiron center [ion binding]; other
                     site"
                     /db_xref="CDD:153102"
     misc_feature    order(488728..488730,488749..488754)
                     /locus_tag="ECL_00485"
                     /note="ion pore; other site"
                     /db_xref="CDD:153102"
     gene            complement(489111..489461)
                     /locus_tag="ECL_00486"
                     /db_xref="GeneID:9122995"
     CDS             complement(489111..489461)
                     /locus_tag="ECL_00486"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsR family transcriptional regulator"
                     /protein_id="YP_003611001.1"
                     /db_xref="GeneID:9122995"
                     /translation="MRMNEDTKRQTDMKNAALGAADVLRGLANSDRLLLMCQLSQGEA
                     NVTELEAAVGITQPTLSQQLGVMRRLKLVETRRAGKMVYYRIGDNRIMTLLNTLYDLY
                     CPQEDTGKESHNNE"
     misc_feature    complement(order(489210..489218,489231..489239,
                     489255..489260,489264..489269,489276..489281,
                     489285..489296,489321..489329,489366..489374,
                     489384..489389))
                     /locus_tag="ECL_00486"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(489168..489359)
                     /locus_tag="ECL_00486"
                     /note="helix_turn_helix, Arsenical Resistance Operon
                     Repressor; Region: HTH_ARSR; smart00418"
                     /db_xref="CDD:197713"
     gene            489623..491281
                     /locus_tag="ECL_00487"
                     /db_xref="GeneID:9122996"
     CDS             489623..491281
                     /locus_tag="ECL_00487"
                     /codon_start=1
                     /transl_table=11
                     /product="putative NADH oxidase"
                     /protein_id="YP_003611002.1"
                     /db_xref="GeneID:9122996"
                     /translation="MKIVIVGGVAGGASAAARARRLSEDVSIVVLERGSNVSFANCGL
                     PYHIGGKIPLRQSLILKTPEDFKSRFNIDVRIYHEVTSVDPVNKTVTVKNLTSGEVYS
                     EEWDRLLLSTGAAPVVPPLPGLQEEGVFTLRNLTDMDAIQAWIEQHNVAHTTLVGGGF
                     IGLEVMEALSERGISVTLLEMGEQVMAPVDPEMASALHQEIRSHGVDLRLRTALNEVL
                     RTETGFRVALSDGEFLQTDMVILAIGVKPENTLATGAGLAVGKRGGISVNACMQTSIP
                     DIYAVGDAVETPDLVFQEPANVPLAGPANRQGRIAADNMLERHSLYHGSQGTSICKVF
                     SLSIGSVGANEKQLKAHGTRYEKVYVHAADHASYYPGATMISLKLLFSPDTGKILGAQ
                     ASGKKGVDKRIDVLAVAQRAGLTVNDLEHLELTYAPPFNSARDVVNQAGMVAANVIKG
                     DTVICHASDVLQREPGSYCFLDIRSPAELKQFGEYPDALSIPLDSLRENLEKLPKDKE
                     IFIGCQSGLRGHVAYRILQAHGFRAYNLSGGFITWKAVMASMNK"
     misc_feature    489686..490945
                     /locus_tag="ECL_00487"
                     /note="NAD(P)H-nitrite reductase, large subunit [Energy
                     production and conversion]; Region: NirB; cl26176"
                     /db_xref="CDD:330997"
     misc_feature    491024..491254
                     /locus_tag="ECL_00487"
                     /note="Rhodanese Homology Domain (RHOD); an alpha beta
                     fold domain found duplicated in the rhodanese protein. The
                     cysteine containing enzymatically active version of the
                     domain is also found in the Cdc25 class of protein
                     phosphatases and a variety of proteins...; Region: RHOD;
                     cl00125"
                     /db_xref="CDD:320771"
     misc_feature    491159..491161
                     /locus_tag="ECL_00487"
                     /note="active site residue [active]"
                     /db_xref="CDD:238089"
     gene            complement(491342..492499)
                     /locus_tag="ECL_00488"
                     /db_xref="GeneID:9122997"
     CDS             complement(491342..492499)
                     /locus_tag="ECL_00488"
                     /codon_start=1
                     /transl_table=11
                     /product="putative sodium-proton antiporter NhaA"
                     /protein_id="YP_003611003.1"
                     /db_xref="GeneID:9122997"
                     /translation="MSANKKKLNGVVRGFISSPAAGGIILILASVAAIVVANSPLLEG
                     YESLLKYKTVGLSTEHWVNDGLMAIFFLFVGLEIKRELLVGQLATWSQRALPGFAALG
                     GVAVPALIYAGFNASNAETLRGWAIPAATDIAFALGVLTLLGRRVPASLKIFLSALAI
                     LDDMGAVAIIAIFYTSHISLMMLGGAMVTALMMFMMNRAGLKRLLPYLVAGCLMWFFM
                     LQSGVHATVAGILVALFIPLKTDSTSGSPLERLEHGLEPWVVFLILPVFGFANAGVSL
                     TGLTAEDLLSPVPVGVATGLFLGKQVGVFGLSLLAVGLGLAQKPKNSSWLQIYGVSVL
                     CGIGFTMSLFIGNLAFAESQLLIDEVKVGVLVGSVLSALTGALIMLLPRQR"
     misc_feature    complement(491345..492478)
                     /locus_tag="ECL_00488"
                     /note="pH-dependent sodium/proton antiporter; Reviewed;
                     Region: nhaA; PRK09560"
                     /db_xref="CDD:236568"
     gene            complement(492486..492602)
                     /locus_tag="ECL_00489"
                     /db_xref="GeneID:9122998"
     CDS             complement(492486..492602)
                     /locus_tag="ECL_00489"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611004.1"
                     /db_xref="GeneID:9122998"
                     /translation="MSSARCLQGQIHVFRISVSKKQPGINFLKGGDTFHERK"
     gene            492796..492933
                     /locus_tag="ECL_00490"
                     /db_xref="GeneID:9122999"
     CDS             492796..492933
                     /locus_tag="ECL_00490"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611005.1"
                     /db_xref="GeneID:9122999"
                     /translation="MMFLKVMAFHLSQPPRPGLMTPDMTLDFQEVCQAVDKSFRPVYF
                     P"
     gene            492947..493855
                     /locus_tag="ECL_00491"
                     /db_xref="GeneID:9123000"
     CDS             492947..493855
                     /locus_tag="ECL_00491"
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic diphosphatase"
                     /protein_id="YP_003611006.1"
                     /db_xref="GeneID:9123000"
                     /translation="MINVFGHLNPDSDAVCTAAVTAGWLNRCNRPARAWRPGEANPET
                     RYIFEAAGLSLPPLLDIPLKGEPVWLVDFTEPAQGPADLLQSNIIGIIDHHRLGGLVT
                     QLPPEVWIKPAGSSATVLWLLMDAEMRRTMPPTHATLLLGALLSDTINLCSPTTTEDD
                     IRTATELCVLSGIKRRAFAHGLMTAKTDISGQSAEQLLNKDLKAFSLAGTDVRIAQLE
                     VNSPEQVAPLLDELQNAMAQMAVTTGAGLIVLMVTDIQECFSTLYFAGPESGNITSCS
                     VPGMVSRKKQLLPWLEHFLSQSRRQP"
     misc_feature    492947..493822
                     /locus_tag="ECL_00491"
                     /note="DHHA2 domain; Region: DHHA2; cl27346"
                     /db_xref="CDD:332167"
     gene            493852..494277
                     /locus_tag="ECL_00492"
                     /db_xref="GeneID:9123001"
     CDS             493852..494277
                     /locus_tag="ECL_00492"
                     /codon_start=1
                     /transl_table=11
                     /product="universal stress protein A"
                     /protein_id="YP_003611007.1"
                     /db_xref="GeneID:9123001"
                     /translation="MKIYTHALVLVQGKEDGVTLLALAATLSRLLQMKITLAHICNDY
                     REMNYVSDGLMDDAVSKDVVQVKALFSELTSSVAEHVDARELVTMRRFEDVQKCITDT
                     GVDLVIAGHRNRFMGALTSRSAEYINHLNVDVLIKHIPN"
     misc_feature    493873..494259
                     /locus_tag="ECL_00492"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(493879..493887,493969..493971,494176..494181,
                     494182..494184,494212..494223)
                     /locus_tag="ECL_00492"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            494294..495583
                     /locus_tag="ECL_00493"
                     /db_xref="GeneID:9123002"
     CDS             494294..495583
                     /locus_tag="ECL_00493"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="YP_003611008.1"
                     /db_xref="GeneID:9123002"
                     /translation="MSFILEKVTAREILDSRGNPTVEVDAFTSDGMMARASVPSGAST
                     GSREATERRDGDATRFGGKGVRDAVKAVDTEICDTVRGTDVREQRRLDNLMRELDGTE
                     NKSRLGANAILGVSLAVARLAAQVTRQPLYRYLGGLNASLLPVPCMNIINGGVHARGQ
                     GADFQEFMIAPHGAPTLAEAVRQGSEVYQALRQILLSRNLSAAVGDEGGFAPAVSSNR
                     EPLEFIVQAIEKAGYRPGEDISICMDPASSEFYRDGKYHLRTESSALSSEEMTDYYGE
                     LMNQFPIVLLEDGLAEDDWAGWKYLHNKLGGRTELVGDDLFVTNVKYIRRGIEEKLAS
                     AALIKLNQIGTLSETFDAVSLCHEHGWGAFISHRSGETMDTFIADMTVALRAGHLKTG
                     APCRGERIEKYNQLMRIEQDLGSEARYAGIKAFVRRG"
     misc_feature    494294..495580
                     /locus_tag="ECL_00493"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     gene            495680..496054
                     /locus_tag="ECL_00494"
                     /db_xref="GeneID:9123003"
     CDS             495680..496054
                     /locus_tag="ECL_00494"
                     /codon_start=1
                     /transl_table=11
                     /product="putative CrcB-like protein"
                     /protein_id="YP_003611009.1"
                     /db_xref="GeneID:9123003"
                     /translation="MGQLSAIMIGGAVGCVIRWFFGVKLNSFFPSLPPGTLVVNLLGA
                     FIIGAAMAYFMRNPQLDPAWKLLIVTGLCGGLTTFSTFSVEVFTLLQVGNYLWALTSV
                     LVHVVGSLLMTAAGFYLITLLA"
     misc_feature    495680..496051
                     /locus_tag="ECL_00494"
                     /note="chromosome condensation membrane protein;
                     Provisional; Region: PRK14196"
                     /db_xref="CDD:184564"
     gene            496424..496843
                     /locus_tag="ECL_00495"
                     /db_xref="GeneID:9123004"
     CDS             496424..496843
                     /locus_tag="ECL_00495"
                     /codon_start=1
                     /transl_table=11
                     /product="UspA domain-containing protein"
                     /protein_id="YP_003611010.1"
                     /db_xref="GeneID:9123004"
                     /translation="MITKILIAYDGSESAKEAMDFAFELAHHFNSELYVMAVCHLTEF
                     GGEVEMLDFVSRTQSYFYQRMRNLRKQYPEMKKKPRLHIATGHPAEQILHYADGHGID
                     HIVVGHRGKKQFSQWLLGSVARQVVDHAPCPVTVTRK"
     misc_feature    496433..496831
                     /locus_tag="ECL_00495"
                     /note="Usp: Universal stress protein family. The universal
                     stress protein Usp is a small cytoplasmic bacterial
                     protein whose expression is enhanced when the cell is
                     exposed to stress agents. Usp enhances the rate of cell
                     survival during prolonged exposure to...; Region:
                     USP_Like; cd00293"
                     /db_xref="CDD:238182"
     misc_feature    order(496445..496453,496535..496537,496739..496744,
                     496748..496753,496781..496792)
                     /locus_tag="ECL_00495"
                     /note="Ligand Binding Site [chemical binding]; other site"
                     /db_xref="CDD:238182"
     gene            complement(496875..496988)
                     /locus_tag="ECL_00496"
                     /db_xref="GeneID:9123005"
     CDS             complement(496875..496988)
                     /locus_tag="ECL_00496"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611011.1"
                     /db_xref="GeneID:9123005"
                     /translation="MDYLITTLILLSLGLICVFAFSLWSLNRTSRKKNKRK"
     gene            497520..498644
                     /locus_tag="ECL_00497"
                     /db_xref="GeneID:9123006"
     CDS             497520..498644
                     /locus_tag="ECL_00497"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS
                     domain-containing protein"
                     /protein_id="YP_003611012.1"
                     /db_xref="GeneID:9123006"
                     /translation="MTNFRNYLSGYIDSENFKSLSAMANRIKDNLEGIRYNLRIKGDT
                     INVEHHADEINYSDKIINVFSKFKQRDVTVKLDFKSHDTVMTNVEARILECVARLFPS
                     VFSELDTFIETRSDYQSHTLNIFEREIQFYLASIEYFRNFQNAGLSFCIPEINVNNKN
                     ITVTNGFDLALAYSLLKKKENVVCNDFQLRECERILVVSGPNQGGKTTFARMIGQLHY
                     LALLGLYVPAEDANLFLVDNIFTHFEKSENIHNLRGKLYDDLVRIKSILDVATSKSLI
                     IMNEIFTSTTSHDALYLGTQIIKKIVMLDALCVCVTFIDELTRLDRAIVSMMSTVEND
                     ERASRTYRIARKPSDGVAWSATLVQKYGLTYEKIKGEVNG"
     misc_feature    <497577..498626
                     /locus_tag="ECL_00497"
                     /note="MutS domain III; Region: MutS_III; cl27055"
                     /db_xref="CDD:331876"
     misc_feature    498045..498566
                     /locus_tag="ECL_00497"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl25403"
                     /db_xref="CDD:330224"
     misc_feature    498117..498140
                     /locus_tag="ECL_00497"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(498126..498131,498135..498143,498249..498251,
                     498354..498359,498456..498458)
                     /locus_tag="ECL_00497"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    498240..498251
                     /locus_tag="ECL_00497"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    498264..498305
                     /locus_tag="ECL_00497"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    498342..498359
                     /locus_tag="ECL_00497"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    498366..498377
                     /locus_tag="ECL_00497"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    498444..498464
                     /locus_tag="ECL_00497"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            498641..500149
                     /locus_tag="ECL_00498"
                     /db_xref="GeneID:9123007"
     CDS             498641..500149
                     /locus_tag="ECL_00498"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein MutS
                     domain-containing protein"
                     /protein_id="YP_003611013.1"
                     /db_xref="GeneID:9123007"
                     /translation="MNVYLMYKDADFVLDDIFPDNFNIQVRDLGLDVLFQSLSAGDEF
                     LYSVVKKACSQSLADVPCIEYRQAILRDCLYNSNIIREFYQAVLECLTMEKEKLHYIV
                     FGHSPSAMLHQSISFTRFFLENLKKVRAIAEKNIYFFESSGMTRLLKMIIQELNEDYL
                     RGIEEHLKQMDFKRGVLMSAKLGPGSRGDEYILREPNSPDKCWFRRIFSRRPEHYSVQ
                     IAPRDENGFRALSDLRDEGLVLVASAMAQSTEHLRNFFKSLRAELGFYVCCINLAEEL
                     NKRNLPQCFPVPVYKRERRLVFESLYDVCLGLTSDKNIVGNTLKTDNKNTFIITGANQ
                     GGKSTFLRSIGLAQIMMQSGMFVVAEYFCTDICGQIFTHYKCEEDSSMVSGKLDEELL
                     RMRDIVDLLEQDDLVLFNESFSATNSREGADIIRGIVMALAESRVKIFFVTHCSEFAC
                     AFYQEFHPDTEYLCAERRDDGERTFRIEEGAPMDTSFGEDLYQAVFTSDELA"
     misc_feature    <498806..500104
                     /locus_tag="ECL_00498"
                     /note="MutS domain III; Region: MutS_III; cl27055"
                     /db_xref="CDD:331876"
     misc_feature    499529..500104
                     /locus_tag="ECL_00498"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl25403"
                     /db_xref="CDD:330224"
     misc_feature    499631..499654
                     /locus_tag="ECL_00498"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(499640..499645,499649..499657,499763..499765,
                     499868..499873,499970..499972)
                     /locus_tag="ECL_00498"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    499754..499765
                     /locus_tag="ECL_00498"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    499778..499819
                     /locus_tag="ECL_00498"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    499856..499873
                     /locus_tag="ECL_00498"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    499880..499891
                     /locus_tag="ECL_00498"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    499958..499978
                     /locus_tag="ECL_00498"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            complement(500474..500593)
                     /locus_tag="ECL_00499"
                     /db_xref="GeneID:9123008"
     CDS             complement(500474..500593)
                     /locus_tag="ECL_00499"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611014.1"
                     /db_xref="GeneID:9123008"
                     /translation="MYLEQTDENNVMDLHIPTGVPVLYEMSEDKTISGRYILE"
     misc_feature    complement(500480..>500590)
                     /locus_tag="ECL_00499"
                     /note="Histidine phosphatase domain found in a
                     functionally diverse set of proteins, mostly phosphatases;
                     contains a His residue which is phosphorylated during the
                     reaction; Region: HP; cl11399"
                     /db_xref="CDD:299704"
     gene            complement(500709..501677)
                     /locus_tag="ECL_00500"
                     /db_xref="GeneID:9123009"
     CDS             complement(500709..501677)
                     /locus_tag="ECL_00500"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_003611015.1"
                     /db_xref="GeneID:9123009"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
     misc_feature    complement(501243..501578)
                     /locus_tag="ECL_00500"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:290455"
     misc_feature    complement(500754..501284)
                     /locus_tag="ECL_00500"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:307645"
     gene            complement(501699..502022)
                     /locus_tag="ECL_00501"
                     /db_xref="GeneID:9123010"
     CDS             complement(501699..502022)
                     /locus_tag="ECL_00501"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoglyceromutase"
                     /protein_id="YP_003611016.1"
                     /db_xref="GeneID:9123010"
                     /translation="METLNLLWLPVSKTWRLNERHYGALQGMRKDEAAQQMGEELVYH
                     WRKSYRGIPPLLAAAPQLLHREARYHHIALSDLPKGESLEMALRRVIPYWQHVIAPRV
                     VSGLC"
     misc_feature    complement(<501708..>502022)
                     /locus_tag="ECL_00501"
                     /note="Histidine phosphatase domain found in a
                     functionally diverse set of proteins, mostly phosphatases;
                     contains a His residue which is phosphorylated during the
                     reaction; Region: HP; cl11399"
                     /db_xref="CDD:299704"
     gene            complement(503098..503217)
                     /locus_tag="ECL_00502"
                     /db_xref="GeneID:9123011"
     CDS             complement(503098..503217)
                     /locus_tag="ECL_00502"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611017.1"
                     /db_xref="GeneID:9123011"
                     /translation="MIFVREWITHQDIHQFFFVLRESEYQVNNTCLFPVVTHR"
     gene            complement(503407..503583)
                     /locus_tag="ECL_00503"
                     /db_xref="GeneID:9123012"
     CDS             complement(503407..503583)
                     /locus_tag="ECL_00503"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611018.1"
                     /db_xref="GeneID:9123012"
                     /translation="MEGTRQRSAARWPSGYSSTASWCHLSSASEGKRLRHCQNIDASS
                     SDQREYYAPTISGD"
     gene            504078..504194
                     /locus_tag="ECL_00504"
                     /db_xref="GeneID:9123013"
     CDS             504078..504194
                     /locus_tag="ECL_00504"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611019.1"
                     /db_xref="GeneID:9123013"
                     /translation="MKMIFMWLRNAMVYRQGYRLEKSPLVALYFATEKIQMS"
     misc_feature    <504141..504185
                     /locus_tag="ECL_00504"
                     /note="FRG domain; Region: FRG; cl07460"
                     /db_xref="CDD:323959"
     gene            505868..506752
                     /locus_tag="ECL_00505"
                     /db_xref="GeneID:9123014"
     CDS             505868..506752
                     /locus_tag="ECL_00505"
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA-binding prophage protein"
                     /protein_id="YP_003611020.1"
                     /db_xref="GeneID:9123014"
                     /translation="MAKLNKNLKTLARQAGGSFKTVADRMKIADRFAARLQSLNIQIR
                     DIKNIKTGHVELYVRSRLAEDISKRTLQNEMSAIRSLLRVAGKTFMADPSHEKLSNEA
                     LNISGTSRDGTKVAITDEHLDSVLSLVKEKDEGVAVAIQLSRLLGLRTEETIQSVKSL
                     STWKKALQNGENKIRVVFGTKGGRPRDTTIIKREETLKLLSSALKYTAEHNGKLIDKP
                     SLHLAIERYRNIVREAGMVGEFAPHSLRYAYTQDVIGLYLEHGFSVKEAQALASMDLG
                     HGDGRGHYVARIYSKTKS"
     misc_feature    505868..506140
                     /locus_tag="ECL_00505"
                     /note="Phage integrase, N-terminal; Region:
                     Phage_int_SAM_2; pfam12834"
                     /db_xref="CDD:315501"
     misc_feature    506180..506623
                     /locus_tag="ECL_00505"
                     /note="Integrase; Region: Integrase_1; pfam12835"
                     /db_xref="CDD:315502"
     misc_feature    order(506270..506272,506312..506317,506537..506539,
                     506543..506545,506594..506596)
                     /locus_tag="ECL_00505"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    order(506312..506314,506594..506596,506603..506605,
                     506696..506698)
                     /locus_tag="ECL_00505"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            506829..507272
                     /locus_tag="ECL_00506"
                     /db_xref="GeneID:9123015"
     CDS             506829..507272
                     /locus_tag="ECL_00506"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611021.1"
                     /db_xref="GeneID:9123015"
                     /translation="MNVLKVSRLVKVANRASFFDFISLVSEIEGRLKLLHAYSILFAI
                     DGKGDSYFSFEHVSRTTFLVTERLMEYKLLGLIPDHRVKCLDDIFEQCKQVLGDKKWN
                     MAVTGGTVVAQDVLDTYAETFLTTYVEESDTRFLKDFVQWYLSTC"
     gene            507559..507948
                     /locus_tag="ECL_00507"
                     /db_xref="GeneID:9123016"
     CDS             507559..507948
                     /locus_tag="ECL_00507"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611022.1"
                     /db_xref="GeneID:9123016"
                     /translation="MTFLHIVYFVAVFADRFVCFIAPKTLIAEWFFWFTGDAKSLLLV
                     VRELELARSYQKDEASVLLTEFSVYHAAFFFGEREYYGLKVRWPRWFINRLHFTGMQL
                     DATQWQEGCQNGFSDAAALESRATAHC"
     gene            508031..508393
                     /locus_tag="ECL_00508"
                     /db_xref="GeneID:9123017"
     CDS             508031..508393
                     /locus_tag="ECL_00508"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611023.1"
                     /db_xref="GeneID:9123017"
                     /translation="MTAFAITVDVLAASIHSKTGFISVMSEIEGLLQSATALNICGIP
                     DSIDLDGFPERCSQTIHLASVVGEAQEMNLIPDSLRQFVDDVVLTGKRFDAEGDTNAW
                     CYGFKLGTERGLANWSGV"
     gene            508517..508813
                     /locus_tag="ECL_00509"
                     /db_xref="GeneID:9123018"
     CDS             508517..508813
                     /locus_tag="ECL_00509"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611024.1"
                     /db_xref="GeneID:9123018"
                     /translation="MLILASKAASALAHVSESLNQRKKEWFTNQSGHSSFRPEVIPDG
                     NGFTAIISRRTGYSPKDWTYQRCATAGRFASSRQAMNAGRRMAQQLADLRYRFD"
     gene            508867..509334
                     /locus_tag="ECL_00510"
                     /db_xref="GeneID:9123019"
     CDS             508867..509334
                     /locus_tag="ECL_00510"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611025.1"
                     /db_xref="GeneID:9123019"
                     /translation="MASFYSEVFNMTVFNDIAFDRSYAPQGMHELWQGQRSLSRFIAY
                     VAELEGELLAIRAFRRCAIPDLTGSYGVPVRTFRLVSIARLIGYACMTGAFTDGLFEK
                     YIAGLILLGEQIAPRAWNFGFSEGQMHFDEMRSDDEASEEQRAVFCASADYIA"
     gene            509444..510055
                     /locus_tag="ECL_00511"
                     /db_xref="GeneID:9123020"
     CDS             509444..510055
                     /locus_tag="ECL_00511"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611026.1"
                     /db_xref="GeneID:9123020"
                     /translation="MIRFTSDELRPLFTQNLGMQRPLILEKKLGIYLRVPDDRRPGEW
                     LKAWAAGCNPLKDADWFTLVDTLIPEHEFSFQTFMAQSMFDAVLNDHHDLLMKPVISK
                     LNNALTLHKGTRPPMKVYVPVGEYRYRIQWLYEQSLRHFHACVGDAERLSWRSQALHV
                     LDQVIRLDSKRAKPADRERFDRAVESVRDRIRSVMSDGSLRYY"
     misc_feature    509507..>509626
                     /locus_tag="ECL_00511"
                     /note="Protein of unknown function (DUF3085); Region:
                     DUF3085; pfam11284"
                     /db_xref="CDD:314267"
     gene            510128..511111
                     /locus_tag="ECL_00512"
                     /db_xref="GeneID:9123021"
     CDS             510128..511111
                     /locus_tag="ECL_00512"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611027.1"
                     /db_xref="GeneID:9123021"
                     /translation="MKITTGRRKPAAVQTPDLYQQVTDKIILALENGVPPWRRPWRSA
                     QNVHGGSLPVNAVTGRAYSGINVPLLWMAAEEHGYTSDRWLTFRQAKAVGGYVRKNET
                     SALAIIYKPFEKQARDSSDNLLYRDGEPVMEQLAMLKQLQLFNVAQCDGLPESVQGEQ
                     PNTVEAEPPSELSAAQLQQVQQILSTTGVGCDHRRQDRAFYRPGADRIVMPTASQFRT
                     EADYWSTLLHELVHATGHSSRLNREGITSSSRKFGDPVYAFEELIAETGSAFLCVELG
                     ITGDVQHESYLAGWLKALREDKRAIFRACRFAREASEYLLAPLNRNTEQAA"
     misc_feature    510143..511105
                     /locus_tag="ECL_00512"
                     /note="Domain of unknown function (DUF1738); Region:
                     DUF1738; cl26762"
                     /db_xref="CDD:331583"
     gene            511208..512158
                     /locus_tag="ECL_00513"
                     /db_xref="GeneID:9123022"
     CDS             511208..512158
                     /locus_tag="ECL_00513"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611028.1"
                     /db_xref="GeneID:9123022"
                     /translation="MFSWCQNRLEITGKSVCLDVMQPWIAGTEKPLYRHAIRQAIKLF
                     LAGCAGILKPVRAVDYAPYPMLTASGTGAQTSPNQAFQHFIELLEQNAWLDSKTLSRM
                     EKIWLQSGIDALKWEAIPFAARQIMAQLMAVHYADWFGVAGAGGQFDPQERWESLSIM
                     PETTCPCDMLMVMPSRLASELNGEGGLFTGLCITSELYMQLFGMEFPAGHQASWSRDD
                     VGSLTLSFASPWYPPSGEVMGIMSQMFDCEIRHYWISPDAGTSGFNCFDRGDHVDSGP
                     YQAEALRQSASGDGARMYLVTPETAAVPATTAAHYGSIRA"
     misc_feature    511253..511624
                     /locus_tag="ECL_00513"
                     /note="Protein of unknown function (DUF1281); Region:
                     DUF1281; pfam06924"
                     /db_xref="CDD:311089"
     gene            512285..512971
                     /locus_tag="ECL_00514"
                     /db_xref="GeneID:9123023"
     CDS             512285..512971
                     /locus_tag="ECL_00514"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611029.1"
                     /db_xref="GeneID:9123023"
                     /translation="MKSVINHEKAFLSLFSQTARYHHRHQVFEDFVSCSVIALQNSLQ
                     FCDKREEKYMRIVGRYEKTDISRMAQLLAHVTNGLDETPGDFLGRVFMQLELGDKYRG
                     QFFTPWNIGLMMARMQLGNVEDNFRDKPFITLSEPACGAGCMALAFAFVLREAGYSPH
                     RYLWVSAQDIDPLAAGMAYIQLSLSGVPGEVVIGNSLNDERRRILHTPAHYMGNWSFL
                     LQTRMNAAVA"
     misc_feature    <512363..>512746
                     /locus_tag="ECL_00514"
                     /note="N-6 DNA Methylase; Region: N6_Mtase; cl28090"
                     /db_xref="CDD:332911"
     gene            complement(513019..513147)
                     /locus_tag="ECL_00515"
                     /db_xref="GeneID:9123024"
     CDS             complement(513019..513147)
                     /locus_tag="ECL_00515"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611030.1"
                     /db_xref="GeneID:9123024"
                     /translation="MWDTKPFTDNYVDFFRLGFLGSYIIPLILVFLSGIFDNFSDM"
     gene            complement(513444..513611)
                     /locus_tag="ECL_00516"
                     /db_xref="GeneID:9123025"
     CDS             complement(513444..513611)
                     /locus_tag="ECL_00516"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611031.1"
                     /db_xref="GeneID:9123025"
                     /translation="MKYYHHLIYTFRLTRLLLRREIPLRIFIFALQTKPGAVAGKHGS
                     YIVDPFYDDLG"
     gene            complement(513684..514565)
                     /locus_tag="ECL_00517"
                     /db_xref="GeneID:9123026"
     CDS             complement(513684..514565)
                     /locus_tag="ECL_00517"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transposase"
                     /protein_id="YP_003611032.1"
                     /db_xref="GeneID:9123026"
                     /translation="MDSARALVAKGRGIALVSRTMGVSRAQLSLRINRSADWQDRRCN
                     RRDDEADAEILSEILDIISDMPSYGYRRVWGILRTQRRTEGLPPVNAKRLYRLMSEHN
                     LLLLHDKPERSKREHKGKIAVAESDMRWCSDGFEFGCDNGEKLRVTFALDCCDREAID
                     WAASTGGYDSSTVQDVMLRSVEKRFGDGLPTTPVQWLTDNGSAYTAHETRRFARELNL
                     EPCTTAVSSPQSNGMAERFVKTMKEDYIAFMPKPDVRTALRNLAAAFTHYNENHPHSA
                     LGYHSPREYRRQRTSLT"
     misc_feature    complement(513699..514565)
                     /locus_tag="ECL_00517"
                     /note="HTH-like domain; Region: HTH_21; cl26233"
                     /db_xref="CDD:331054"
     gene            complement(514523..514918)
                     /locus_tag="ECL_00518"
                     /db_xref="GeneID:9123027"
     CDS             complement(514523..514918)
                     /locus_tag="ECL_00518"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611033.1"
                     /db_xref="GeneID:9123027"
                     /translation="MSNTNANFEMTGILLGQEVRKRKTPQEKIAIIQQTMEPGMNVSH
                     VARLHGIQPSLLFKWKKQYQEGSLTAVAAGEEVVPASELTAALKQVRELQRLLGKKTM
                     EVEILKEAVEYAQSRKWIAHAPLLPKDGE"
     misc_feature    complement(514526..514879)
                     /locus_tag="ECL_00518"
                     /note="Helix-turn-helix domains; Region: HTH; cl21459"
                     /db_xref="CDD:328727"
     gene            complement(514967..515458)
                     /locus_tag="ECL_00519"
                     /db_xref="GeneID:9123028"
     CDS             complement(514967..515458)
                     /locus_tag="ECL_00519"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611034.1"
                     /db_xref="GeneID:9123028"
                     /translation="MIELPDLPKHLPKAEVPDGRFSRPKNKITKAQRAELRMKFGGRC
                     AYCGCFLPEKGWHADHVEPVRRDFEYVLAPVGSGVTHVARNTGKVLHPDLHTIENLFP
                     ACAPCNLFKGAFSVEGMRKEISQQVERARTYSVNFRTAERFGLVEIVDKPVVFWFEHD
                     VAP"
     misc_feature    complement(515132..515344)
                     /locus_tag="ECL_00519"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    complement(order(515135..515137,515144..515149,
                     515159..515164,515270..515272,515276..515284,
                     515288..515290))
                     /locus_tag="ECL_00519"
                     /note="active site"
                     /db_xref="CDD:238038"
     gene            complement(515489..516328)
                     /locus_tag="ECL_00520"
                     /db_xref="GeneID:9123029"
     CDS             complement(515489..516328)
                     /locus_tag="ECL_00520"
                     /codon_start=1
                     /transl_table=11
                     /product="IS911 orfA"
                     /protein_id="YP_003611035.1"
                     /db_xref="GeneID:9123029"
                     /translation="MATLCHVFGVHRSSYKYWKNRPEKPDGRRAVLRSQVLELHGISH
                     GSAGARSIATMATQRGYQMGRWLAGRLMKELGLVSCQQPTHRYKRGGHEHVAIPNHLE
                     RQFAVTEPNQVWCGDVTYIWTGKRWAYLAVVLDLFARKPVGWAMSFSPDSRLTMKALE
                     MAWETRGKPVGVMFHSDQGSHYTSRQFRQLLWRYRIRQSMSRRGNCWDNSPMERFFRS
                     LKNEWVPATGYVSFSDAAHAITDYIVGYYSALRPHEYNGGLPPNESENRYWKNSNAVA
                     SFC"
     misc_feature    complement(515498..516307)
                     /locus_tag="ECL_00520"
                     /note="putative transposase OrfB; Reviewed; Region:
                     PHA02517"
                     /db_xref="CDD:222853"
     gene            complement(516355..516564)
                     /locus_tag="ECL_00521"
                     /db_xref="GeneID:9123030"
     CDS             complement(516355..516564)
                     /locus_tag="ECL_00521"
                     /codon_start=1
                     /transl_table=11
                     /product="IS911 orfB"
                     /protein_id="YP_003611036.1"
                     /db_xref="GeneID:9123030"
                     /translation="MDVGLSTMTRWVKQLRDERQGKTPKASPITPEQIEIRELRKKLQ
                     RIEMENEILKKATALLMSDSLNSSR"
     misc_feature    complement(516364..>516549)
                     /locus_tag="ECL_00521"
                     /note="Transposase and inactivated derivatives [Mobilome:
                     prophages, transposons]; Region: InsE; COG2963"
                     /db_xref="CDD:225511"
     gene            complement(516627..517451)
                     /locus_tag="ECL_00522"
                     /db_xref="GeneID:9123031"
     CDS             complement(516627..517451)
                     /locus_tag="ECL_00522"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611037.1"
                     /db_xref="GeneID:9123031"
                     /translation="MNNDMLTLAAKKYLSTFADHRNNPTNYEALTAWDNATSEFMALV
                     NNDELNIIASLLAGREADKTDNSQLRQRIADLEARPVAPFDFKETTDADYCREWAWRA
                     IKKDLPTEHWKTGENGTFYAFYLMGWHARLQYNEQRRSEYSQIADTILKTRTVSINTE
                     PWRSFVSDDDITALNRFAECCDDPESGGHDLEKEQVKRLEKIGLLRRSGRISFTTDFG
                     DFVLSAAGINLNLEMGEQVCPGLKWFTEFGHLNRGDMLTSEQHRCHNEKKKFQRRV"
     gene            complement(517448..517927)
                     /locus_tag="ECL_00523"
                     /db_xref="GeneID:9123032"
     CDS             complement(517448..517927)
                     /locus_tag="ECL_00523"
                     /codon_start=1
                     /transl_table=11
                     /product="appr-1-p processing domain-containing protein"
                     /protein_id="YP_003611038.1"
                     /db_xref="GeneID:9123032"
                     /translation="MTLTVLPGDLFEQEADCLINAWNMNFIPWWLLWPKGVSGRLKQL
                     AGPEPFRQLARTGVMRPGTVCLTDGGKLKTPIIHAAALNMFWCSSESIVHCCTDAALN
                     LAAVKGFHSVAFPLLGSGIGGLTPSLSLEAMTRAIEINPYSKTLDIKIITYRKGDAV"
     misc_feature    complement(517514..517921)
                     /locus_tag="ECL_00523"
                     /note="Macro domain, a high-affinity ADP-ribose binding
                     module found in a variety of proteins as a stand-alone
                     domain or in combination with other domains like in
                     histone macroH2A and some PARPs (poly ADP-ribose
                     polymerases). Some macro domains recognize poly...;
                     Region: Macro; cl00019"
                     /db_xref="CDD:320715"
     misc_feature    complement(order(517562..517570,517574..517576,
                     517814..517819,517823..517825,517859..517861,
                     517901..517903))
                     /locus_tag="ECL_00523"
                     /note="ADP-ribose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239150"
     gene            complement(517924..518577)
                     /locus_tag="ECL_00524"
                     /db_xref="GeneID:9123033"
     CDS             complement(517924..518577)
                     /locus_tag="ECL_00524"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611039.1"
                     /db_xref="GeneID:9123033"
                     /translation="MVQLQTQLNAIHERIAEAQNIVARRERSVKRAERNLEIAEDNLA
                     QLQNERDELLIASWGDIPNWQVIFDLVNPSPAMYEYKEKWVREKGLHAGGMYNCHTNQ
                     GAFSVGFTTTSEHELYQNIRMVEFVMQYLRTDHNNEKTMIVYNVPTDNCCHNFVFNTG
                     TGKYGITTDSYMSRSNITEFSTAEEALRYLQSISDTDIVPEPESLPGAVIYPDGDEE"
     misc_feature    complement(518347..>518568)
                     /locus_tag="ECL_00524"
                     /note="G-rich domain on putative tyrosine kinase; Region:
                     GNVR; cl26080"
                     /db_xref="CDD:330901"
     gene            complement(518593..519129)
                     /locus_tag="ECL_00525"
                     /db_xref="GeneID:9123034"
     CDS             complement(518593..519129)
                     /locus_tag="ECL_00525"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611040.1"
                     /db_xref="GeneID:9123034"
                     /translation="MIKMFSVVSLTTLLLTLTGCSGSSPLNDLSLSRLTSLINPVSQQ
                     QTQNSAEPNQRNYVGQFYGPIPIPAETVAMRLKQHYGFVSDIDVAAAHNSGQGNAGWS
                     ASAISEGTSWEAQPGNYYRMSRNWAENDRLTLDVRGNSKESFITATYISSNPEHLKKT
                     WTSRLWKQIPDVASGSLK"
     gene            complement(519202..520398)
                     /locus_tag="ECL_00526"
                     /db_xref="GeneID:9123035"
     CDS             complement(519202..520398)
                     /locus_tag="ECL_00526"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611041.1"
                     /db_xref="GeneID:9123035"
                     /translation="MITRCISVALLVSAVPSVYAATGWMEARGDAMGGTGVASAHYGT
                     AALSNPALLTHFGPTDYFSLVLPSVGAQVSDPDNTVDKADDVKDLWDRFDAAADSQSG
                     VSESAAALKNKLQDLKDTHANGQVGASVVATVPNQTLPFAVVVKSWGTVSVEGKVSDH
                     DLDYLDKVADGDIPPSAVDKNSLTSKAYGRAAVITDVGVAMAHEFETAGQRWSLGITP
                     KYQRIDLFNYNVSVRDFDKSDIHSGDYRNTKTGFNADLGLATDLTDNWTLGLAVLNVI
                     PRSVETKPVNGSTGTFKVKPQATAGAAWHSGFITTALDVDLTEASRFDTDKKRQFASA
                     GVELNAWSWMQVRAGYRQNIISNDGSAFTAGLGFSPFDVVHLDITGIAGTDRTYGAVA
                     QMQFTF"
     misc_feature    complement(519451..520254)
                     /locus_tag="ECL_00526"
                     /note="F plasmid transfer operon, TraF, protein; Region:
                     TraF_2; pfam13729"
                     /db_xref="CDD:316268"
     gene            520382..520522
                     /locus_tag="ECL_00527"
                     /db_xref="GeneID:9123036"
     CDS             520382..520522
                     /locus_tag="ECL_00527"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611042.1"
                     /db_xref="GeneID:9123036"
                     /translation="MQRVIIETEAFIIYFLFSFMVFKAKESPDAGAPVKTGYSVNSDG
                     TG"
     gene            complement(520505..521494)
                     /locus_tag="ECL_00528"
                     /db_xref="GeneID:9123037"
     CDS             complement(520505..521494)
                     /locus_tag="ECL_00528"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611043.1"
                     /db_xref="GeneID:9123037"
                     /translation="MKHLNMTSLLARIALERDDELLQLTAAMSDGKKTSGNPMAIRFK
                     PAVGDFIILMSGRLGISAAALVNIMIEGVMRETLTPHQAAVTRIPERFWLLMDEYNLS
                     SPEVAHLLADWNMSLGVLENRERTLGYMTPPLLEKLSEWFYVSTGWLSGKIVPPVRIT
                     VFPDWLDASRLLTCRIQEINPEDFIARPDLFFIRKKEQDDIFLFIRRYTTINDTRFRV
                     VECAGRCSVSGESGKQFTLFLALCGLLFKAEVLSLVDTFIDSGNILDSMISGEVLPPA
                     ALREIQKPFHDSHGKYTQRIWSTEEREPFLNPDNFINDEWRKIAEDIISTRSI"
     gene            complement(521669..522229)
                     /locus_tag="ECL_00529"
                     /db_xref="GeneID:9123038"
     CDS             complement(521669..522229)
                     /locus_tag="ECL_00529"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611044.1"
                     /db_xref="GeneID:9123038"
                     /translation="MQQACVFSFFLLWLGLSGVMGLEITGGVPCSGFYLVWVLLSGLP
                     FLLRPLAWAERRFRPKMTLISQHGKRAWVHLAPWQPTTDLTPSRVCLFWQNVNASTCQ
                     ALETHRTVIISSHLLTGIRARRLLAHTTEYGLTVRSRIYQIPFTPWKRALMQLEILFR
                     QWRWRTDFRRDWPVLVLRRKSLNTEK"
     gene            complement(522391..522513)
                     /locus_tag="ECL_00530"
                     /db_xref="GeneID:9123039"
     CDS             complement(522391..522513)
                     /locus_tag="ECL_00530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611045.1"
                     /db_xref="GeneID:9123039"
                     /translation="MAPAGSLSPGRFSCLLLPVNQLSPRTITSAGICLLKMTLR"
     gene            522605..524014
                     /locus_tag="ECL_00531"
                     /db_xref="GeneID:9123040"
     CDS             522605..524014
                     /locus_tag="ECL_00531"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611046.1"
                     /db_xref="GeneID:9123040"
                     /translation="MLTENSPLSQQVTEAWWLRPLEEMAGRVQACPGAWSGPFSGPGG
                     FNELSLNVATRAVRLVRGMMLPPGATPEEQAEQMPGWVCAAYWAGLFHHLPWLMQVEG
                     ALKSGRVWYPGLSVPGEPWRVRPAGEPPGATGSVYVAFRLLPEAALLWLQRWPVLSDT
                     LLLFLSGRRAEAGILNSIVNDALRSCGLSDTAVMSGQPPDPVSLVTVVPVTGHTFPKL
                     YETDSIPLSSNDNSPDVSVPIKTGDMTYSFSQDGEKTSVNTVPSALVLESALSTHEPL
                     LSAENDISRDEEGGAQVSTENLLSLLDLMAEGKSSVVTENVPADSADSPPATELPPGT
                     HPSHEEGMDKEEQAGALFLEWVRDSVEDGTLSVNEKDSILHVLAQFVFMVSPACFYRH
                     TSTAEGSVTDKDRLQKSFEALNVHHSRNGKGLFHYHQYDTPDKSGRFTKVSGYMINAD
                     IIFKKGSCLTDSIWLSAKK"
     misc_feature    522605..523171
                     /locus_tag="ECL_00531"
                     /note="integrating conjugative element relaxase, PFL_4751
                     family; Region: ICE_TraI_Pfluor; TIGR03760"
                     /db_xref="CDD:163472"
     misc_feature    523658..523945
                     /locus_tag="ECL_00531"
                     /note="Putative conjugal transfer nickase/helicase TraI
                     C-term; Region: TraI_2_C; pfam07515"
                     /db_xref="CDD:284848"
     gene            524049..525014
                     /locus_tag="ECL_00532"
                     /db_xref="GeneID:9123041"
     CDS             524049..525014
                     /locus_tag="ECL_00532"
                     /codon_start=1
                     /transl_table=11
                     /product="putative integrase"
                     /protein_id="YP_003611047.1"
                     /db_xref="GeneID:9123041"
                     /translation="MADIVTFEKILDDYFFNKVLRRATEWSYRKVVRTFLEFYGEDIL
                     PENVTRMDVLKWRRYVLNEQMSSKRTWNNKVAHMRAVFNHAITNKLISARENPFNQVI
                     VKPDIKRKKTLSGEQMKKIDLIMERKIELEQMGVHDPRPNALEPAWFWMTVIETLKFT
                     GMRQNQLLHIRLCDVDLKLGIIELQAEGSKNHREHRVPITARLRPRLEQLYLMSVQKG
                     SKKGEQLFNINRFTPKKKRIIRAKNMDHLPMRAFFRRLSRECQCDISPHRFRHTIATD
                     LMKRPERSLNDVQMLLGHSSVAVTLEYVEANMDNLRRNLEAAYAA"
     misc_feature    524049..525008
                     /locus_tag="ECL_00532"
                     /note="Integrase [Replication, recombination and repair,
                     Mobilome: prophages, transposons]; Region: XerC; COG0582"
                     /db_xref="CDD:223655"
     misc_feature    524496..524960
                     /locus_tag="ECL_00532"
                     /note="DNA breaking-rejoining enzymes, C-terminal
                     catalytic domain; Region: DNA_BRE_C; cd00397"
                     /db_xref="CDD:271175"
     misc_feature    order(524535..524540,524790..524792,524796..524798,
                     524847..524849,524955..524957)
                     /locus_tag="ECL_00532"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:271175"
     misc_feature    order(524535..524537,524847..524849,524856..524858,
                     524928..524930,524955..524957)
                     /locus_tag="ECL_00532"
                     /note="active site"
                     /db_xref="CDD:271175"
     gene            complement(525298..525373)
                     /locus_tag="ECL_tRNA010"
                     /db_xref="GeneID:9123042"
     tRNA            complement(525298..525373)
                     /locus_tag="ECL_tRNA010"
                     /product="tRNA-Phe"
                     /db_xref="GeneID:9123042"
     gene            complement(525493..526068)
                     /locus_tag="ECL_00533"
                     /db_xref="GeneID:9127678"
     CDS             complement(525493..526068)
                     /locus_tag="ECL_00533"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_003611048.1"
                     /db_xref="GeneID:9127678"
                     /translation="MQREDVLGQALQLLEIQGIASTTLEMVADRIDYPLDELTRFWPD
                     KEALLYDALRYLSQQVDIWRRQLMLNEELTAEQKLLARYTALTECVSNNRYPGCLFIA
                     ACTYYPDPGHPIHQLADQQKRAAHDFTHELLTTLEVDDPAMVAKQMELVLEGCLSRML
                     VNRSQADVDTAHRLAEDILRFAQCRMGGALT"
     misc_feature    complement(525496..526068)
                     /locus_tag="ECL_00533"
                     /note="putative transcriptional regulator; Provisional;
                     Region: PRK11640"
                     /db_xref="CDD:183252"
     gene            complement(526117..527817)
                     /locus_tag="ECL_00534"
                     /db_xref="GeneID:9123043"
     CDS             complement(526117..527817)
                     /locus_tag="ECL_00534"
                     /codon_start=1
                     /transl_table=11
                     /product="thiol:disulfide interchange protein"
                     /protein_id="YP_003611049.1"
                     /db_xref="GeneID:9123043"
                     /translation="MAQRFLTLILLLCSTSVFAGLFDAPGRSNFIPADQAFVFDFQQN
                     QHDLNLTWQVKEGYYLYRKQVSITPAQASVGALQLPAGEWHEDEFYGKSEIYRQHLSV
                     PVTVQQADKGATLTVTYQGCADAGFCYPPETRIVPLSEVKASAANVAPLPAEVKREGE
                     PASDLPFSALWALLIGIGIAFTPCVLPMYPLISGIVLGGKQRLSTARALLLAFIYVQG
                     MALTYTALGLVVAAAGLQFQAALQHPYVLIGLSVMFILLALSMFGLFTLQLPSSLQTR
                     LTLLSNRQQGGSAGGVFAMGAIAGLICSPCTTAPLSAILLYIAQSGNMWLGGGTLYLY
                     ALGMGLPLILVTVFGNRLLPKSGPWMETVKTAFGFVILALPVFLLERIVGDVWGMRLW
                     AMLGVAFFSWAFIVSLGAKSAWMRLVQIVLLAAALVSVRPLQDWAFGTPVAQNQAHLN
                     FIQIKNVDDLNQALAQARGKPVMLDLYADWCVACKEFEKYTFSDPQVQGALNGTVLLQ
                     ANVTANNAQDKALLKQLNVLGLPTILFFNQQGEEQPGQRVTGFMDAAAFSAHLRDRQP
                     "
     misc_feature    complement(526120..527814)
                     /locus_tag="ECL_00534"
                     /note="thiol:disulfide interchange protein precursor;
                     Provisional; Region: dipZ; PRK00293"
                     /db_xref="CDD:234717"
     gene            complement(527793..528116)
                     /locus_tag="ECL_00535"
                     /db_xref="GeneID:9123044"
     CDS             complement(527793..528116)
                     /locus_tag="ECL_00535"
                     /codon_start=1
                     /transl_table=11
                     /product="divalent-cation tolerance protein CutA"
                     /protein_id="YP_003611050.1"
                     /db_xref="GeneID:9123044"
                     /translation="MNTPDAVVVLCTAPDEASAQDLAAKVLAEKLAACVTLLPGATSL
                     YYWEGKLEQEYEVQMLLKTNPANQQALLDCLKSHHPYQTPELLVLPVLHGDNDYLSWL
                     NVSLR"
     misc_feature    complement(527796..528116)
                     /locus_tag="ECL_00535"
                     /note="divalent-cation tolerance protein CutA;
                     Provisional; Region: PRK10645"
                     /db_xref="CDD:182614"
     gene            complement(528230..529531)
                     /locus_tag="ECL_00536"
                     /db_xref="GeneID:9123045"
     CDS             complement(528230..529531)
                     /locus_tag="ECL_00536"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic C4-dicarboxylate transporter"
                     /protein_id="YP_003611051.1"
                     /db_xref="GeneID:9123045"
                     /translation="MFGAELVIVLLAIYLGARLGGIGIGFAGGLGVLVLTLIFQIKPG
                     AIPFDVIEIIMAVIAAIAAMQVAGGMDYLVSLAERMLRRHPKYITFLAPLVTWFMTIL
                     AGTGHTAFSTLPVITEVAKEQGIRPSRPLSIAVVASQIAITASPISAAVVFFAGILEP
                     MGVSYLTLLAICIPVTLIAVMITAVLCNFLGAELKDDPVYQERLAKGEVSLRGSQVFK
                     LKPHAKRSVVLFLIGIVAVMFYATAISDTVGLIQNPVLPRNEAIVVFMLTIATLISIT
                     CKIDTSEVLNASTFKSGMSACVCVLGVAWLGDTFVKAHISDIQTVAGDLLHNYPWLLA
                     VVLFFAATLLYSQAATTKALMPAALMLGVTPLTAIASFAAVSALFVLPTYPTLLAAVE
                     MDDTGSTRIGKYVFNHAFLIPGVVAITLCVILGFIIGGVVL"
     misc_feature    complement(528233..529531)
                     /locus_tag="ECL_00536"
                     /note="anaerobic C4-dicarboxylate transporter; Reviewed;
                     Region: PRK09412"
                     /db_xref="CDD:236503"
     gene            complement(529648..531084)
                     /locus_tag="ECL_00537"
                     /db_xref="GeneID:9123046"
     CDS             complement(529648..531084)
                     /locus_tag="ECL_00537"
                     /codon_start=1
                     /transl_table=11
                     /product="Aspartate ammonia-lyase"
                     /protein_id="YP_003611052.1"
                     /db_xref="GeneID:9123046"
                     /translation="MLNNIRIEEDLLGTREVPADAYYGVHTLRAIENFYISNSKISDI
                     PEFVRGMVMVKKAAALANKELQTIPKSAANAIIAACDEVLNNGKCMDQFPVDVYQGGA
                     GTSVNMNTNEVLANIGLELMGHQKGEYQYLNPNDHVNKCQSTNDAYPTGFRIAVYASV
                     VKLVDAINQLGDGFQRKAVEFQDILKMGRTQLQDAVPMTLGQEFHAFNVLLNEETKNL
                     LRTSELLLEVNLGATAIGTRLNTPDGYQQLAVQKLAEVSNLPVVPAEDLIEATSDCGA
                     YVMVHSALKRLAVKLSKICNDLRLLSSGPRAGLNEINLPELQAGSSIMPAKVNPVVPE
                     VVNQVCFKVIGNDTTVTMASEAGQLQLNVMEPVIGQAMFESIHILTNACYNLLEKCIN
                     GITANKEVCEGYVYNSIGIVTYLNPFIGHHNGDIVGKICAETGKSVREVVLERGLLTE
                     AELDDIFSAQNLMHPAYKAKRYTDESEQ"
     misc_feature    complement(529666..531084)
                     /locus_tag="ECL_00537"
                     /note="aspartate ammonia-lyase; Provisional; Region: aspA;
                     PRK12273"
                     /db_xref="CDD:237031"
     gene            531420..531884
                     /locus_tag="ECL_00538"
                     /db_xref="GeneID:9123047"
     CDS             531420..531884
                     /locus_tag="ECL_00538"
                     /codon_start=1
                     /transl_table=11
                     /product="FxsA protein"
                     /protein_id="YP_003611053.1"
                     /db_xref="GeneID:9123047"
                     /translation="MRWIPFIAFFLYVYIEISIFIQVAHVLGVLLTLILVIFTSVIGM
                     SLVRNQGFKNFLLMQQKMAAGESPAAEMIKSVSLIIAGLLLILPGFFTDFLGLLLLLP
                     PVQKHLTMKLLPHLRFSRMPGGGFSTGPGDTFEGEYQRKDDQHDRLDHKDDR"
     misc_feature    531420..531881
                     /locus_tag="ECL_00538"
                     /note="Protein affecting phage T7 exclusion by the F
                     plasmid, UPF0716 family [General function prediction
                     only]; Region: FxsA; COG3030"
                     /db_xref="CDD:225574"
     gene            complement(531922..533148)
                     /locus_tag="ECL_00539"
                     /db_xref="GeneID:9123048"
     CDS             complement(531922..533148)
                     /locus_tag="ECL_00539"
                     /codon_start=1
                     /transl_table=11
                     /product="putative inner membrane protein"
                     /protein_id="YP_003611054.1"
                     /db_xref="GeneID:9123048"
                     /translation="MSMSGLKQELGLAQGVGLLSTSLLGTGVFAVPALAALVAGNNSL
                     WAWPVLIVLVFPVAIVFAILGRHFPSAGGVAHFVGMAFGPRLERVTGWLFLSVIPVGL
                     PAALHIATGFGQALFGWHDEALLLAELGTLAIVWWVGSRGASSSANLQTIVAVLIVAL
                     ITAIWWAGDIRVEEIPFPAITDINHAQLFAALSVMFWCFVGLEAFAHLASEFKHPERD
                     FPRALMIGLLVAGTVYWACTVLVLHFDAFGADKAAAASLPGIVVQLFGVKALWVACVI
                     GYLACFASLNIYIQSFARLVWSQARNKPQSRLAQLSKRQLPLNALNLVLGSCVVSTLC
                     IYALKINLDALIIYANGIFIMIYLLCMLAGCRLLKGRYKALAVVGGVLCLLLLMMVGW
                     KSMYAVVMLAGLWVAL"
     misc_feature    complement(531925..533121)
                     /locus_tag="ECL_00539"
                     /note="putative transporter; Provisional; Region:
                     PRK11021"
                     /db_xref="CDD:236823"
     gene            533321..533614
                     /locus_tag="ECL_00540"
                     /db_xref="GeneID:9123049"
     CDS             533321..533614
                     /locus_tag="ECL_00540"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611055.1"
                     /db_xref="GeneID:9123049"
                     /translation="MSIRPLHDRVIVKRKEVETKSAGGIVLTGSAAAKSTRGEIIAVG
                     KGRILENGTVQPLDVKVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIVEA"
     misc_feature    533321..533608
                     /locus_tag="ECL_00540"
                     /note="co-chaperonin GroES; Reviewed; Region: groES;
                     PRK00364"
                     /db_xref="CDD:178988"
     misc_feature    order(533324..533326,533330..533332,533336..533338,
                     533345..533347,533426..533431,533492..533494,
                     533522..533524,533537..533539,533546..533548,
                     533594..533602)
                     /locus_tag="ECL_00540"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    533372..533413
                     /locus_tag="ECL_00540"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    order(533453..533455,533486..533488)
                     /locus_tag="ECL_00540"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            533654..535300
                     /locus_tag="ECL_00541"
                     /db_xref="GeneID:9123050"
     CDS             533654..535300
                     /locus_tag="ECL_00541"
                     /codon_start=1
                     /transl_table=11
                     /product="protein GroEL"
                     /protein_id="YP_003611056.1"
                     /db_xref="GeneID:9123050"
                     /translation="MAAKDVKFGNDARVKMLRGVNVLADAVKVTLGPKGRNVVLDKSF
                     GAPTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIITE
                     GLKAVAAGMNPMDLKRGIDKAVASAVEELKALSVPCSDSKAIAQVGTISANSDETVGK
                     LIAEAMDKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETGAVELESP
                     FILLADKKVSNIREMLPVLEAVAKAGKPLVIIAEDVEGEALATLVVNTMRGIVKVAAV
                     KAPGFGDRRKAMLQDIATLTGGTVISEEIGMELEKATLEDLGQAKRVVINKDTTTIID
                     GVGEESAIQGRVAQIRKQIEEATSDYDREKLQERVAKLAGGVAVIKVGAATEVEMKEK
                     KARVDDALHATRAAVEEGVVAGGGVALVRVAAKLAGLSGQNEDQNVGIKVALRAMEAP
                     LRQIVSNAGEEPSVVTNNVKAGEGNYGYNAATEEYGNMIDFGILDPTKVTRSALQYAA
                     SVAGLMITTECMVTDLPKGDAPDLGAAGGMGGMGGMGGMM"
     misc_feature    533657..535243
                     /locus_tag="ECL_00541"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK00013"
                     /db_xref="CDD:234573"
     misc_feature    order(533663..533665,533675..533677,533726..533728,
                     533759..533770,533774..533776,533789..533794,
                     533798..533800,533828..533830,533834..533836,
                     533858..533860,533870..533872,533879..533881,
                     534242..534244,534338..534340,534422..534424,
                     534803..534805,534809..534811,535028..535030,
                     535190..535192,535199..535219)
                     /locus_tag="ECL_00541"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(533744..533752,533912..533914,533924..533926,
                     534101..534103,534845..534847,534896..534898,
                     535013..535015,535130..535132,535136..535138)
                     /locus_tag="ECL_00541"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(533978..533980,534953..534955,535007..535009,
                     535034..535036,535040..535045,535052..535054)
                     /locus_tag="ECL_00541"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    order(534074..534076,534209..534211,534230..534232,
                     534776..534778,534878..534883)
                     /locus_tag="ECL_00541"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(535539..536507)
                     /locus_tag="ECL_00542"
                     /db_xref="GeneID:9123051"
     CDS             complement(535539..536507)
                     /locus_tag="ECL_00542"
                     /codon_start=1
                     /transl_table=11
                     /product="putative IS903 trasposase"
                     /protein_id="YP_003611057.1"
                     /db_xref="GeneID:9123051"
                     /translation="MKDQITYLPDNADRSVAKQKFKITNWPTYNKALINRGSITFWLD
                     DEAIQAWYESATPSSRGRPQRYSDLAITTVLVIKRVFRLTLRAAQGFIDSIFSLMNVP
                     LRCPDYSCVSRRAKSVNVSFKTPTRGEIAHLVIDSTGLKVFGEGEWKVKKHGQERRRI
                     WRKLHLAVDSKTHEIICADLSLNNVTDSEAFPGLIRQTHRKIRSAAADGAYDTRLCHD
                     ELRRKKISALIPPRKGAGYWPGEYADRNRAVANQRMTGSNARWKWTTDYNRRSIAETA
                     MYRVKQLFGGSLTLRDYDGQVAEAMALVRALNKMTKAGIPESVRIA"
     misc_feature    complement(536073..536408)
                     /locus_tag="ECL_00542"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_5;
                     pfam13737"
                     /db_xref="CDD:290455"
     misc_feature    complement(535584..536114)
                     /locus_tag="ECL_00542"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:307645"
     gene            complement(536525..536914)
                     /locus_tag="ECL_00543"
                     /db_xref="GeneID:9123052"
     CDS             complement(536525..536914)
                     /locus_tag="ECL_00543"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611058.1"
                     /db_xref="GeneID:9123052"
                     /translation="MTAEVRKNLMDLFIDGARRGFTIATTSLLPNVVMAFVIIQALKV
                     TGLLDIVGRVCEPIMALWGLPGEAATVLLASVMSMGGGVGVCASLVVAGSLSGHDATV
                     LLPAIYLMGNPVQNTGRCLGTAGGFVE"
     misc_feature    complement(536540..536908)
                     /locus_tag="ECL_00543"
                     /note="hypothetical protein; Provisional; Region:
                     PRK10519"
                     /db_xref="CDD:182513"
     gene            complement(536895..537572)
                     /locus_tag="ECL_00544"
                     /db_xref="GeneID:9123053"
     CDS             complement(536895..537572)
                     /locus_tag="ECL_00544"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611059.1"
                     /db_xref="GeneID:9123053"
                     /translation="MSEVSPNQGKVTWVGYLAFFLTIIFFSGFFAKATEWWRVFDFTV
                     LNGTFGQVNGEGAASVSFRGTGGTGAKDGFLFALELAPSVILSLGIISVTEGLGGLRA
                     AQQLMTPVLKPLLGIPGICSLALIANLQNTDAAAGMTKELADEGVISDRERAIFATFQ
                     TSGSAIITNYFSSGAALFTSITVPVITPLAVILVFKFIGANFLRAWIAHMETRQIKER
                     EDDRRSA"
     misc_feature    complement(<536952..>537560)
                     /locus_tag="ECL_00544"
                     /note="Nucleoside recognition; Region: Gate; cl21594"
                     /db_xref="CDD:328818"
     gene            537827..538180
                     /locus_tag="ECL_00545"
                     /db_xref="GeneID:9123054"
     CDS             537827..538180
                     /locus_tag="ECL_00545"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane lipoprotein"
                     /protein_id="YP_003611060.1"
                     /db_xref="GeneID:9123054"
                     /translation="MRVKVCAGIVGAALLLAGCSSSNELTAAGQGVRFVEDKPGNECQ
                     FLGTATGEQSNWMSGQHGEEGGSMRGAANALRNQAAAMGGNVIYGVSSPTQGMLSSFV
                     PTASQMNGQVYKCPN"
     misc_feature    537896..538171
                     /locus_tag="ECL_00545"
                     /note="Domain of unknown function (DUF4156); Region:
                     DUF4156; pfam13698"
                     /db_xref="CDD:316239"
     gene            complement(538228..539256)
                     /locus_tag="ECL_00546"
                     /db_xref="GeneID:9123055"
     CDS             complement(538228..539256)
                     /locus_tag="ECL_00546"
                     /codon_start=1
                     /transl_table=11
                     /product="L-lysine 2,3-aminomutase"
                     /protein_id="YP_003611061.1"
                     /db_xref="GeneID:9123055"
                     /translation="MAHIVTLNTPSREDWLSQLADVITSPDELLRLLELEQHTDLLAG
                     REAKRLFALRVPRAFVARMEKGNPDDPLLKQTLTAQEEFITAPGYSTDPLEEQNSVVP
                     GLLHKYLNRALLLVKGGCAVNCRYCFRRHFPYAENQGNKRNWQVALDYIAAHSELDEI
                     IFSGGDPLMAKDYELDWLLTQLEAIPHIKRLRIHSRLPIVIPARITDGLVSRLEQSRL
                     QVLLVNHINHANEIDDAFRAAMVRLRKAGVTLLNQSVLLRGVNDNARVLADLSNALFD
                     AGVMPYYLHVLDRVQGAAHFMVTDEEARQIVRELLTLVSGYMVPKLAREIGGEPSKTP
                     LDLQLRQS"
     misc_feature    complement(538252..539214)
                     /locus_tag="ECL_00546"
                     /note="EF-P beta-lysylation protein EpmB; Region:
                     EFP_modif_epmB; TIGR03821"
                     /db_xref="CDD:163533"
     gene            539345..539863
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /db_xref="GeneID:9123056"
     CDS             539345..539863
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /codon_start=1
                     /transl_table=11
                     /product="elongation factor P"
                     /protein_id="YP_003611062.1"
                     /db_xref="GeneID:9123056"
                     /translation="MDGEPYAVEASEFVKPGKGQAFARVKLRRLLTGTRVEKTFKSTD
                     SAEGADVVDMNLTYLYNDGEFWHFMNNETFEQLSADAKAIGDSDKWLLDQAECIVTLW
                     NGQPIAVTPPNFVELEIVETDPGLKGDTAGTGGKPAKLSTGAVVKVPLFVQTGEVIKV
                     DTRSGEYVSRVK"
     misc_feature    539345..539860
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /note="elongation factor P; Validated; Region: PRK00529"
                     /db_xref="CDD:234788"
     misc_feature    <539345..539479
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /note="Elongation factor P (EF-P) KOW-like domain; Region:
                     EFP_N; pfam08207"
                     /db_xref="CDD:285425"
     misc_feature    539501..539680
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /note="S1_EF-P_repeat_1: Translation elongation factor P
                     (EF-P), S1-like RNA-binding domain, repeat 1. EF-P
                     stimulates the peptidyltransferase activity in the
                     prokaryotic 70S ribosome. EF-P enhances the synthesis of
                     certain dipeptides with...; Region: S1_EF-P_repeat_1;
                     cd04470"
                     /db_xref="CDD:239916"
     misc_feature    order(539567..539569,539642..539644,539657..539662)
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239916"
     misc_feature    539687..539854
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /note="Elongation factor P, C-terminal; Region:
                     Elong-fact-P_C; pfam09285"
                     /db_xref="CDD:286380"
     misc_feature    order(539774..539776,539825..539827,539840..539845)
                     /gene="eF-P"
                     /locus_tag="ECL_00547"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:240220"
     gene            539911..540042
                     /locus_tag="ECL_00548"
                     /db_xref="GeneID:9123057"
     CDS             539911..540042
                     /locus_tag="ECL_00548"
                     /codon_start=1
                     /transl_table=11
                     /product="entericidin A"
                     /protein_id="YP_003611063.1"
                     /db_xref="GeneID:9123057"
                     /translation="MKRTVKILLLLALSSALLSGCNTTRGMGEDIQDLGHIISHAAS"
     misc_feature    539911..540039
                     /locus_tag="ECL_00548"
                     /note="Predicted small secreted protein [Function
                     unknown]; Region: COG5510; cl22944"
                     /db_xref="CDD:304653"
     gene            540151..540297
                     /locus_tag="ECL_00549"
                     /db_xref="GeneID:9123058"
     CDS             540151..540297
                     /locus_tag="ECL_00549"
                     /codon_start=1
                     /transl_table=11
                     /product="entericidin B membrane lipoprotein"
                     /protein_id="YP_003611064.1"
                     /db_xref="GeneID:9123058"
                     /translation="MVKKTIAAIFSVLVLSSVLTACNTTRGVGQDISEGGSAISGAAT
                     KAQQ"
     misc_feature    540151..540294
                     /locus_tag="ECL_00549"
                     /note="entericidin B membrane lipoprotein; Provisional;
                     Region: PRK10081"
                     /db_xref="CDD:170240"
     gene            complement(540335..540934)
                     /locus_tag="ECL_00550"
                     /db_xref="GeneID:9123059"
     CDS             complement(540335..540934)
                     /locus_tag="ECL_00550"
                     /codon_start=1
                     /transl_table=11
                     /product="two component LuxR family transcriptional
                     regulator"
                     /protein_id="YP_003611065.1"
                     /db_xref="GeneID:9123059"
                     /translation="MFKILLIDRCHFTRAGFEAWLNHSGLFPGHFVVTGLNNLILARE
                     HILQWDPSVVIADLHGFMQDIHHFQQLSSLLNASEKVPFILLQSGEDKEMAGFLSQFP
                     IWASLTKNAGLETLATVINDALTTRASVEIPAVAAPLLTRQEEKVLTLWMDGASNQKI
                     ATHLRINGKTVYTYKRNIRMKLHMDTRFSPFLSLQESEN"
     misc_feature    complement(540374..540928)
                     /locus_tag="ECL_00550"
                     /note="DNA-binding response regulator, NarL/FixJ family,
                     contains REC and HTH domains [Signal transduction
                     mechanisms, Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     gene            541197..541514
                     /gene="sugE"
                     /locus_tag="ECL_00551"
                     /db_xref="GeneID:9123060"
     CDS             541197..541514
                     /gene="sugE"
                     /locus_tag="ECL_00551"
                     /codon_start=1
                     /transl_table=11
                     /product="suppresser of groEL"
                     /protein_id="YP_003611066.1"
                     /db_xref="GeneID:9123060"
                     /translation="MSWIILVIAGLLEVVWAIGLKYTHGFTRLTPSVITVTAMIVSIV
                     LLSWAMRSLPVGTAYAVWTGIGAVGAAITGILLLGESASLARIASLALIVCGIIGLKL
                     SAH"
     misc_feature    541197..541511
                     /gene="sugE"
                     /locus_tag="ECL_00551"
                     /note="multidrug efflux system protein; Provisional;
                     Region: PRK11431"
                     /db_xref="CDD:171110"
     gene            complement(541511..542041)
                     /locus_tag="ECL_00552"
                     /db_xref="GeneID:9123061"
     CDS             complement(541511..542041)
                     /locus_tag="ECL_00552"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane lipoprotein Blc"
                     /protein_id="YP_003611067.1"
                     /db_xref="GeneID:9123061"
                     /translation="MRILPVIAAVTAAFLVVACSSPTPPSGVTVVSNFDAQRFLGTWY
                     EIARLDHRFERGLEKVTAHYSSMDDGGIQVINRGYNPDRQMWQQSTGKAYFTGDPRRA
                     ALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISSEMKQQMLDVAT
                     RQGFDVSKLIWVEQPH"
     misc_feature    complement(541514..542041)
                     /locus_tag="ECL_00552"
                     /note="outer membrane lipoprotein Blc; Provisional;
                     Region: PRK10477"
                     /db_xref="CDD:182489"
     gene            complement(542200..543345)
                     /gene="ampC"
                     /locus_tag="ECL_00553"
                     /db_xref="GeneID:9123062"
     CDS             complement(542200..543345)
                     /gene="ampC"
                     /locus_tag="ECL_00553"
                     /codon_start=1
                     /transl_table=11
                     /product="class C beta-lactamase"
                     /protein_id="YP_003611068.1"
                     /db_xref="GeneID:9123062"
                     /translation="MMKKSLSCALLLSVACSAFAAPMSEKQLADVVERTVTPLMKAQA
                     IPGMAVAVIYQGQPHYFTFGKADVAANKPVTPQTLFELGSVSKTFTGVLGGDAIARKE
                     ISLADPVTKYWPELTGKQWQGIRLLDLATYTAGGLPLQVPDDVTDNASLLRFYQSWQP
                     KWAPGTTRLYANTSIGLFGSLAVKPSGMRFEQAMAERVFKPLKLNHTWINVPHAEEPH
                     YAWGYREGKAVHVSPGMLDAEAYGVKSNVKDMASWVMANMAPETLPQSTLQQGIALAQ
                     SRYWRVGAMYQGLGWEMLNWPVDAKTVVDGSDNKVALAPLPVAEVNPPAPPVKASWVH
                     KTGSTGGFGSYVAFIPEKQIGIVMLANKSYPNPVRVETAYRILDALQ"
     misc_feature    complement(542203..543345)
                     /gene="ampC"
                     /locus_tag="ECL_00553"
                     /note="beta-lactamase/D-alanine carboxypeptidase;
                     Provisional; Region: ampC; PRK11289"
                     /db_xref="CDD:236894"
     gene            543478..544353
                     /locus_tag="ECL_00554"
                     /db_xref="GeneID:9123063"
     CDS             543478..544353
                     /locus_tag="ECL_00554"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="YP_003611069.1"
                     /db_xref="GeneID:9123063"
                     /translation="MTRSYLPLNSLRAFEAAARHLSFTHAAIELNVTHSAISQHVKAL
                     EQHLNCQLFVRVSRGLMLTTEGENLLPVLNDSFDRIAGMLDRFANHRAQEKLKIGVVG
                     TFATGVLFSQLDDFRRSYPHIDLQLSTHNNRVDPAAEGLDYTIRYGGGAWHGTEATFL
                     CSAPLAPLCTPDIAAALHTPADILKFTLLRSYRRDEWTAWMQAAGENPPSPTHRVMVF
                     DSSVTMLEAAQTGTGIAIAPVDMFTHLLNSERIVQPFTTQIDLGSYWLTRLQSRAQTP
                     AMREFAQWLVGKMQK"
     misc_feature    543502..543678
                     /locus_tag="ECL_00554"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:306606"
     misc_feature    543763..544332
                     /locus_tag="ECL_00554"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl25412"
                     /db_xref="CDD:330233"
     misc_feature    order(543805..543810,543814..543819,543826..543828,
                     543838..543840,543844..543864,544114..544116,
                     544123..544137,544153..544158,544162..544167)
                     /locus_tag="ECL_00554"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            complement(544383..544742)
                     /locus_tag="ECL_00555"
                     /db_xref="GeneID:9123064"
     CDS             complement(544383..544742)
                     /locus_tag="ECL_00555"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit D"
                     /protein_id="YP_003611070.1"
                     /db_xref="GeneID:9123064"
                     /translation="MINPNPKRSDEPVFWGLFGAGGMWSAIIAPVIILLVGIMLPLGL
                     FPGDALSYERVLAFAGSFIGRVFIFLMIVLPLWCGLHRIHHAMHDLKIHVPSGKWVFY
                     GLATILTVVTLIAVVTI"
     misc_feature    complement(544386..544739)
                     /locus_tag="ECL_00555"
                     /note="fumarate reductase subunit D; Provisional; Region:
                     PRK05470"
                     /db_xref="CDD:180105"
     misc_feature    complement(order(544476..544478,544698..544700,
                     544707..544709,544716..544721))
                     /locus_tag="ECL_00555"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(544686..544691,544698..544700))
                     /locus_tag="ECL_00555"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(544386..544388,544407..544409,
                     544470..544478,544494..544499,544527..544529,
                     544566..544568,544575..544577,544581..544583,
                     544587..544589,544620..544622,544665..544667,
                     544677..544679))
                     /locus_tag="ECL_00555"
                     /note="C-subunit interface; other site"
                     /db_xref="CDD:238307"
     misc_feature    complement(order(544569..544571,544578..544583,
                     544635..544637,544647..544649))
                     /locus_tag="ECL_00555"
                     /note="distal quinone binding site; other site"
                     /db_xref="CDD:238307"
     gene            complement(544753..545148)
                     /locus_tag="ECL_00556"
                     /db_xref="GeneID:9123065"
     CDS             complement(544753..545148)
                     /locus_tag="ECL_00556"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase subunit C"
                     /protein_id="YP_003611071.1"
                     /db_xref="GeneID:9123065"
                     /translation="MTTKRKAYVRPMPSTWWKKLPFYRFYMLREGTAVPAVWFSLELM
                     YGVFALKHGPETWASFVGFLQNPIIVILNLIVLAAALLHTKTWFELAPKAANIIVKGE
                     KMGPEPVIKGLWAVTAVVSVVILFVALFW"
     misc_feature    complement(544759..545148)
                     /locus_tag="ECL_00556"
                     /note="fumarate reductase subunit C; Provisional; Region:
                     PRK04987"
                     /db_xref="CDD:235327"
     misc_feature    complement(order(544765..544767,544777..544779,
                     544861..544863,544867..544872,544879..544881,
                     544888..544890,544897..544902,544918..544920,
                     544930..544932,544954..544956,544978..544980,
                     544996..545001,545005..545007,545017..545019,
                     545029..545034,545047..545049,545053..545055,
                     545059..545064,545071..545073,545080..545085,
                     545089..545091,545101..545103,545107..545109,
                     545113..545115,545119..545121,545125..545136))
                     /locus_tag="ECL_00556"
                     /note="D-subunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238306"
     misc_feature    complement(order(544861..544863,544870..544872,
                     544879..544881,545062..545064,545071..545073,
                     545080..545085,545089..545091,545113..545115,
                     545119..545121,545125..545127,545131..545136))
                     /locus_tag="ECL_00556"
                     /note="Iron-sulfur protein interface; other site"
                     /db_xref="CDD:238306"
     misc_feature    complement(order(544879..544881,544888..544890,
                     545059..545064))
                     /locus_tag="ECL_00556"
                     /note="proximal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238306"
     misc_feature    complement(544765..544767)
                     /locus_tag="ECL_00556"
                     /note="distal quinone binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238306"
     gene            complement(545159..545893)
                     /locus_tag="ECL_00557"
                     /db_xref="GeneID:9123066"
     CDS             complement(545159..545893)
                     /locus_tag="ECL_00557"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase iron-sulfur subunit"
                     /protein_id="YP_003611072.1"
                     /db_xref="GeneID:9123066"
                     /translation="MAEMQTLKVEVVRYNPEVDTAPHSAFYEVPYDEQTSLLDALGYI
                     KDNLAPDLSYRWSCRMAICGSCGMMVNKVPKLACKTFLRDYTKGIKVEALGNFPIERD
                     LVVDMTHFIESLEAIKPYIIGNPRTPDQGPNTQTPAQMAKYHQFSGCINCGLCYAACP
                     QFGLNPEFIGPAAITLAHRYNEDSRDHGKKERMPQLNSQNGVWSCTFVGYCSEVCPKH
                     VDPAAAIQQGKVESSKDFLIATLKPR"
     misc_feature    complement(545162..545893)
                     /locus_tag="ECL_00557"
                     /note="fumarate reductase iron-sulfur subunit;
                     Provisional; Region: PRK12385"
                     /db_xref="CDD:183490"
     gene            complement(545886..547676)
                     /locus_tag="ECL_00558"
                     /db_xref="GeneID:9123067"
     CDS             complement(545886..547676)
                     /locus_tag="ECL_00558"
                     /codon_start=1
                     /transl_table=11
                     /product="fumarate reductase flavoprotein subunit"
                     /protein_id="YP_003611073.1"
                     /db_xref="GeneID:9123067"
                     /translation="MQTFQADLAVIGAGGAGLRAAIAAAQANPNAKIALISKVYPMRS
                     HTVAAEGGSAAVAQDHDSFEYHFHDTVAGGDWLCEQDVVDYFVHHCPTEMTQLEQWGC
                     PWSRRPDGSVNVRRFGGMKIERTWFAADKTGFHMLHTLFQTSLQFPQIQRFDEHFVLD
                     ILVDDGHARGLVAMNMMEGTLVQIRANAVVMATGGAGRVYRYNTNGGIVTGDGMGMAL
                     SHGVPLRDMEFVQYHPTGLPGSGILMTEGCRGEGGILVNKNGYRYLQDYGMGPETPLG
                     EPKNKYMELGPRDKVSQAFWHEWRKGNTISTPRGDVVYLDLRHLGEKKLLERLPFICE
                     LAKAYVGVDPVKEPIPVRPTAHYTMGGIETDQQCETRIKGLFAVGECSSVGLHGANRL
                     GSNSLAELVVFGRMAGERAMERAATAGEANGAALDAQVADVEKRLKDLVNQEGNENWS
                     KIRDEMGMSMEEGCGIYRTPELMQKTVDKLAELQERFKRVRITDTSSVFNTDLLYTIE
                     LGHGLNVAECMAHSALARKESRGAHQRLDEGCTERDDVNFLKHTLAWRDADGTTRLDY
                     SDVKITTLPPAKRVYGAEAEAAEKKEKANG"
     misc_feature    complement(545931..547673)
                     /locus_tag="ECL_00558"
                     /note="fumarate reductase flavoprotein subunit; Validated;
                     Region: PRK09231"
                     /db_xref="CDD:236421"
     gene            547986..548963
                     /locus_tag="ECL_00559"
                     /db_xref="GeneID:9123068"
     CDS             547986..548963
                     /locus_tag="ECL_00559"
                     /codon_start=1
                     /transl_table=11
                     /product="lysyl-tRNA synthetase"
                     /protein_id="YP_003611074.1"
                     /db_xref="GeneID:9123068"
                     /translation="MSETATWQPSASIPNLLKRAAIMAEIRRFFADRGVLEVETPCMS
                     QATVTDIHLVPFETRFVGPGHSQGMNLWLMTSPEYHMKRLLAAGCGPVYQLCRSFRNE
                     EMGRHHNPEFTMLEWYRPHYDMYRLMNEVDDLLQQVLDCSEAETLSYQQAFQRYLEID
                     PLSADKTQLREVAAKLDLSNVADTEEDRDTLLQLLFTFGVEPQIGKDRPTFVYHFPAS
                     QASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQ
                     QPIDTNLLAALKAGLPDCSGVALGVDRLVMLALGAEQLGDVIAFTVDRA"
     misc_feature    548019..548936
                     /locus_tag="ECL_00559"
                     /note="poxB regulator PoxA; Provisional; Region: PRK09350"
                     /db_xref="CDD:236474"
     gene            complement(549007..552330)
                     /locus_tag="ECL_00560"
                     /db_xref="GeneID:9123069"
     CDS             complement(549007..552330)
                     /locus_tag="ECL_00560"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611075.1"
                     /db_xref="GeneID:9123069"
                     /translation="MRPIIVLLMAWCLSMGAYAATAPDAKQITQELEQAKAAKPAQPE
                     TVESLQSALNALEERKGSLERAQQYQQVIDNFPKLSQTLRNQLSNLRDEPRDVPAGMT
                     SDALNQEILQVSSQLLEKSRLAQQEQERAREIADSLSQLPQQQTDARRQLNEVERRIG
                     TQTGNTPQNQAQNLSLQAQSARLKALVDELELAQLSANNRQELSRMRSELAQKQSEQL
                     DAYLQALRNQLNSQRQREAERALESTELLAENSDNLPAGIVDQFKVNRELSAALNQQA
                     QRMDLVASQQRQATNQTLQVRQALNTLREQSQWLGSSNLLGEALRAQVSRLPEMPKPQ
                     QLDTEMAQLRVQRLHYEDLLNKQPQIRQIRQADGQPLTSEQNRILEAQLRTQRELLNS
                     LLQGGDTLILELTKLKVSNSQLEDALKEVNEATHRYLFWTSDVRPMTFSWPIEIVQDL
                     RRLISLDTFSQLGKASVMMLTSKETIFPLLGALILVGFSIYSRRHFTRFLERSSARVG
                     KVTQDHFWLTLRTVFWSILVASPLPVLWMTLGYGLREAWPYPLAVAIGDGVTATVPLL
                     WVVMICATFARPNGLFIAHFGWPRNRVARAMRYYLMSIGLIVPLIMALIMFDNLNDRE
                     FSGSLGRLCFMLICGALAIVTLSLKRAGIPLYLDKTGSGDNMFNRMLWNLLLCAPLVA
                     MLAAAVGYLATSQALLARLETSVAIWFLLLVIYHVIRRGMLIQRRRLAFDRAKHRRAE
                     ILAQRARGEDEPNHVNSTEGTIDADEVELDLDAISTQSLRLVRSILMLIALLSVIFLW
                     SEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILVLIITTQLVRNFPALLE
                     LALLQHLDLTPGTGYAITTITKYLILLFGGMVGFSMIGIEWSKLQWLVAALTFGLGFG
                     MQEIFANFVSGLIILFEKPIRIGDTVTIRDLTGSITKINTRATTISDWDRKEIIVPNK
                     AFITEQFINWSLSDSVTRVVLTVPAPSDANSEEVTQILYTAAERCTLVLDNPAPEVFL
                     VDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGFREHGIDMPFPPFQMRLESLDG
                     LKTGKTLTSAARKRPAGSL"
     misc_feature    complement(549010..552330)
                     /locus_tag="ECL_00560"
                     /note="putative mechanosensitive channel protein;
                     Provisional; Region: PRK10929"
                     /db_xref="CDD:236798"
     gene            complement(552350..553318)
                     /locus_tag="ECL_00561"
                     /db_xref="GeneID:9123070"
     CDS             complement(552350..553318)
                     /locus_tag="ECL_00561"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatidylserine decarboxylase"
                     /protein_id="YP_003611076.1"
                     /db_xref="GeneID:9123070"
                     /translation="MLNAFKLSLQYILPKLWLTRLAGWGASKRAGWLTKLVIDLFVKY
                     YKVDMKEAQKPDTASYRTFNEFFVRPLRDEVRPVDTDPNVLVMPADGVISQLGNIEDD
                     KILQAKGHNYSLEALLAGNYLMADLFRNGTFATTYLSPRDYHRVHMPCNGILREMIYV
                     PGDLFSVNHLTAQNVPNLFARNERVICLFDTEFGPMAQILVGATIVGSIETVWAGTIT
                     PPREGVIKRWTWPAGEEEGAVALLKGQEMGRFKLGSTVINLFAPGKVKLAEQLQSLSV
                     TKLGQPLAVSTEPFVTPDAEPAPLPEEEIKAELDASPLVDDKKDEG"
     misc_feature    complement(552452..553318)
                     /locus_tag="ECL_00561"
                     /note="phosphatidylserine decarboxylase; Reviewed; Region:
                     psd; PRK00044"
                     /db_xref="CDD:234591"
     gene            complement(553415..554467)
                     /locus_tag="ECL_00562"
                     /db_xref="GeneID:9123071"
     CDS             complement(553415..554467)
                     /locus_tag="ECL_00562"
                     /codon_start=1
                     /transl_table=11
                     /product="ribosome-associated GTPase"
                     /protein_id="YP_003611077.1"
                     /db_xref="GeneID:9123071"
                     /translation="MSKNKLSKGQQRRVNANHQRRLKTTSEKVDYDDNLFGEPTEGVV
                     ISRFGMHADVESADGEIHRCNIRRTIRSLVTGDRVVWRPGKEAAEGVTVKGIVEAVHE
                     RTSVLTRPDFYDGVKPIAANINQIVIVSAILPELSLNIIDRYLVACETLQVEPIIVLN
                     KIDLLDDEGMDFVNEQMDIYRKIGYRVLMVSSYTKDGLKPLEEALTGRISIFAGQSGV
                     GKSSLLNNLLGLQQEILTNDVSDVSGLGQHTTTASRLYHFPHGGDVIDSPGVREFGLW
                     HLEPEQIFNGFVEFHDYLGACKYRDCKHDNDPGCAIREAVEKGEIAETRFDNYHRILE
                     SMDQVKTRKNFSDSDN"
     misc_feature    complement(553418..554467)
                     /locus_tag="ECL_00562"
                     /note="GTPase RsgA; Reviewed; Region: PRK12288"
                     /db_xref="CDD:237039"
     gene            554575..555120
                     /locus_tag="ECL_00563"
                     /db_xref="GeneID:9123072"
     CDS             554575..555120
                     /locus_tag="ECL_00563"
                     /codon_start=1
                     /transl_table=11
                     /product="oligoribonuclease"
                     /protein_id="YP_003611078.1"
                     /db_xref="GeneID:9123072"
                     /translation="MSADENNLIWIDLEMTGLDPERDRIIEIATLVTDANLNILAEGP
                     TIAVHQSDDQLALMDEWNVRTHTGSGLVERVKASTMGDREAELATLEFLKQWVPAGKS
                     PICGNSIGQDRRFLFKYMPELESYFHYRYLDVSTLKELARRWKPEILDGFKKQGTHQA
                     MDDIRESVAELAYYRENFIKL"
     misc_feature    554584..555117
                     /locus_tag="ECL_00563"
                     /note="oligoribonuclease; Provisional; Region: PRK05359"
                     /db_xref="CDD:235429"
     misc_feature    order(554608..554619,554623..554625,554893..554898,
                     554902..554910,555046..555048,555061..555063)
                     /locus_tag="ECL_00563"
                     /note="putative active site [active]"
                     /db_xref="CDD:99838"
     misc_feature    order(554608..554619,554623..554625,554893..554898,
                     554902..554907,555046..555048,555061..555063)
                     /locus_tag="ECL_00563"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:99838"
     misc_feature    order(554608..554610,554614..554616,554908..554910,
                     555046..555048,555061..555063)
                     /locus_tag="ECL_00563"
                     /note="catalytic site [active]"
                     /db_xref="CDD:99838"
     misc_feature    order(554677..554679,554902..554907,554914..554916,
                     554923..554925,554962..554967,554971..554973,
                     554980..554982,554989..554991,555004..555009,
                     555100..555102,555106..555111)
                     /locus_tag="ECL_00563"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99838"
     gene            555317..555392
                     /locus_tag="ECL_tRNA011"
                     /db_xref="GeneID:9123073"
     tRNA            555317..555392
                     /locus_tag="ECL_tRNA011"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:9123073"
     gene            555437..555512
                     /locus_tag="ECL_tRNA012"
                     /db_xref="GeneID:9127679"
     tRNA            555437..555512
                     /locus_tag="ECL_tRNA012"
                     /product="tRNA-Gly"
                     /db_xref="GeneID:9127679"
     gene            complement(555783..556922)
                     /locus_tag="ECL_00564"
                     /db_xref="GeneID:9127680"
     CDS             complement(555783..556922)
                     /locus_tag="ECL_00564"
                     /codon_start=1
                     /transl_table=11
                     /product="putative iron-sulfur cluster binding protein"
                     /protein_id="YP_003611079.1"
                     /db_xref="GeneID:9127680"
                     /translation="MSQPLDLNQLAQKIKQWGAELGFQKVGITDTDLSASEPKLQAWL
                     DKQYHGEMEWMARHGMMRARPHELLPGTLRVISVRMNYLPANAAFARTLKNPSLGYVS
                     RYALGRDYHKLLRNRLKKLGETIQQHCVSLNFRPFVDSAPVLERPIAEKAGLGWTGKH
                     SLILSRDAGSFFFLGELLIDLPLPVDGPVEEGCGRCVACMTICPTGAIVEPYTVDARR
                     CISYLTIELEGAIPEEFRPLIGNRIYGCDDCQLICPWNRYSQLTDEEDFSPRKALHAP
                     QLIELFAWSEAWFLKVTEGSAIRRIGHLRWLRNVAVALGNAPWDEANIRALESRRGEH
                     PLLDEHIEWAIAQQIEKRNACVVEVQPPQKQRLVRVIEKGLPRDA"
     misc_feature    complement(555879..556883)
                     /locus_tag="ECL_00564"
                     /note="epoxyqueuosine reductase; Region: TIGR00276"
                     /db_xref="CDD:272993"
     gene            557044..558444
                     /locus_tag="ECL_00565"
                     /db_xref="GeneID:9123074"
     CDS             557044..558444
                     /locus_tag="ECL_00565"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611080.1"
                     /db_xref="GeneID:9123074"
                     /translation="MQRAGEAAFNIARSAYPQSGHWLILCGHGNNGGDGYVVARLAVA
                     AGLRVTLLALESDKPLPEEASAAREAWLNAGGVIHASDIVWPEDVDLIVDGLLGTGLR
                     SAPRDNVAALIARANAHTAPVVALDIPSGLMAETGATPGAVIQAAHTVTFIALKPGLL
                     TGKARDVVGSLHHNALGLESWLAGQETHLSRFDATQLSHWLPPRRPTSHKGDHGRLVI
                     IGGDHGTAGAIRMTGEAALRSGAGLVRVLTRSENIPPIITARPELMVHELTPQTLEES
                     LEWADVVVIGPGLGQQAWGKQALQKVENFRKPMLWDADALNLLAINPDKRHNRILTPH
                     PGEAARLLNCSVAEIESDRLLSARRLVKRYGGVAVLKGAGTVIASDEALGIIDAGNAG
                     MASGGMGDVLSGIIGALLGQKLPLYDAACAGCVAHGAAADSLAARYGTRGMLATDLFC
                     TLRRVVNPDVIDVEDD"
     misc_feature    557044..558441
                     /locus_tag="ECL_00565"
                     /note="putative carbohydrate kinase; Provisional; Region:
                     PRK10565"
                     /db_xref="CDD:182554"
     misc_feature    557044..557559
                     /locus_tag="ECL_00565"
                     /note="NAD(P)H-hydrate repair enzyme Nnr, NAD(P)H-hydrate
                     epimerase domain [Nucleotide transport and metabolism];
                     Region: Nnr1; COG0062"
                     /db_xref="CDD:223140"
     misc_feature    557614..558417
                     /locus_tag="ECL_00565"
                     /note="yjeF C-terminal region, hydroxyethylthiazole
                     kinase-related; Region: yjeF_cterm; TIGR00196"
                     /db_xref="CDD:272955"
     misc_feature    order(557734..557736,558232..558234,558241..558243)
                     /locus_tag="ECL_00565"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238576"
     misc_feature    order(558043..558045,558154..558156,558235..558240,
                     558247..558249,558325..558327)
                     /locus_tag="ECL_00565"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238576"
     gene            558437..558898
                     /locus_tag="ECL_00566"
                     /db_xref="GeneID:9123075"
     CDS             558437..558898
                     /locus_tag="ECL_00566"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611081.1"
                     /db_xref="GeneID:9123075"
                     /translation="MTNRAIPLPDEQATLELGKRVAQACQGATVIYLYGDLGAGKTTF
                     SRGFLQALGHNGNVKSPTYTLVEPYTLENLMVYHFDLYRLADPEELEFMGIRDYFAND
                     AICLVEWPQQGAGVLPDPDVEIHLDYQAQGREARISAVSSSGSSLLARLAG"
     misc_feature    558437..558895
                     /locus_tag="ECL_00566"
                     /note="ADP-binding protein; Provisional; Region: PRK10646"
                     /db_xref="CDD:182615"
     gene            558942..560252
                     /locus_tag="ECL_00567"
                     /db_xref="GeneID:9123076"
     CDS             558942..560252
                     /locus_tag="ECL_00567"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylmuramoyl-l-alanine amidase II"
                     /protein_id="YP_003611082.1"
                     /db_xref="GeneID:9123076"
                     /translation="MAATVLLCAQAGAASLSDIQVSNGESQARITFSFMGDPEYAFSQ
                     PDSRSVALDIKQTGVIQGLPLQFSGNNLVKSIRSGTPKDSQSLRLVVDLTEKGKTRAV
                     KQQNGANYTVVFTINADAPPPPPPPPVVAKRVEEPVYTPRPSEPARNPFKTDNDRITG
                     VTSSNTVTRPAASARRVVSSDKVIIAIDAGHGGQDPGAIGPGGTREKNVTIAIARKLR
                     TLLNDDPMFKGVLTRDGDYFISVMGRSDVARKQNANFLVSIHADAAPNRNATGASVWV
                     LSNRRANSEMANWLEEHEKQSELLGGAGDVLANSQSDPYLSQAVLDLQFGHSQRVGYD
                     VATNVLNQLQGIGALHKRRPEHASLGVLRSPDIPSILVETGFISNNSEERLLGSDSYQ
                     QQIAEAIYNGLRKYFEAHPLQSAPQGGAAQTASAVLPGEMTATN"
     misc_feature    558942..560249
                     /locus_tag="ECL_00567"
                     /note="N-acetylmuramoyl-l-alanine amidase II; Provisional;
                     Region: PRK10431"
                     /db_xref="CDD:236692"
     misc_feature    558996..559283
                     /locus_tag="ECL_00567"
                     /note="AMIN domain; Region: AMIN; pfam11741"
                     /db_xref="CDD:288576"
     misc_feature    559491..560150
                     /locus_tag="ECL_00567"
                     /note="N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA
                     (also known as peptidoglycan aminohydrolase, NAMLA
                     amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC
                     3.5.1.28) is an autolysin that hydrolyzes the amide bond
                     between N-acetylmuramoyl and L-amino...; Region:
                     MurNAc-LAA; cd02696"
                     /db_xref="CDD:119407"
     misc_feature    order(559512..559514,559557..559559,559719..559721,
                     560058..560060)
                     /locus_tag="ECL_00567"
                     /note="active site"
                     /db_xref="CDD:119407"
     misc_feature    order(559512..559514,559557..559559,559719..559721)
                     /locus_tag="ECL_00567"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119407"
     gene            560262..562106
                     /locus_tag="ECL_00568"
                     /db_xref="GeneID:9123077"
     CDS             560262..562106
                     /locus_tag="ECL_00568"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA mismatch repair protein"
                     /protein_id="YP_003611083.1"
                     /db_xref="GeneID:9123077"
                     /translation="MPIQVLPPQLANQIAAGEVVERPASVVKELVENSLDAGATRIDI
                     DIERGGAKLIRIRDNGCGIKKEELALALARHATSKIASLDDLEAIISLGFRGEALASI
                     SSVSRLTLTSRTAEQQEAWQAYAEGRDMDVTIKPAAHPVGTTLEVLDLFYNTPARRKF
                     MRTEKTEFGHIDEIIRRIALARFDVTINLSHNGKVMRQYRAVAEGGQKERRLGAICGT
                     PFLEQALAIEWQHGDLALRGWVADPNASSAAFAEIQYCYVNGRMMRDRLINHAIRQAC
                     EDKLGADQQPAFVLYLEIDPHQVDVNVHPAKHEVRFHQSRLVHDFIYQGVLSVLQQQV
                     EPTLPLEKEEPASRPIPENRVAAGRNHFAEPAVAREPEAPRFSSAGSAPRPTGANYPN
                     AQPGYQKQQGALYRKLLETPAVTRKEHSEVQAPSLEGHSQSFGRVLTIIAPDMALLER
                     EGKLMLLALPVAERWLKQVQLTPGENAACAQPLLIPVRLKISTEETRVLQRAEAQLAQ
                     MGIEMVLESQHVTIRAVPLPLRQQNLQNLIPELIGYLAQQTTFDAANTAQWIARHLAS
                     EHTPWSMAQAISVLAEVERLCPHLVKAPPGGLLQPVDLQTAMTALKDD"
     misc_feature    560262..562028
                     /locus_tag="ECL_00568"
                     /note="DNA mismatch repair protein; Reviewed; Region:
                     mutL; PRK00095"
                     /db_xref="CDD:234630"
     gene            562099..563049
                     /locus_tag="ECL_00569"
                     /db_xref="GeneID:9123078"
     CDS             562099..563049
                     /locus_tag="ECL_00569"
                     /codon_start=1
                     /transl_table=11
                     /product="tRNA delta(2)-isopentenylpyrophosphate
                     transferase"
                     /protein_id="YP_003611084.1"
                     /db_xref="GeneID:9123078"
                     /translation="MIDVSKASLPKAIFLMGPTASGKTALAIELRKVLPVELISVDSA
                     LIYRGMDIGTAKPDAAELRAAPHRLLDILDPAQAYSAADFRRDALAEMAEITAAGRIP
                     LLVGGTMLYFKALLEGLSPLPSADPEIRAKIEQKAAEQGWDVLHQQLAEIDPVAAARI
                     HPNDPQRLSRALEVFFISGKTLTELTQTSGDALPYQVHQFAIAPASRELLHQRIEQRF
                     HQMLASDFEAEVRALFARGDLHTDMPSVRCVGYRQMWSYLEGEISYDEMVYRGVCATR
                     QLAKRQITWLRGWEGVHWLDSEKPQQALNEVIEVIGDIAH"
     misc_feature    562117..563034
                     /locus_tag="ECL_00569"
                     /note="tRNA delta(2)-isopentenylpyrophosphate transferase;
                     Reviewed; Region: miaA; PRK00091"
                     /db_xref="CDD:234626"
     gene            563135..563446
                     /locus_tag="ECL_00570"
                     /db_xref="GeneID:9123079"
     CDS             563135..563446
                     /locus_tag="ECL_00570"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA-binding protein Hfq"
                     /protein_id="YP_003611085.1"
                     /db_xref="GeneID:9123079"
                     /translation="MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVI
                     LLKNTVSQMVYKHAISTVVPSRPVSHHSNNAGGGTGSNYHHGSNAQGSSAPAQDSDET
                     E"
     misc_feature    563135..563362
                     /locus_tag="ECL_00570"
                     /note="RNA-binding protein Hfq; Provisional; Region: hfq;
                     PRK00395"
                     /db_xref="CDD:179001"
     misc_feature    order(563150..563158,563165..563167,563210..563224,
                     563246..563254,563258..563263,563282..563326)
                     /locus_tag="ECL_00570"
                     /note="hexamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212463"
     misc_feature    order(563198..563218,563222..563275)
                     /locus_tag="ECL_00570"
                     /note="Sm1 motif; other site"
                     /db_xref="CDD:212463"
     misc_feature    order(563207..563209,563219..563233,563270..563272,
                     563288..563290,563312..563317,563321..563323)
                     /locus_tag="ECL_00570"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:212463"
     misc_feature    563285..563320
                     /locus_tag="ECL_00570"
                     /note="Sm2 motif; other site"
                     /db_xref="CDD:212463"
     gene            563521..564801
                     /locus_tag="ECL_00571"
                     /db_xref="GeneID:9123080"
     CDS             563521..564801
                     /locus_tag="ECL_00571"
                     /codon_start=1
                     /transl_table=11
                     /product="putative GTPase HflX"
                     /protein_id="YP_003611086.1"
                     /db_xref="GeneID:9123080"
                     /translation="MFDRYDAGEQAVLVHIYFSQDKDMEDLQEFESLVSSAGVEAMQV
                     ITGSRKAPHPKYFVGEGKAVEIADAVKATGASVVLFDHALSPAQERNLEALCECRVID
                     RTGLILDIFAQRARTHEGKLQVELAQLRHLATRLVRGWTHLERQKGGIGLRGPGETQL
                     ETDRRLLRGRITQILSRLERVEKQREQGRRARTKADIPTVSLVGYTNAGKSTLFNQIT
                     EAQVYAADQLFATLDPTLRRIDVADVGETVLADTVGFIRHLPHDLVAAFKATLQETRQ
                     ATLLLHVIDAADVRVQENIDAVNVVLEEIEAHEIPTLLVMNKIDMLDDFEPRIDRDEE
                     NKPIRVWLSAQTGIGVPLLFQALTERLSGEVAQHTLRLPPQEGRLRSRFYQLQAIEKE
                     WMEDDGSVGMQVRMPIVDWRRLCKQEPALVDYIV"
     misc_feature    563521..564798
                     /locus_tag="ECL_00571"
                     /note="GTPase HflX; Provisional; Region: PRK11058"
                     /db_xref="CDD:182934"
     gene            564858..566117
                     /locus_tag="ECL_00572"
                     /db_xref="GeneID:9123081"
     CDS             564858..566117
                     /locus_tag="ECL_00572"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611087.1"
                     /db_xref="GeneID:9123081"
                     /translation="MAWNQPGNNGQDRDPWGSSNNQGGNSGGNGNKGGRDQGPPDLDD
                     IFRKLSKKLGGLGGGKGSGSGGNSTQGPRPQMGGRIVGIVAAAVVIIWAASGFYTIKE
                     AERGVVTRFGKFSHLVEPGLNWKPTFIDDVTAVNVESVRELAASGVMLTSDENVVRVE
                     MNVQYRVTDPERYLFSVTSADDSLRQATDSALRGVIGKYTMDRILTEGRTVIRSDTQR
                     ELEETIRPYNMGITLLDVNFQAARPPEEVKAAFDDAIAARENEQQYIREAEAYANEVQ
                     PRANGQAQRILEEARAYKTQTILEAQGEVARFAKILPEYKAAPEITRERLYIETMEKV
                     LSHTRKVLVNDSKGGNLMVLPLDQMLKGGSAPAAKDNSGANNLLRLPPASSGSSSATT
                     TPSSNDGDIMDQRRANAQRNDYQRQGE"
     misc_feature    564858..566114
                     /locus_tag="ECL_00572"
                     /note="FtsH protease regulator HflK; Provisional; Region:
                     PRK10930"
                     /db_xref="CDD:236799"
     gene            566120..567124
                     /locus_tag="ECL_00573"
                     /db_xref="GeneID:9123082"
     CDS             566120..567124
                     /locus_tag="ECL_00573"
                     /codon_start=1
                     /transl_table=11
                     /product="FtsH protease regulator HflC"
                     /protein_id="YP_003611088.1"
                     /db_xref="GeneID:9123082"
                     /translation="MRKSVIAIIVIVLVVLYTSIFVVKEGERGIKFQFSSVVRDSDKR
                     PVIYEPGLHFKVPFIQSVKTLDARIQTMDNQADRFVTKEKKDLIVDSYIKWRISDFSR
                     YFLATGGGDVSQAEVLLKRKFSDRLRSEIGRLDVKDIVTDSRGRLTLEVRDALNSGTA
                     GTEDEVETPAADDAIAKAAERVQAETNGKVPVINPNSMAALGIEVVDVRIKQINLPAE
                     VSEAIYNRMRAEREAVARRHRSQGQEEAEKLRAAADYEVTKTLAESERQGRILRGEGD
                     AEAAKLFADAFSQDPDFYAFIRSLRAYENSFQSNQDVMVLSPDSDFFRYMKTPTNATR
                     "
     misc_feature    566120..567121
                     /locus_tag="ECL_00573"
                     /note="FtsH protease regulator HflC; Provisional; Region:
                     PRK11029"
                     /db_xref="CDD:182913"
     gene            567196..567393
                     /locus_tag="ECL_00574"
                     /db_xref="GeneID:9123083"
     CDS             567196..567393
                     /locus_tag="ECL_00574"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611089.1"
                     /db_xref="GeneID:9123083"
                     /translation="MNSTIWLALALVLVLEGLGPMLYPRAWRRMIATLSQLPDNILRR
                     FGGGLVVAGIVIYYMLRKTIG"
     misc_feature    567196..567381
                     /locus_tag="ECL_00574"
                     /note="Uncharacterized conserved protein YjeT, DUF2065
                     family [Function unknown]; Region: yjeT; COG3242"
                     /db_xref="CDD:225782"
     gene            567456..568796
                     /locus_tag="ECL_00575"
                     /db_xref="GeneID:9123084"
     CDS             567456..568796
                     /locus_tag="ECL_00575"
                     /codon_start=1
                     /transl_table=11
                     /product="adenylosuccinate synthase"
                     /protein_id="YP_003611090.1"
                     /db_xref="GeneID:9123084"
                     /translation="MVESIFKQTVILKKMGNNVVVLGTQWGDEGKGKIVDLLTERAKY
                     VVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKGLE
                     DRGIPVRERLLLSEACPLILDYHVALDVAREKARGAKAIGTTGRGIGPAYEDKVARRG
                     LRVGDLFDKATFAEKLKEVMEYHNFQLVNFYKADAVDYQKVLDDVMAIADILTGMVVD
                     VSDLLDQARKRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDY
                     VLGIIKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDAVAVRRAV
                     QINSLSGFCLTKLDVLDGLKEVKICVGYRMPDGREVTTTPLAADDWEGIEPIYETMPG
                     WSETTFGVKERSGLPQAALDYIKRIEELTEVPIDIISTGPDRTETMILRDPFDA"
     misc_feature    567501..568793
                     /locus_tag="ECL_00575"
                     /note="adenylosuccinate synthetase; Provisional; Region:
                     PRK01117"
                     /db_xref="CDD:234904"
     gene            568939..569415
                     /gene="nsrR"
                     /locus_tag="ECL_00576"
                     /db_xref="GeneID:9123085"
     CDS             568939..569415
                     /gene="nsrR"
                     /locus_tag="ECL_00576"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor NsrR"
                     /protein_id="YP_003611091.1"
                     /db_xref="GeneID:9123085"
                     /translation="MNISAVLPRFPFFPEVDVQLTSFTDYGLRALIYMASLPDGKMTS
                     ISEVTEVYGVSRNHMVKIINQLSRAGYVAAVRGKNGGIRLGKPAQSIRIGDVVRELEP
                     LSLVNCSSEFCHITPACRLKQALSLAVQSFLKELDNYTLADLVEENQPLYKLLLVE"
     misc_feature    568990..569412
                     /gene="nsrR"
                     /locus_tag="ECL_00576"
                     /note="transcriptional repressor NsrR; Provisional;
                     Region: PRK11014"
                     /db_xref="CDD:236820"
     gene            569454..571895
                     /locus_tag="ECL_00577"
                     /db_xref="GeneID:9123086"
     CDS             569454..571895
                     /locus_tag="ECL_00577"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="YP_003611092.1"
                     /db_xref="GeneID:9123086"
                     /translation="MSHDPFQEREAEKYANPIPSREFIIEHLTKREKPANREELAVEL
                     NIEGEEQTEALRRRLRAMERDGQLVFTRRQCYALPERLDLLKGTVIGHRDGYGFLRVE
                     GRKDDLYLSSEQMKMCIHGDQILAQPLGADRKGRREARVVRVLVPKTSQIVGRYFTDA
                     GVGFVVPDDSRLSFDILIPPEEVMGARMGFVVVVELTQRPTRRTKAVGKIVEVLGDNM
                     GTGMAVDMALRTHEIPYIWPKAVEEQIVGLKEEVPEESKAGRVDLRSLPLVTIDGEDA
                     RDFDDAVYCEKKRGGGWRLWVAIADVSYYVRPHTPLDNEARSRGTSVYFPSQVVPMLP
                     EVLSNGLCSLNPQVDRLCMVCEMTISSKGRLTGYKFYEAVMSSHARLTYTKVWHMLQG
                     DQDLREQYAPLVKHIEELHNLYKTLDQAREERGGISFESEEAKFIFNAERRIERIEQT
                     QRNDAHKLIEECMILANISAARFVEKAKEPALFRIHDKPSTEAITAFRSVLAELGLEL
                     PGGNKPEPRDYAELLESIGDRPDAEMLQTMLLRSMKQAIYDPENRGHFGLALQSYAHF
                     TSPIRRYPDLSLHRAIKYLLAQEQGHKGNTTETGGYHYSMEEMLQLGQHCSMTERRAD
                     EATREVSDWLKCDFMLDQVGNIFKGVIASVTGFGFFVRLDELFIDGLVHVSSLDNDYY
                     RFDQVGQRLIGESGGQTYRLGDRVEVKVEAVNMDERKIDFSLISSERAPRNVGKTARE
                     KAKKGGNGNASGKRRQAGKKVNFEPDSAFRGEKKQKPKAAKKEARKAKKPSAKTQKIA
                     AATKAKRAAKKQQAE"
     misc_feature    569454..571835
                     /locus_tag="ECL_00577"
                     /note="exoribonuclease R; Provisional; Region: PRK11642"
                     /db_xref="CDD:236944"
     gene            571963..572697
                     /locus_tag="ECL_00578"
                     /db_xref="GeneID:9123087"
     CDS             571963..572697
                     /locus_tag="ECL_00578"
                     /codon_start=1
                     /transl_table=11
                     /product="23S rRNA
                     (guanosine(2251)-2'-O)-methyltransferase"
                     /protein_id="YP_003611093.1"
                     /db_xref="GeneID:9123087"
                     /translation="MSEMIYGIHAVQALLERAPERFQEVFILKGREDKRLMPLIHALE
                     AQGVVIQLANRQFLDEKSEGAVHQGIIARVKPGRQYQENDLPDLIAALDNPFFLILDG
                     VTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAENVPLIRVTNLART
                     MRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPM
                     AGSVSSLNVSVATGICLFEAVRQRGE"
     misc_feature    571963..572691
                     /locus_tag="ECL_00578"
                     /note="23S rRNA (guanosine-2'-O-)-methyltransferase;
                     Provisional; Region: PRK11181"
                     /db_xref="CDD:183021"
     gene            complement(572776..574050)
                     /locus_tag="ECL_00579"
                     /db_xref="GeneID:9123088"
     CDS             complement(572776..574050)
                     /locus_tag="ECL_00579"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator transporter"
                     /protein_id="YP_003611094.1"
                     /db_xref="GeneID:9123088"
                     /translation="MQPNAHKRALIAGSIGNFIEWYEFAVYGFLATVIAKNFFQLEGE
                     SGLTSLILTYASFAIAFFFRPLGAVVFGRIGDRIGRKPTLIIVLVLMTLATAAIGVVP
                     VYASIGIAAPLIVTLLRILQGLFAGGEYGGAVSLMTEFAPRGKRGLYGAWQSFTVALG
                     LLAGAGIVALLSALLTPEALHDWGWRIPFFLALPMGVVALWLRVSMEETPSFVQQQEK
                     PLIAQASTVATIKAIVMGIGRVMVWSAAGYTYLVIMPTYLQSALHTGFNQALLIAVIS
                     NVGFALTIIPSGILSDRIGRRTVMIIATALLLILALPLLKILQAESSTLAVKAIVVLI
                     AGGLVGMLAGPGPAMLSEMFPTRVRYTGLGLAYSLSNAIFSGCAGLIITGLIKETGNL
                     DIPAYYVMATAVVSIVALMTLRKDDHLRTLEE"
     misc_feature    complement(572833..574005)
                     /locus_tag="ECL_00579"
                     /note="putative sialic acid transporter; Provisional;
                     Region: PRK03893; cl26864"
                     /db_xref="CDD:331685"
     gene            574244..575866
                     /locus_tag="ECL_00580"
                     /db_xref="GeneID:9123089"
     CDS             574244..575866
                     /locus_tag="ECL_00580"
                     /codon_start=1
                     /transl_table=11
                     /product="isovaleryl CoA dehydrogenase"
                     /protein_id="YP_003611095.1"
                     /db_xref="GeneID:9123089"
                     /translation="MHWQTHTVFNQPAPLSNSNLFLSDCALRDAVAREGAEWDSELLA
                     SIGQQLGTAESLELGRLANVNPPELLRYDPTGERLDDVRFHPAWHLLMQGLCANRVHN
                     LAWEEEARKGSFVARAARFVLHAQVEAGTLCPVTMTFAATPLLQQALPEPFQNWLTPL
                     LSDRYDPHLAPGAQKRGLLIGMGMTEKQGGSDVLSNTTKAEKCSDGSYRLVGHKWFFS
                     VPQSDAHLVLAQAKGGLSCFFVPRFLPDGQRNAVRLERLKDKLGNRSNASSEAEFLDA
                     SGWLLGEEGEGVRQILRMGGLTRFDCALGSHGLMRRALSVALYHAHQRQTFGKNLIDQ
                     PLMRDVLSRMALVLEGQTALLFRLARAWDKRADPQEAAWARLFTPAAKFSVCKAGIPF
                     VAEAMEVLGGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVLRVLAKQPGMFDLLA
                     EDFAQVKGQDRHFDRSWRQLQQKLRKPQEAQGREIAHQLFLLGAGSQMLRHASPPVAQ
                     AWCRMMLDTRGGTLMTEQVQSDLLLRATGRVG"
     misc_feature    574244..575857
                     /locus_tag="ECL_00580"
                     /note="isovaleryl CoA dehydrogenase; Provisional; Region:
                     PRK11561"
                     /db_xref="CDD:183199"
     misc_feature    order(574787..574789,574793..574798,574811..574816,
                     574889..574891,574895..574897,575501..575503,
                     575522..575524,575528..575530)
                     /locus_tag="ECL_00580"
                     /note="FAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173843"
     misc_feature    order(574814..574816,575516..575521,575552..575554)
                     /locus_tag="ECL_00580"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173843"
     misc_feature    575516..575521
                     /locus_tag="ECL_00580"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:173843"
     gene            complement(575863..577794)
                     /locus_tag="ECL_00581"
                     /db_xref="GeneID:9123090"
     CDS             complement(575863..577794)
                     /locus_tag="ECL_00581"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003611096.1"
                     /db_xref="GeneID:9123090"
                     /translation="MITFFRRAGLGAKLSLLTGVSVATLFLLFTFLLSHKASQQLEAL
                     AVEDLHNQSTGMVDMVQMFNTSLSEEVESYTRLFTTFLPQPLSVDSNQLQTINGLSVP
                     LLKGGETGLHENNALSDDFLTRTGAISTLFVRSGNDFVRVATSLRKENGDRAMGTVLD
                     TASPAYAAVTKGEVYRGLALLFGKRYITQYQPFKNAEGQVIGIIFVGVDITHSWNVMR
                     EKILNRRLGDSGHFFVLDRSNGKTRGQFLFHSNREGQLPEWDSATQQQLLSNTPGTLE
                     RTSEGGRILKMAYTPLPGWNWTIVGEVDKSVLLSSVTTMRDRFLLAGVALSVLFAALF
                     VIIIRRMLTRPLRNVIHLARQYAAGDLRASLSVTRQDEVGQLIDAINGIGGGLQKIVL
                     QVREAAGEIHLGTNALASDTGEISEQINKQASSVEETSASMEQLAATVQQNAANMEQT
                     QQLVGETSRAVHQGGETVTHAVSTMDDIRDASKRIEDITRVIESIAFQTNILALNAAV
                     EAARAGEHGKGFAVVAQEVRALAARSANAVKEIEQLIGDTLNKVSEGHALSEQTRLAM
                     DAIIAHIDNINQLVTEINHASREQSAGIRQVNLAMTHIGEASHINADRVSRSEQTAQS
                     LREKGSHLTQLVSLFQLKN"
     misc_feature    complement(576844..577695)
                     /locus_tag="ECL_00581"
                     /note="Cache 3/Cache 2 fusion domain; Region:
                     Cache_3-Cache_2; pfam17201"
                     /db_xref="CDD:319219"
     misc_feature    complement(575872..>576870)
                     /locus_tag="ECL_00581"
                     /note="Methyl-accepting chemotaxis protein (MCP)
                     signalling domain; Region: MCPsignal; cl28165"
                     /db_xref="CDD:332985"
     gene            complement(577965..578252)
                     /locus_tag="ECL_00582"
                     /db_xref="GeneID:9123091"
     CDS             complement(577965..578252)
                     /locus_tag="ECL_00582"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611097.1"
                     /db_xref="GeneID:9123091"
                     /translation="MELTMKRTLALTSLLLSVGLVSTTAQSAEFASADCVTGLNEIGQ
                     ISVNNISGSPQDVERVVALKADEQGASWYRIIQMQEDNRSDHWRVQAILYV"
     misc_feature    complement(577971..578138)
                     /locus_tag="ECL_00582"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:311344"
     gene            complement(578389..578697)
                     /locus_tag="ECL_00583"
                     /db_xref="GeneID:9123092"
     CDS             complement(578389..578697)
                     /locus_tag="ECL_00583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611098.1"
                     /db_xref="GeneID:9123092"
                     /translation="MVMRRFATLLLLVLLSGCSALQGTPQPAPPVADHPQEIRRNQTE
                     GLQRMGTVSALVRGSPDDAEESIKAQAAAAKADYYVIIMIDETIITGQWYSQAILYRK
                     "
     misc_feature    complement(578392..578697)
                     /locus_tag="ECL_00583"
                     /note="putative biofilm stress and motility protein A;
                     Provisional; Region: PRK14864"
                     /db_xref="CDD:184866"
     gene            578856..579578
                     /locus_tag="ECL_00584"
                     /db_xref="GeneID:9123093"
     CDS             578856..579578
                     /locus_tag="ECL_00584"
                     /codon_start=1
                     /transl_table=11
                     /product="putative esterase"
                     /protein_id="YP_003611099.1"
                     /db_xref="GeneID:9123093"
                     /translation="MIEIETRRLGNHEILHAIPAGKSAHPLPVVVFYHGFTSSKLVYS
                     YFAVALAQAGFRVVMPDAPDHGARFTGDEQVRLGQFWQILHGSLSEFAGLRDALYQAG
                     LVADQRLSVAGASMGGMTALGIMARHPEVTSVACLMGSGYFTSLSKTLFPPQDATEID
                     ALLAEWEVTRALPRLADRPLLLWHGDADDVVPPGETFRLQQALQREGLDGNLTCLWEA
                     GVRHRITPAALDATVDFFRQHL"
     misc_feature    578856..579575
                     /locus_tag="ECL_00584"
                     /note="esterase; Provisional; Region: PRK10566"
                     /db_xref="CDD:182555"
     gene            complement(579575..580330)
                     /locus_tag="ECL_00585"
                     /db_xref="GeneID:9123094"
     CDS             complement(579575..580330)
                     /locus_tag="ECL_00585"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor UlaR"
                     /protein_id="YP_003611100.1"
                     /db_xref="GeneID:9123094"
                     /translation="MTEAQRHQILLELLAQTGFITVEKVIERLGISPATARRDINKLD
                     ESGKLKKVRNGAEAISQQRPRWTPMNIHQAQNHDEKVRIARAASQLVNPGESVVINCG
                     STAFLLGREMCGKPVQIITNYLPLANYLIDQEHESVVIMGGQYNKSQSITLSPQDSEN
                     SLYAGHWMFTSGKGLTADGLYKTDMLTAMAEQNMLNVVGKLVVLVDSSKVGERAGMLF
                     SRAEQIDMVITGKHANPEILQKLEDQGVKILRV"
     misc_feature    complement(579578..580330)
                     /locus_tag="ECL_00585"
                     /note="transcriptional repressor UlaR; Provisional;
                     Region: PRK13509"
                     /db_xref="CDD:184100"
     gene            complement(580441..581505)
                     /locus_tag="ECL_00586"
                     /db_xref="GeneID:9123095"
     CDS             complement(580441..581505)
                     /locus_tag="ECL_00586"
                     /codon_start=1
                     /transl_table=11
                     /product="putative beta-lactamase-like protein"
                     /protein_id="YP_003611101.1"
                     /db_xref="GeneID:9123095"
                     /translation="MSKVNTITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLG
                     CTGIWLKSEGGANICVDFWCGTGKQSHGNPLMKKGHQMQRMAGVEKLQPNLRTTPFVL
                     DPFAIRQIDAVLSTHDHNDHIDVNVAAAVMQNCADDVPFIGPQTCVDLWIGWGVPKER
                     CIVMKPGDVVKIKDIEIHALDAFDRTALITLPADQKAAGVLPDGMDERAVNYLFKTPG
                     GSLYHSGDSHYSNYYAKHGNEHQIDVALGSYGENPRGITDKMTSADMLRMAEALNTKV
                     VIPFHHDIWSNFQADPQEIRVLWEMKKDRLKYGFKPFIWQVGGKFTWPLDKDNLEYHY
                     PRGFDDCFTIEPDLPFKSFL"
     misc_feature    complement(580444..581505)
                     /locus_tag="ECL_00586"
                     /note="putative L-ascorbate 6-phosphate lactonase;
                     Provisional; Region: PRK11709"
                     /db_xref="CDD:236958"
     misc_feature    complement(order(580759..580761,580828..580830,
                     580891..580896,581140..581145,581149..581151,
                     581155..581157))
                     /locus_tag="ECL_00586"
                     /note="putative active site [active]"
                     /db_xref="CDD:293842"
     misc_feature    complement(order(580828..580830,580894..580896,
                     581143..581145,581149..581151,581155..581157))
                     /locus_tag="ECL_00586"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:293842"
     misc_feature    complement(order(580828..580830,580894..580896,
                     581149..581151,581155..581157))
                     /locus_tag="ECL_00586"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:293842"
     misc_feature    complement(order(580828..580830,581143..581145))
                     /locus_tag="ECL_00586"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:293842"
     gene            581865..583265
                     /locus_tag="ECL_00587"
                     /db_xref="GeneID:9123096"
     CDS             581865..583265
                     /locus_tag="ECL_00587"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611102.1"
                     /db_xref="GeneID:9123096"
                     /translation="MEILYNVFTVFFNQVMTNAPLLLGIVTCLGYILLRKSVSVIIKG
                     TIKTIIGFMLLQAGSGILTSTFKPVVAKMSEVYGINGAISDTYASMMATIDRMGDAYS
                     WVGYAVLLALALNIIYVLLRRITGIRTIMLTGHIMFQQAGLIAVSLYIFGYPMWTTII
                     CTAVLVSLYWGITSNMMYKPTQEVTDGCGFSIGHQQQFAAWLAYKVAPYLGKKEDSVE
                     DLKLPGWLNIFHDNIVSTAIVMTIFFGAILLSFGIDVVQAMAGKTHWTVYILQTGFSF
                     AVAIFIITQGVRMFVAELSEAFNGISQRLIPGAVLAIDCAAIYSFAPNAVVWGFMWGT
                     IGQLIAVGILVGCGSSILIIPGFIPMFFSNATIGVFANHFGGWRAALKICLVMGMVEI
                     FGCVWAVKLTGMSAWMGMADWSILAPPMMQGFASVGLVFMAVIILIALAYMFFAGRSL
                     RAEEDAEKQTAEVSAH"
     misc_feature    581865..>583250
                     /locus_tag="ECL_00587"
                     /note="PTS system ascorbate-specific transporter subunits
                     IICB; Provisional; Region: PRK09548"
                     /db_xref="CDD:236559"
     gene            583326..583583
                     /locus_tag="ECL_00588"
                     /db_xref="GeneID:9123097"
     CDS             583326..583583
                     /locus_tag="ECL_00588"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611103.1"
                     /db_xref="GeneID:9123097"
                     /translation="MIMKMKVDQFLTQSNIDHTVNSCAVGEYKSELNGADIIIASTHI
                     AGEISVSGNKYVVGVRNMLSPADFGPKLLEVIKAHFPQDVK"
     misc_feature    583326..583580
                     /locus_tag="ECL_00588"
                     /note="PTS system L-ascorbate-specific transporter subunit
                     IIB; Provisional; Region: PRK10222"
                     /db_xref="CDD:182316"
     gene            583593..584060
                     /locus_tag="ECL_00589"
                     /db_xref="GeneID:9123098"
     CDS             583593..584060
                     /locus_tag="ECL_00589"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611104.1"
                     /db_xref="GeneID:9123098"
                     /translation="MKLRDSLAENNSILLQAEASTWQEAVKLSVDLLVKADVVEPRYY
                     QAILDGVAQHGPYFVIAPGLAMPHGRPEEGVKKTGFALVTLKTPLVFNHEDNDPVDIL
                     ITMAAVDANTHQEVGIMQIVNLFDDEANFDRLRACRTEQEVLDLIDNATAAAV"
     misc_feature    583593..584054
                     /locus_tag="ECL_00589"
                     /note="PTS system L-ascorbate-specific transporter subunit
                     IIA; Provisional; Region: PRK10372"
                     /db_xref="CDD:182417"
     misc_feature    order(583740..583742,583794..583796)
                     /locus_tag="ECL_00589"
                     /note="active site"
                     /db_xref="CDD:238129"
     misc_feature    583794..583796
                     /locus_tag="ECL_00589"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238129"
     gene            584074..584724
                     /locus_tag="ECL_00590"
                     /db_xref="GeneID:9123099"
     CDS             584074..584724
                     /locus_tag="ECL_00590"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611105.1"
                     /db_xref="GeneID:9123099"
                     /translation="MSLPMLQVALDNQTLSDAYETTRLIAEEVDIIEVGTILCVGEGV
                     RAVRDLKALYPHKIVLADAKIADAGKILSRMCFEANADWVTVICCADINTAKGALDVA
                     KEFNGDVQIELTGFWTWEQAQAWRDAGIQQVVYHRSRDAQAAGVAWGDADISAIKRLA
                     DMGFKVTVTGGLALEDLPLFKGIPIHVFIAGRSIRDAASPVEAARQFKRSIAQLWG"
     misc_feature    584074..584721
                     /locus_tag="ECL_00590"
                     /note="3-keto-L-gulonate-6-phosphate decarboxylase;
                     Provisional; Region: ulaD; PRK13306"
                     /db_xref="CDD:237344"
     gene            584734..585594
                     /locus_tag="ECL_00591"
                     /db_xref="GeneID:9123100"
     CDS             584734..585594
                     /locus_tag="ECL_00591"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 3-epimerase"
                     /protein_id="YP_003611106.1"
                     /db_xref="GeneID:9123100"
                     /translation="MLSKQVPLGIYEKALPAGECWLERLKLAKQLGFDFVEMSVDETD
                     ERLSRLDWSQEQRLALVSAVAETGVRVPSMCLSAHRRFPLGSEDDTVRAQGLEIMRKA
                     IRFAQDVGIRVIQLAGYDVYYQEANDETRRRFRDGLKESVEMASRAQVTLAMEIMDYP
                     LMNSISKALGYAHYLNNPWFQLYPDIGNLSAWDNDVQMELLAGMGHIVAVHVKDTRPG
                     VFKNVPFGTGVVDFERCFQTLKQAGYCGPYLIEMWSETSDDPAGEVANARDWVRERMA
                     RAGLLEAEYA"
     misc_feature    584734..585573
                     /locus_tag="ECL_00591"
                     /note="L-xylulose 5-phosphate 3-epimerase; Reviewed;
                     Region: PRK13209"
                     /db_xref="CDD:237307"
     gene            585587..586273
                     /locus_tag="ECL_00592"
                     /db_xref="GeneID:9123101"
     CDS             585587..586273
                     /locus_tag="ECL_00592"
                     /codon_start=1
                     /transl_table=11
                     /product="L-ribulose-5-phosphate 4-epimerase"
                     /protein_id="YP_003611107.1"
                     /db_xref="GeneID:9123101"
                     /translation="MLKLKQQVFDANMDLPRYGLVTFTWGNVSAIDREQGLVVIKPSG
                     VAYDAMSPDDMVVVDLEGNVVDGKWRPSSDTATHLALYRRYPSLGGVVHTHSTHATAW
                     AQAGRAIPALGTTHADYFFGDIPCTRALTQTEVEGEYELNTGNVIIETLGESEPLHTP
                     GIVVYQHGPFAWGKDAHDAVHNAVVMEEVARMAWIARGINPQLQGIDDYLMNKHFMRK
                     HGPNAYYGQK"
     misc_feature    585587..586270
                     /locus_tag="ECL_00592"
                     /note="L-ribulose-5-phosphate 4-epimerase; Reviewed;
                     Region: sgaE; PRK12348"
                     /db_xref="CDD:183460"
     misc_feature    order(585614..585616,585626..585628,585650..585652,
                     585722..585724,585728..585733,585869..585871,
                     585875..585880,585893..585901,585920..585922,
                     585926..585931,585971..585973,586082..586084,
                     586115..586117,586136..586138,586148..586150,
                     586169..586171,586229..586231)
                     /locus_tag="ECL_00592"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238232"
     misc_feature    order(585665..585667,585713..585718,585800..585808,
                     585863..585865,585869..585871,586085..586087)
                     /locus_tag="ECL_00592"
                     /note="active site"
                     /db_xref="CDD:238232"
     misc_feature    order(585863..585865,585869..585871,586085..586087)
                     /locus_tag="ECL_00592"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238232"
     gene            complement(586413..586688)
                     /locus_tag="ECL_00593"
                     /db_xref="GeneID:9123102"
     CDS             complement(586413..586688)
                     /locus_tag="ECL_00593"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611108.1"
                     /db_xref="GeneID:9123102"
                     /translation="MKKIAIAVMAALLLSANAMAAIKIDSRQARNMDDVQSLGVIYIN
                     HHFATESEADQALNKETDAQGANYYHVILMREPGSNGNMHASADIYR"
     misc_feature    complement(586419..586583)
                     /locus_tag="ECL_00593"
                     /note="Protein of unknown function (DUF1471); Region:
                     DUF1471; pfam07338"
                     /db_xref="CDD:311344"
     gene            587032..587427
                     /locus_tag="ECL_00594"
                     /db_xref="GeneID:9123103"
     CDS             587032..587427
                     /locus_tag="ECL_00594"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S6"
                     /protein_id="YP_003611109.1"
                     /db_xref="GeneID:9123103"
                     /translation="MRHYEIVFMVHPDQSEQVPGMIERYSAAITGAEGTIHRLEDWGR
                     RQLAYPINKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASPM
                     VKAKDERRERRDDFANETADDSDAGDSEE"
     misc_feature    587032..587352
                     /locus_tag="ECL_00594"
                     /note="30S ribosomal protein S6; Reviewed; Region: rpsF;
                     PRK00453"
                     /db_xref="CDD:179034"
     misc_feature    order(587041..587043,587176..587178,587188..587190,
                     587233..587235,587242..587247,587266..587268,
                     587287..587289,587296..587304)
                     /locus_tag="ECL_00594"
                     /note="rRNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:275385"
     misc_feature    order(587044..587046,587050..587052,587164..587166,
                     587170..587178,587206..587208,587212..587214,
                     587287..587289,587299..587301)
                     /locus_tag="ECL_00594"
                     /note="S18 interface [polypeptide binding]; other site"
                     /db_xref="CDD:275385"
     gene            587581..587748
                     /locus_tag="ECL_00595"
                     /db_xref="GeneID:9123104"
     CDS             587581..587748
                     /locus_tag="ECL_00595"
                     /codon_start=1
                     /transl_table=11
                     /product="primosomal replication protein N"
                     /protein_id="YP_003611110.1"
                     /db_xref="GeneID:9123104"
                     /translation="MPVIISGHENQAITHSLTVGSAVIVQGFISCHKAKNGLSKMVLH
                     AEQIDLIDSGD"
     misc_feature    <587581..587736
                     /locus_tag="ECL_00595"
                     /note="Replication protein A, class 2b aminoacyl-tRNA
                     synthetases, and related proteins with
                     oligonucleotide/oligosaccharide (OB) fold; Region:
                     RPA_2b-aaRSs_OBF_like; cl09930"
                     /db_xref="CDD:299125"
     gene            587753..587980
                     /locus_tag="ECL_00596"
                     /db_xref="GeneID:9123105"
     CDS             587753..587980
                     /locus_tag="ECL_00596"
                     /codon_start=1
                     /transl_table=11
                     /product="30S ribosomal protein S18"
                     /protein_id="YP_003611111.1"
                     /db_xref="GeneID:9123105"
                     /translation="MARYFRRRKFCRFTAEGVQEIDYKDIATLKNYITESGKIVPSRI
                     TGTRAKYQRQLARAIKRARYLSLLPYTDRHQ"
     misc_feature    587753..587968
                     /locus_tag="ECL_00596"
                     /note="30S ribosomal protein S18; Reviewed; Region: rpsR;
                     PRK00391"
                     /db_xref="CDD:178997"
     gene            588022..588471
                     /locus_tag="ECL_00597"
                     /db_xref="GeneID:9123106"
     CDS             588022..588471
                     /locus_tag="ECL_00597"
                     /codon_start=1
                     /transl_table=11
                     /product="50S ribosomal protein L9"
                     /protein_id="YP_003611112.1"
                     /db_xref="GeneID:9123106"
                     /translation="MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATKKNV
                     EFFEARRAELEAKLADVLAAANARAEAINALGTVTIASKAGDEGKLFGSIGTRDIADA
                     VSAAGVKVAKSEVRLPNGVLRTTGEHEVDFQVHSEVFAKLVVNVVAE"
     misc_feature    588022..588468
                     /locus_tag="ECL_00597"
                     /note="50S ribosomal protein L9; Reviewed; Region: rplI;
                     PRK00137"
                     /db_xref="CDD:234659"
     gene            588623..589552
                     /locus_tag="ECL_00598"
                     /db_xref="GeneID:9123107"
     CDS             588623..589552
                     /locus_tag="ECL_00598"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611113.1"
                     /db_xref="GeneID:9123107"
                     /translation="METALSTPVFARRNVAYACATLCCLLWGSSYPAIKSGYELFQIA
                     TDDIPSKVVFAGYRFLFAGALLLLFALAQRKPIARLTPTQFGQLTILGLTQTTIQYTF
                     FYIGLAYTTGVNGSIMNATGTFFSVLLAHFIYHNDKLSYNKTLGCILGFAGVMLVNFH
                     SGIRDFRFVWNGDGFVVLAAFILSAATLYGKRISQTVDPTVMTGWQLGIGGLALVAGG
                     YATGGTLEVHSLTAVAVLGYLTLLSSVAFALWSALLKVNRVSMIAPFNFVIPVAGTVL
                     SAIFLGENILEIKYAIALVLVCSGIWWVNKRSA"
     misc_feature    588668..589543
                     /locus_tag="ECL_00598"
                     /note="Permease of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism, Amino
                     acid transport and metabolism, General function prediction
                     only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     gene            complement(589599..590243)
                     /locus_tag="ECL_00599"
                     /db_xref="GeneID:9123108"
     CDS             complement(589599..590243)
                     /locus_tag="ECL_00599"
                     /codon_start=1
                     /transl_table=11
                     /product="opacity-associated protein A"
                     /protein_id="YP_003611114.1"
                     /db_xref="GeneID:9123108"
                     /translation="MPGRFELKPTLAKIWHAPDNFRIMDPLPPLHRRGIIIGALLMIV
                     GFLLPSGGDNVDTAPVTRNAQLDLQSQTRPQPDTQTMQTQLVTPSNDPGQVAPVEPEP
                     IQEEQPQEQAAAPSEPQTQQPTGIEQQWRSYRVEAGKTLAQLFRDHNLPPTDVYAMAQ
                     VEGAGKPLSNLQNGQMVQIRQNASGVVTGLTIDTGNGQQVLFTRQPDGSFIRAR"
     misc_feature    complement(589602..590243)
                     /locus_tag="ECL_00599"
                     /note="Cell envelope opacity-associated protein A
                     (function unknown) [Function unknown]; Region: OapA;
                     COG3061"
                     /db_xref="CDD:225603"
     gene            590477..591097
                     /locus_tag="ECL_00600"
                     /db_xref="GeneID:9123109"
     CDS             590477..591097
                     /locus_tag="ECL_00600"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidyl-prolyl cis-trans isomerase"
                     /protein_id="YP_003611115.1"
                     /db_xref="GeneID:9123109"
                     /translation="MTTPTFDTIEAQASYGIGLQVGQQLSESGLEGLLPEALVAGIAD
                     ALEGKQPAVPVDVVHRALREIHERADAVRRARFEEMAAEGVKYLEENREREGVNSTES
                     GLQFRVINQGDGAIPARTDHVRVHYTGKLIDGTVFDSSVARGEPAEFPVNGVIAGWIE
                     ALTLMPVGSKWELTIPHNLAYGERGAGASIPPFSTLVFEVELLEIL"
     misc_feature    590477..591094
                     /locus_tag="ECL_00600"
                     /note="peptidyl-prolyl cis-trans isomerase; Provisional;
                     Region: PRK11570"
                     /db_xref="CDD:183207"
     gene            591409..592818
                     /locus_tag="ECL_00601"
                     /db_xref="GeneID:9123110"
     CDS             591409..592818
                     /locus_tag="ECL_00601"
                     /codon_start=1
                     /transl_table=11
                     /product="D-alanine/D-serine/glycine permease"
                     /protein_id="YP_003611116.1"
                     /db_xref="GeneID:9123110"
                     /translation="MVDQVKVAATEEATSEQSLRRNLTNRHIQLIAIGGAIGTGLFMG
                     SGKTISLAGPSIIFVYMIIGFMLFFVMRAMGELLLSNLEYKSFSDFASDLLGPWAGYF
                     TGWTYWFCWVVTGMADVVAITAYAQFWFPGLSDWVASLAVIVLLLSLNLATVKMFGEM
                     EFWFAMIKIVAIVALIVVGLVMVLTHFQSPTGVQASFTHLWNDGGWFPKGISGFFAGF
                     QIAVFAFVGIELVGTTAAETKDPEKSLPRAINSIPVRIIMFYVFALIIIMSVTPWSSV
                     VPSKSPFVELFVLVGLPAAASLINFVVLTSAASSANSGVFSTSRMLFGLAQEGVAPSA
                     FAKLSKRAVPAKGLTFSCMCLLGGVVMLYVNPSVIGAFTMITTVSAILFMFVWTIILC
                     SYLVYRKQRPHLHEKSIYKMPLGKLMCWVCMAFFAFVLVLLTLEDDTRQALIVTPLWF
                     IALGLGWLFIGKKRMAGVR"
     misc_feature    591412..592815
                     /locus_tag="ECL_00601"
                     /note="D-alanine/D-serine/glycine permease; Provisional;
                     Region: PRK11049"
                     /db_xref="CDD:236830"
     gene            complement(592914..593576)
                     /locus_tag="ECL_00602"
                     /db_xref="GeneID:9123111"
     CDS             complement(592914..593576)
                     /locus_tag="ECL_00602"
                     /codon_start=1
                     /transl_table=11
                     /product="iron-sulfur cluster repair di-iron protein"
                     /protein_id="YP_003611117.1"
                     /db_xref="GeneID:9123111"
                     /translation="MAFRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAASRK
                     ELDVEVIEAELALLAEQPINKEWRTAPLAEIIDHIIVRYHDRHREQLPELILQATKVE
                     RVHADKPSVPRGLAKYLTMLHEELTSHMMKEEQILFPMIKQGMGSQAMGPISVMESEH
                     DDAGELLEVIKHTTNNVTPPPEACTTWKAMYNGINEMIDDLMEHISLENNVLFPRALA
                     GK"
     misc_feature    complement(592917..593576)
                     /locus_tag="ECL_00602"
                     /note="iron-sulfur cluster repair di-iron protein;
                     Provisional; Region: PRK10992"
                     /db_xref="CDD:236812"
     gene            593821..595470
                     /locus_tag="ECL_00603"
                     /db_xref="GeneID:9123112"
     CDS             593821..595470
                     /locus_tag="ECL_00603"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003611118.1"
                     /db_xref="GeneID:9123112"
                     /translation="MFKRIKVITLLISVLLVLGIMQLVSAGIFINALNNDKDNFTVSQ
                     LSSKNVAEFTDAWISLNQARVTLNRGMLRLQSSMASQINGGQLNELVNTAKNLLANAQ
                     SHYDKYYALPNTPGLDPNLANRLEEQYRNYSATLTQMNVLLSQGNLEEMFKQNAEQKQ
                     TAMQNVYREWREAQAVLTDKGIKDNESDYKRILWILSAVMLLVIIVIISSWIAMRRVL
                     LLPLQDVISHIRAIAAGDLTQPIHAEGKNEMAVLAQNVQEMQTALANTVGVVREGADT
                     IYTGAGEISAGSNDLSSRTEQQAASLEETAASMEQLTATVKQNADNARQASRLALDAS
                     STAKKGGNVVEGVVRTMDEIATSSSKIAQITNVIDGIAFQTNILALNAAVEAARAGEQ
                     GRGFAVVAGEVRTLAQRSAQAAKEIKALIDDSGERVNAGSQLVNEAGATMAEIVNAVT
                     RVTDIMGEIASASDEQSRGIDQVGQAVAEMDRVTQQNASLVEESAAAAAALEDQAARL
                     NDAVAVFKIARSQAVKAAPAKTYAPKAQPVASASEANWETF"
     misc_feature    593821..595467
                     /locus_tag="ECL_00603"
                     /note="Methyl-accepting chemotaxis protein (MCP)
                     signalling domain; Region: MCPsignal; cl28165"
                     /db_xref="CDD:332985"
     gene            complement(595533..596498)
                     /locus_tag="ECL_00604"
                     /db_xref="GeneID:9123113"
     CDS             complement(595533..596498)
                     /locus_tag="ECL_00604"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611119.1"
                     /db_xref="GeneID:9123113"
                     /translation="MISGVLYALLAGLMWGLIFVGPLIVPEYPAALQSTGRYLALGLI
                     ALPLAWLGRTRLRQLNRQDWMTALALTMMGNLIYYVCLASAIQRTGAPVSTMIIGTLP
                     VVIPVFANLLYSQRDGKLAWSKMVPALICTGVGLVCVNIAELRHGLADFSVWRYGSGI
                     GLAFISVACWAWYALRNARWLRENPDKHPMMWATAQALVTLPVSLVGYAGACLWSGQQ
                     QPDFALPFGPRPWVFVGLMIAIAVLCSWVGALCWNIASQKLPTVILGPLIVFETLAGL
                     LYTFLMRQSVPPLLTACGIVLLVMGVVMAVRAKPEKPMVVPASEM"
     misc_feature    complement(595572..596498)
                     /locus_tag="ECL_00604"
                     /note="Permease of the drug/metabolite transporter (DMT)
                     superfamily [Carbohydrate transport and metabolism, Amino
                     acid transport and metabolism, General function prediction
                     only]; Region: RhaT; COG0697"
                     /db_xref="CDD:223769"
     gene            complement(596574..597398)
                     /locus_tag="ECL_00605"
                     /db_xref="GeneID:9123114"
     CDS             complement(596574..597398)
                     /locus_tag="ECL_00605"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_003611120.1"
                     /db_xref="GeneID:9123114"
                     /translation="MQGVPEQFSDERDSARFRHLAQLPGLELYHAHIADYAFEPHTHE
                     AFGIGTIETGAERFRYRGTQHLAAEKSVVTMNPDEIHTGESATEGGWRYRMVYIEPAL
                     LEEVTGLRHWWFSDVTRHDPLRSQQIGQLIYGLWHTQDPLAQKGLLLDLIETFQPLAH
                     HAPIIKEGAHRFERVREYLHDNYMHAVTLDELANVVSLSPYHFQRQFKAHFHVTPHQM
                     LMAIRLWRAKGFLTHGMPAAEVAAATGLTDQSHLTRAFTRRYGITPVRYQKQVIGR"
     misc_feature    complement(596988..597332)
                     /locus_tag="ECL_00605"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:308111"
     misc_feature    complement(596589..596948)
                     /locus_tag="ECL_00605"
                     /note="AraC-type DNA-binding domain and AraC-containing
                     proteins [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     gene            complement(597448..598278)
                     /locus_tag="ECL_00606"
                     /db_xref="GeneID:9123115"
     CDS             complement(597448..598278)
                     /locus_tag="ECL_00606"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="YP_003611121.1"
                     /db_xref="GeneID:9123115"
                     /translation="MPIRTHSGFSITADTTLADDRHYDVIYIPALWRNPRAVVRQQPE
                     LLAWLSEQAARGTRIAAVGTGCCFLAESGLLNGKPATTHWHYFRQFSRDYPSVKLQTK
                     HFLTQAENIYCAASVKALSDLTIHFIETIYGKRVATHTQRTFFHEIRSQFDRQCYSEE
                     NKPHPDEDIVQIQTWIKANCASDISMQNLADMAGMSLRNFNRRFKNATDMSPLQYLLT
                     ARIELAMNMLQSTNLCIQEIANAVGYEDIAHFNRQFKHKTTVSPGDYRKTVRAKMFSA
                     "
     misc_feature    complement(597838..>598275)
                     /locus_tag="ECL_00606"
                     /note="AraC transcriptional regulators having a Type 1
                     glutamine amidotransferase (GATase1)-like domain; Region:
                     GATase1_AraC_2; cd03138"
                     /db_xref="CDD:153232"
     misc_feature    complement(<598027..>598266)
                     /locus_tag="ECL_00606"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    complement(598090..598092)
                     /locus_tag="ECL_00606"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153232"
     misc_feature    complement(597463..597828)
                     /locus_tag="ECL_00606"
                     /note="AraC-type DNA-binding domain and AraC-containing
                     proteins [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    complement(597631..597753)
                     /locus_tag="ECL_00606"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:278590"
     misc_feature    complement(597478..597591)
                     /locus_tag="ECL_00606"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:278590"
     gene            598265..598396
                     /locus_tag="ECL_00607"
                     /db_xref="GeneID:9123116"
     CDS             598265..598396
                     /locus_tag="ECL_00607"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611122.1"
                     /db_xref="GeneID:9123116"
                     /translation="MRIGKLFMPMVLTFKMLSGRQSLKRDRFAGGVSVLAFVFCSAK"
     gene            598669..600567
                     /locus_tag="ECL_00608"
                     /db_xref="GeneID:9123117"
     CDS             598669..600567
                     /locus_tag="ECL_00608"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-ketoacyl synthase"
                     /protein_id="YP_003611123.1"
                     /db_xref="GeneID:9123117"
                     /translation="MVKLPVITAFGGYGPAGRSSSHHAFRRMVIESLSEEERQQTLLS
                     LAILMGLLKYDEGGYCDISGKRFTPDQAAATIKNEALEGSLIRKITDDNFDVDAIVSH
                     AKLNMASDENGFSFNISSRQLPQPLPQGWHAEELTDQRVRITVRGDMDCRIETLLRTE
                     VQAAGLLPQGFRPGDYYNSQFHPRALQMAVVGASDAINALGIPWRDIQAKISPDKLGI
                     YSGNIMGQLDEYGFGGMLQSRLKGHRVSAKQCPLGLNSMCADFLNAYVLGSVGHTSAT
                     LGACATFLYNLNAAVEDIKAGRIRMAVVGSAEAPVTSEVIEGFDAMGALATESKLRHI
                     DQTETADWRNSSRPFGNSCGFVIAESSQYIVLMDDELAMQLGAEIHGSVGNVFINADG
                     YKRSIASPGPGNYITMAKAVASAVSMVGLETVQKGSFIQAHGSSTPKNCVSEADIFDR
                     VAQAFSIHNWPVTAVKSYLGHSLGPASGDQLISCLGVFRYGILPGIKSVSHIAPQVNN
                     ARLHIPVQDCKLEDEQGQIAFINSKGFGGNNATGVVYSPKLTQQWLRKRYGEPAFADY
                     QQRNRQVQRQARAYDEAASHGELNVIYLFGQQGINEDDINIDMNGITIPGFEKPISFA
                     REKEYSDF"
     misc_feature    <598675..599034
                     /locus_tag="ECL_00608"
                     /note="3-oxoacyl-ACP reductase domain of yeast-type FAS1
                     [Lipid transport and metabolism]; Region: FabG2; COG4982"
                     /db_xref="CDD:227315"
     misc_feature    599113..600300
                     /locus_tag="ECL_00608"
                     /note="'elongating' condensing enzymes are a subclass of
                     decarboxylating condensing enzymes, including
                     beta-ketoacyl [ACP] synthase, type I and II and polyketide
                     synthases.They are characterized by the utlization of acyl
                     carrier protein (ACP) thioesters as...; Region:
                     elong_cond_enzymes; cd00828"
                     /db_xref="CDD:238424"
     misc_feature    order(599506..599508,599965..599967,600079..600081)
                     /locus_tag="ECL_00608"
                     /note="active site"
                     /db_xref="CDD:238424"
     gene            complement(600782..601630)
                     /locus_tag="ECL_00609"
                     /db_xref="GeneID:9123118"
     CDS             complement(600782..601630)
                     /locus_tag="ECL_00609"
                     /codon_start=1
                     /transl_table=11
                     /product="NmrA family protein"
                     /protein_id="YP_003611124.1"
                     /db_xref="GeneID:9123118"
                     /translation="MIAITGATGQLGRLVIEQLLKTVPANQIVAIVRNPAKAEALSQQ
                     GIVVRQGDYTDQAALTTALKGVKKLLLISSSEVGQRATQHQNVINAAKAAGVIFIAYT
                     SLLHADNSPLGLHVEHVATEKALATSSIPYALLRNGWYTENYLASAPPALEHGVFIGA
                     AGEGKIASATRADYAAAAAKVVSEEGHAGKVYELAGDSAWTLSELAAELSKQSGKPVV
                     YQNMSEADFAAALKSVGLPAGLADMLADSDVGASKGGLFDDSHTLSKLIGRPTTSLAE
                     SVKTIL"
     misc_feature    complement(600809..601627)
                     /locus_tag="ECL_00609"
                     /note="triphenylmethane reductase (TMR)-like proteins,
                     NMRa-like, atypical (a) SDRs; Region: TMR_SDR_a; cd05269"
                     /db_xref="CDD:187578"
     misc_feature    complement(order(601118..601120,601211..601219,
                     601406..601417,601469..601480,601520..601522,
                     601529..601534,601598..601609,601613..601615))
                     /locus_tag="ECL_00609"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187578"
     gene            601720..602100
                     /locus_tag="ECL_00610"
                     /db_xref="GeneID:9123119"
     CDS             601720..602100
                     /locus_tag="ECL_00610"
                     /codon_start=1
                     /transl_table=11
                     /product="HxlR family transcriptional regulator"
                     /protein_id="YP_003611125.1"
                     /db_xref="GeneID:9123119"
                     /translation="MTIPTLSEQMRDGNLFAEQCPSREVLKHVTSRWGVLILVALRER
                     THRFSDLRRKMGGVSEKMLAQSLQALEHDGFVDRVSYPVVPPHVEYSLTPLGVEVSEK
                     VAALADWIEVNTPKVMANRDERAA"
     misc_feature    601747..602091
                     /locus_tag="ECL_00610"
                     /note="DNA-binding transcriptional regulator, HxlR family
                     [Transcription]; Region: HxlR; COG1733"
                     /db_xref="CDD:224647"
     gene            complement(602198..604141)
                     /locus_tag="ECL_00611"
                     /db_xref="GeneID:9123120"
     CDS             complement(602198..604141)
                     /locus_tag="ECL_00611"
                     /codon_start=1
                     /transl_table=11
                     /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase"
                     /protein_id="YP_003611126.1"
                     /db_xref="GeneID:9123120"
                     /translation="MIKFSATLLATLIAASVQAATVDLRILETTDLHSNMMDFDYYKD
                     TPTEKFGLVRTASLINAARNEVKNSVLVDNGDLIQGSPLGDYMAAKGLKKGEIHPVYK
                     AMNTLDYIVGNLGNHEFNYGLKYLHDALAGAKFPYVNANIIDVKTKKPLFTPYLIKET
                     EVVDQDGKKQTLKIGYIGFVPPQIMTWDKANLTGKVTVNDITETARKYVPEMREKGAD
                     VVVVVAHSGLSADPYQVMAENSVYYLSEVPGVDAILFGHAHAVFPGKDFASIKGADID
                     KGTLNGVPAVMPGMWGDHLGVVDLVLNNDSGSWKVTGSKAEARPIYDAAAKKSLAAED
                     QKLLDVLKHDHDATREFVSKPIGKSADNMYSYLALIQDDPTVQVVNMAQKAYAEHFVQ
                     GDPDLANLPVLSAAAPFKVGGRKNDPASYVEVEKGHLTFRNAADLYLYPNTLVVVKAT
                     GKEVKEWLECSAGQFNQIDPKSSKPQSLINWDGFRTYNFDVIDGVDYQIDVTQPAKYD
                     GECQAINPQAERIKNLTFKGKPVDPAATFLVVTNNYRAYGGKFAGTGDSHIAFASPDE
                     NRSVLAAWISAESKKAGEIHPAVDNNWRLAPIHSDTPLDIRIETSPSDKAAAFIKEKA
                     QYPMKKVATDDIGFAIYQVDLSK"
     misc_feature    complement(602201..604141)
                     /locus_tag="ECL_00611"
                     /note="bifunctional 2',3'-cyclic nucleotide
                     2'-phosphodiesterase/3'-nucleotidase periplasmic precursor
                     protein; Reviewed; Region: cpdB; PRK09420"
                     /db_xref="CDD:236506"
     gene            604332..605072
                     /locus_tag="ECL_00612"
                     /db_xref="GeneID:9123121"
     CDS             604332..605072
                     /locus_tag="ECL_00612"
                     /codon_start=1
                     /transl_table=11
                     /product="3'(2'),5'-bisphosphate nucleotidase CysQ"
                     /protein_id="YP_003611127.1"
                     /db_xref="GeneID:9123121"
                     /translation="MLDKICQLARDAGDAIMQVYDGAQPMNVVSKADDSPVTAADIAA
                     HGVIMKGLQALTPEIPVLSEEAPQSWDERQHWQRYWLVDPLDGTKEFIKRNGEFTVNI
                     ALIDKGKAVLGVVYAPVMKVMYSAAEGKAWKEECGVRKPIQVRDARPPLVVISRSHSD
                     SELEEYLQQLGEHQTTSIGSSLKFCLVAEGQAQLYPRFGPTNIWDTAAGHAVAAAAGA
                     HVHDWQGKPLDYTPRESFLNPGFRVSLY"
     misc_feature    604332..605069
                     /locus_tag="ECL_00612"
                     /note="adenosine-3'(2'),5'-bisphosphate nucleotidase;
                     Provisional; Region: PRK10931"
                     /db_xref="CDD:182848"
     misc_feature    order(604452..604454,604521..604526,604578..604595,
                     604599..604601,604794..604796,604803..604805,
                     604878..604880,604914..604916,604941..604946)
                     /locus_tag="ECL_00612"
                     /note="active site"
                     /db_xref="CDD:238816"
     gene            complement(605066..605623)
                     /locus_tag="ECL_00613"
                     /db_xref="GeneID:9123122"
     CDS             complement(605066..605623)
                     /locus_tag="ECL_00613"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_003611128.1"
                     /db_xref="GeneID:9123122"
                     /translation="MTLRNILAAACLLLPLWASAHNIEKGQRVPPVGIADRGELILDN
                     DKFSYKPWNSAQLAGKVRVVQHIAGRTSAKEKNANLVEAIKAAKFPHDRYQTTTIVNT
                     DDAIPGSGMFVRSSLESNKKLYPWSQFIVDSNGVTRKAWQLEEESSAIIVLDKNGQVQ
                     WVKDGALTQEEVQQVVDLLHKLLAQ"
     misc_feature    complement(605075..605623)
                     /locus_tag="ECL_00613"
                     /note="Bacterial protein of unknown function
                     (YtfJ_HI0045); Region: YtfJ_HI0045; cl17398"
                     /db_xref="CDD:302642"
     gene            605948..606154
                     /locus_tag="ECL_00614"
                     /db_xref="GeneID:9123123"
     CDS             605948..606154
                     /locus_tag="ECL_00614"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611129.1"
                     /db_xref="GeneID:9123123"
                     /translation="MKIFQRYNPLQVAKYVKILFRGRLYIKDVGAFEFDKGKILVPKV
                     KDKQHLSVMSEVNRQVMRLQTEMA"
     misc_feature    605948..606136
                     /locus_tag="ECL_00614"
                     /note="Protein of unknown function (DUF1107); Region:
                     DUF1107; pfam06526"
                     /db_xref="CDD:310846"
     gene            complement(606226..607563)
                     /locus_tag="ECL_00615"
                     /db_xref="GeneID:9123124"
     CDS             complement(606226..607563)
                     /locus_tag="ECL_00615"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611130.1"
                     /db_xref="GeneID:9123124"
                     /translation="MLNSILVILCLIAVSAFFSISEISLAASRKIKLKLLADEGNINA
                     SRILKMQENPGTFFTVVQIGLNAVAILGGIVGDAAFSPAFYSLFVQYMSAELAEQMSF
                     ILSFSLVTGMFILFADLTPKRIGMIAPEAVALRIINPMRFCLFVFRPLVWFFNGLANV
                     IFRIFKLPMVRKDDITSDDIYAVVEAGALAGVLRKQEHELIENVFELESRTVPSSMTG
                     RESVIWFDLHEDEQSLKNKVAEHPHSKFLVCNEDIDHIIGYVDSKDLLNRVLANQSLA
                     LNSGVQIRNTLIVPDTLTLSEALESFKTAGEDFAVIMNEYALVVGIITLNDVMTTLMG
                     DLVGQGLEEQIVARDENSWLIDGATPIDDVMRVLDIDEFPQSGNYETIGGFMMFMLRK
                     IPKRTDSVKFSGYKFEVVDIDNYRIDQLLVTRIDNKPTVLVPKLPDAEEKVSA"
     misc_feature    complement(606277..607563)
                     /locus_tag="ECL_00615"
                     /note="Hemolysin or related protein, contains CBS domains
                     [General function prediction only]; Region: TlyC; COG1253"
                     /db_xref="CDD:224173"
     gene            608095..609834
                     /locus_tag="ECL_00616"
                     /db_xref="GeneID:9123125"
     CDS             608095..609834
                     /locus_tag="ECL_00616"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent OLD family endonuclease"
                     /protein_id="YP_003611131.1"
                     /db_xref="GeneID:9123125"
                     /translation="MKLERIEIQNFRGIGTASINLENFTTLIGSNNIGKSTVLKAIKI
                     LVDTTNPTTEDWPFRQASDGELIIAGYFIDIQDWERTKPAISNLILNDKLAIRVRATW
                     DEDNNCISLPIYEAYCRREIIEGFTNKITEARRVPYLLEIIERLDVNSSEAYKANLQQ
                     VIEIIRTEYPDKVTTEEGWSSENINFKNSLQQALPHILYIPACFKIEDDLKSQKGTPF
                     GHLFSNRIFPALQADSSFSGYLDSANYMQRKMKGEIDGETIEGLMELMDSISESLNKV
                     MDISSKVKLSVGEIDINSVFMKAAGLVIEDRLETQLEYQGSGVQRALAYALLESNAIF
                     EVSESRRSTIILYEEPELYIHPHLMRLLRDTLRSKSSGSEWQVIVSTHSPFLIDIAEN
                     PSSLKLLKDHDNGTRTVHEINEDIFSVGGQYNERDMLRAALDFHPTVCEAFFAKRVVV
                     VEGDTEVAILRFAENLCDKFEINKRLVKDTTIVSAGGKWTIPAIARILRKLNIPFKVI
                     HDTDRKGRTDQELEALSPISEYKANEKIESIVGADDVYRVDDTFEHVLWNLETDGEAP
                     TDGGKPFNAWKRM"
     misc_feature    608095..609255
                     /locus_tag="ECL_00616"
                     /note="AAA ATPase domain; Region: AAA_15; pfam13175"
                     /db_xref="CDD:315766"
     misc_feature    609421..609726
                     /locus_tag="ECL_00616"
                     /note="TOPRIM_OLD: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in bacterial and archaeal nucleases of the OLD (overcome
                     lysogenization defect) family. The bacteriophage P2 OLD
                     protein, which has DNase as well as...; Region:
                     TOPRIM_OLD; cd01026"
                     /db_xref="CDD:173776"
     misc_feature    order(609448..609453,609460..609462,609622..609624,
                     609628..609630)
                     /locus_tag="ECL_00616"
                     /note="putative active site [active]"
                     /db_xref="CDD:173776"
     misc_feature    order(609448..609450,609622..609624)
                     /locus_tag="ECL_00616"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173776"
     gene            complement(610146..611693)
                     /locus_tag="ECL_00617"
                     /db_xref="GeneID:9123126"
     CDS             complement(610146..611693)
                     /locus_tag="ECL_00617"
                     /codon_start=1
                     /transl_table=11
                     /product="putative oligogalacturonide transporter"
                     /protein_id="YP_003611132.1"
                     /db_xref="GeneID:9123126"
                     /translation="MVKPTERRVGYGVALGYGITDLFGGGAFAIIGTWLLFFYTTYCG
                     LSVVEAGSIFAIARVIDALLSPIMGYITDNFGDTWLGRKFGRRRFFLLLSSPLMFLYA
                     LLWMTDMGYWYYLGTYLSIELLSAMVLVPWETLAAEMTNRYEERSRLSGVRMICSQLG
                     GFLAVSVPGVIMQFTGKDNPFTYTLTGLIFSCVFCIAVFITWYTTWEAKDVQQPSTFK
                     VDKQRSSGLINHLKYLVLDLFSSFRIRAFRLHIIIYIFSFTAMDVFGSVFTYYVVYCL
                     SQDAAAVSGWLSIAAFASVPGTYGFMLLLNRLNVSPSAALRLSYGGIFFVLVFLFTVY
                     LTKTQVPTLLFTAVFILLGATRAGLYYIPWNIYSFIPDIDEMVTQQRREGIFAGVMVL
                     TRKSTVAIAIMIIGLVLQESGFVKGGGAQPESALGAIIGLMIFATAALLAVSFFTTYK
                     FKLTRETHKLLLKEIARRKLGGDYRDCDANTRVVIKQLTGYEYDQVWGGDAARRAVNK
                     LNLSSIK"
     misc_feature    complement(610278..611651)
                     /locus_tag="ECL_00617"
                     /note="MFS/sugar transport protein; Region: MFS_2;
                     cl26210"
                     /db_xref="CDD:331031"
     gene            complement(611776..612795)
                     /locus_tag="ECL_00618"
                     /db_xref="GeneID:9123127"
     CDS             complement(611776..612795)
                     /locus_tag="ECL_00618"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611133.1"
                     /db_xref="GeneID:9123127"
                     /translation="MKLLNTAVIGAGAIHGCHVNALRQLPNVALRALADIDSVKGLKL
                     ALGYQCRFYQDYREMLLDDAIDVVHICTPHFEHKSMILAALAAGKHVFCEKPVGMNSS
                     ELVDITRAADQATGLLGVCYQNRLNPTSLRIRQALDEGELGKMLSIKAVLTWSRSGAY
                     YTQSPWRGRLATEGGSLLINQAIHTLDLMQWFAGGVTRVKGVVDSGELADVTEGEDSA
                     MATLHFANGARGLFYASNCNTTDSPLLMEIHCEQGSLLLNDNTLWRVTPGERVRLTCD
                     DSPDGSVKSYWGLGHQQAIRRFYQAITHPGYTDYTDIREAGKSLTLVEAIYRSSQLRQ
                     WIEIN"
     misc_feature    complement(611782..612795)
                     /locus_tag="ECL_00618"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     gene            complement(612808..613875)
                     /locus_tag="ECL_00619"
                     /db_xref="GeneID:9123128"
     CDS             complement(612808..613875)
                     /locus_tag="ECL_00619"
                     /codon_start=1
                     /transl_table=11
                     /product="putative dehydrogenase"
                     /protein_id="YP_003611134.1"
                     /db_xref="GeneID:9123128"
                     /translation="MNKNDGMNYAPVGKPQPVVREGEFVFAAAALDHGHIYGMSNGLI
                     EAGATLKWVYDPDPAKVDKFIQQYPQARVADSLDVILADDEVRLVAGAAIPAERCALG
                     LKAMAAGKDYFTDKAPLTTLEQLADAKAMVEKTGRKYAVYYSERLHVESAVFAGQLVQ
                     QGAIGRVVQTLGTGPHREGTGRPDWFYDRRYFGGILCDIGSHQIEQFLFYTGNSDATV
                     VASQVRNVKHPQYPAFEDFGDAMLKGENGASGYFRCDWFTPDGLSTWGDGRLTLLGTE
                     GYIEIRKYVDLTRGEQDVVYLVNNEGEFRYPVAGQVGFPFFGELILDCLHRTEHAMTQ
                     AHAFKAAELCVKAQMLANATA"
     misc_feature    complement(612835..613746)
                     /locus_tag="ECL_00619"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     gene            complement(613872..615056)
                     /locus_tag="ECL_00620"
                     /db_xref="GeneID:9123129"
     CDS             complement(613872..615056)
                     /locus_tag="ECL_00620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611135.1"
                     /db_xref="GeneID:9123129"
                     /translation="MLNVAIVGTGNISHNHIQGYLQFGQRCRIVALVDIYPEKAHEKK
                     ARYNLTDARVYESHEQMLASEPDIDIVDVCTPPHVHAEISINALNAGCHVLCEKPMAA
                     SLEECDAMIAAQQASGKLLAIIAQNRFTDAFWRLKAALDSGLAGKVCHAQVDSFWWRG
                     HCYYDLWWRGTWEKEGGGCTLNHAVHHIDAIQWMLGFPSEVVAMMTNVAHDNAEVEDL
                     SAAIFKYPSGALTQLTASVVHHGEDQKIIIQGEKARISAPWQAFASVSADNGFPQEDR
                     DRQREAQLNAVFHETPKLEWTLHTGQINDLLYAIEHGTAPLVDGLQGKRSLELITAIY
                     KSAVTRCVVSLPIQRDDPFYRTGGTNALAPRFYEKSASVANFSEVGAIPLGKDLDEGV
                     TP"
     misc_feature    complement(614019..615056)
                     /locus_tag="ECL_00620"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     gene            complement(615073..616224)
                     /locus_tag="ECL_00621"
                     /db_xref="GeneID:9123130"
     CDS             complement(615073..616224)
                     /locus_tag="ECL_00621"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611136.1"
                     /db_xref="GeneID:9123130"
                     /translation="MEKVRFGIIGIGNIGTVHARYLLAGTVSDACLAAVCDNAPEKHP
                     AIRQLVGSLPLFSDAQEMLQSGLIDAVIVATPHYEHPRLSMLAMRHGIHTLCEKPAGV
                     YTAQVQEMNACARTCDVVFGIMYNQRPNPLYQKVKDLIDSGELGEIRRSNWIITNWYR
                     SQSYYNSGGWRATWKGEGGGVLLNQDPHQLDLWQWLVGMPIRLRAFCQFGKHRDIEVE
                     DEVTAYAEYANGATGVFITTVAETPGTNRLEIVGDRGKVVVEEGKLRYWRLRESETAF
                     NARWQNGFGEPECWEVTLPVGPECSEHHVITANFCGAILRGEPLIAPGLEGIHGLTLS
                     NAMHLSTWTDDWVDLPLNEKQYLRLLQQRISTSVAKETASVTLDASGTW"
     misc_feature    complement(615172..616179)
                     /locus_tag="ECL_00621"
                     /note="Predicted dehydrogenase [General function
                     prediction only]; Region: MviM; COG0673"
                     /db_xref="CDD:223745"
     gene            616435..617475
                     /locus_tag="ECL_00622"
                     /db_xref="GeneID:9123131"
     CDS             616435..617475
                     /locus_tag="ECL_00622"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="YP_003611137.1"
                     /db_xref="GeneID:9123131"
                     /translation="MEEIATLTGYSVSTVSRVLSGKSYASDKARDAIVRTARELGVLE
                     AMASGRLLINGIAVFAPERTFQGRGDIFYLEVTKGIAEACAPHNVWVSCCGLEEQHAD
                     VKLFMEKASHKNINAIIIIGTDDSTIFKLASTLNKPCVLINSVDRDRVLDAVSPDHRA
                     IGFTAMQYLFEQGHRRVLTLTCLRRETLYARLDGIKEAYRHFHVAFDPQRDLLVTEWF
                     TAEEAERALDAWLLSHDRSQWPEVIFPNSTSMTEGVIRALTRHGLRIPEDISLITTDF
                     AWNLAHRLEKPITGVTVPCRELGIEAVHLLQTRLNRPQAPVYNLLLQGKVMDYGSVSN
                     ATRHAARVALDQ"
     misc_feature    616435..617409
                     /locus_tag="ECL_00622"
                     /note="DNA-binding transcriptional regulator, LacI/PurR
                     family [Transcription]; Region: PurR; COG1609"
                     /db_xref="CDD:224525"
     gene            complement(617476..618012)
                     /locus_tag="ECL_00623"
                     /db_xref="GeneID:9123132"
     CDS             complement(617476..618012)
                     /locus_tag="ECL_00623"
                     /codon_start=1
                     /transl_table=11
                     /product="methionine sulfoxide reductase A"
                     /protein_id="YP_003611138.1"
                     /db_xref="GeneID:9123132"
                     /translation="MTNVPEGMEIALFAMGCFWGVERLYWQLPGVYSTAAGYTGGYTP
                     NPTYREVCSGETGHAEAVRVVYDPSVISYEQLLQVFWENHDPAQGMRQGNDHGTQYRS
                     AIYPLTPEQEAAALASKERFQQAMRDAGDTREVTTEITTAKPFYYAEDDHQQYLHKNP
                     YGYCGIGGIGVCLPPQLA"
     misc_feature    complement(617485..618003)
                     /locus_tag="ECL_00623"
                     /note="methionine sulfoxide reductase A; Provisional;
                     Region: PRK00058"
                     /db_xref="CDD:234604"
     gene            618343..620076
                     /locus_tag="ECL_00624"
                     /db_xref="GeneID:9123133"
     CDS             618343..620076
                     /locus_tag="ECL_00624"
                     /codon_start=1
                     /transl_table=11
                     /product="putative outer membrane protein"
                     /protein_id="YP_003611139.1"
                     /db_xref="GeneID:9123133"
                     /translation="MTKIRQLCLVSVLLTSGVASAANVRLQVEGLSGALEKNVRAQLS
                     TIESDEVTPDRRFRARVDDAIREGLKALGYYEPTIDFDLRPPPKKGRQVLIARVSPGE
                     PVLIGGTNVVLRGGARTDRDYLDLLSTRPKIGTVLNHGDYDSFKKSLTSVSLRKGYFD
                     SQFNKSQLGIALGRRQAFWDIDYDSGERYRFGDVTFEGSQIREEYLQNLVPFKKGDYY
                     HSRDLAELNRRLSATGWFNSVVVAPEFEKARKTKVLPLHGVVSPRTENTIETGAGYST
                     DVGPRVRATWKKPWMNSYGHSLTTSASISAPEQQLDFSYKIPLLKNPLEQYYLVQGGF
                     KRTDLNDTESDSTTLAVSRFWDLSSGWQRAINLRWSLDHFTQANVTNTTMLLYPGVMI
                     SRTRSRGGLMPTWGDSQRYSIDYSNTMWGSDVDFSVIQAQNVWIRTLYDKHRFVMRGN
                     LGWIETGDFDKVPPDLRFFAGGDRSIRGYKYKSIAPKDDDGKLIGASKLATGSLEYQY
                     NVSGKWWGAMFVDGGEAVSDIRRSDFKTGAGVGVRWQSPVGPIKLDFAVPVGDKEEHG
                     LQFYIGLGPEL"
     misc_feature    618343..620073
                     /locus_tag="ECL_00624"
                     /note="Outer membrane translocation and assembly module
                     TamA [Cell wall/membrane/envelope biogenesis]; Region:
                     TamA; COG0729"
                     /db_xref="CDD:223801"
     gene            620073..623849
                     /locus_tag="ECL_00625"
                     /db_xref="GeneID:9123134"
     CDS             620073..623849
                     /locus_tag="ECL_00625"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611140.1"
                     /db_xref="GeneID:9123134"
                     /translation="MSLWKKISLGVLIFIVLLLGTVAFLVGTTTGLHLLFNAANRWVP
                     GLEIGQVTGGWRDLRLKNIRYEQPGVAVNAGEFHLAVRLGCLRDSKLCVNDLSLKDVN
                     VAIDSEKMPKSAPVEEEDSGPLNLSTPYPIALYRVALDNVNVKIDDTTVSVMDFTSGL
                     RWQEKNLTLTPTTLQGLLIALPKVADVAQEEIVEPKIQNPQPEEKPLGETLKDLFSKP
                     VLPEMTDVHLPLNLNIEAFKGEQLRLTGDTDLTVYNMLLKVSSIDGNMKLDALDIDTN
                     QGSVNASGHALLRDNWPVDITLNSALNIDPLKGEKVKVKVGGALRDKLDVGVNLSGPV
                     DMVLRAQTQLAEAGLPLNLEVVSKQLYWPFTGEKQFQADDLKLKLSGKMTDYTLSFRT
                     AVKGQDVPPATITLDAKGNEQQVNLDKLTVAALEGKTELTALLDWQQAISWRGELKLS
                     GINTAKEVPDWPSKLDGLIKTRGSLYGGTWQMDVPEIKLTGNVKQNKVNVEGSLKGNS
                     YLQWVIPGLHVALGRNTADIKGELGVKDLNLDATIDAPNLDNALPGLGGTAKGLLKVR
                     GTVDAPQLLADITASNLRWQELSIARVRVDGDVKSTDQIGGNLNLRVERISQPDVNIN
                     LVTLDAKGNEKQHDLQLRVQGEPVSGQLHLTGSFDRKAERWKGTLDNTRFNTPVGPLV
                     LSRAIALDYRNAEQKISIGPHCWTNPNAELCVPQTIDAGAEGRAQITLNRFDLAMLKP
                     FMPDTTQASGVFSGKADVAWDTTKDGLPQGSVTLSGRNVKVTQDVNNAPLPVAFDTLN
                     LSADLHNNRAELGWLIRLTNNGQFDGKVQITDPQGRRNLGGNVSIRNFNLAMVNPIFS
                     RGEKAAGMLNANLRLAGNAQSPQLFGQMQLNGVDIDGNFMPFDMQPSHITMNFNGMSS
                     TLNGSVLTQQGQINLSGDADWSQLDNWRARIAAKGSKVRITVPPMVRLDVSPDIVFEA
                     TPSLFTLDGNVDVPWARIVVHEVPESAVGVSSDEVMLDDNLKPINQQSAGIPINSNLT
                     VHVGNNVRLNAFGLKARLTGDLKVAQDRQGLGLNGQINIPEGRFHAYGQDLIVRKGEL
                     LFSGPPDQPLLNIEAIRNPEATENDVIAGVRVTGSADEPKAEIFSDPAMSQQEALSYL
                     LRGQGLDSGQSDSAAMTSMLVGLGVAQSGQVVGKIGETFGVSNLALDTQGVGDSSQVV
                     VSGYVLPGLQVKYGVGIFDSLATLTLRYRLMPKLYLEAVSGVDQALDLLYQFEF"
     misc_feature    620073..623846
                     /locus_tag="ECL_00625"
                     /note="Autotransporter translocation and assembly factor
                     TamB [Intracellular trafficking, secretion, and vesicular
                     transport]; Region: TamB; COG2911"
                     /db_xref="CDD:225463"
     gene            623906..624196
                     /locus_tag="ECL_00626"
                     /db_xref="GeneID:9123135"
     CDS             623906..624196
                     /locus_tag="ECL_00626"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611141.1"
                     /db_xref="GeneID:9123135"
                     /translation="MTNALLLGNYNIENYQLYSLGHYPGAVPGEGTVHGEVYRIDNAT
                     LAELDALRTRGGEYARQLIQTPYGSAWMYVYQRPVEGLTRIVSGNWLDRDQY"
     misc_feature    623906..624190
                     /locus_tag="ECL_00626"
                     /note="Uncharacterized conserved protein YtfP,
                     gamma-glutamylcyclotransferase (GGCT)/AIG2-like family
                     [General function prediction only]; Region: YtfP; COG2105"
                     /db_xref="CDD:225016"
     misc_feature    order(623984..623989,623993..623995,624077..624091,
                     624095..624097,624116..624118,624125..624127)
                     /locus_tag="ECL_00626"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119400"
     misc_feature    624059..624061
                     /locus_tag="ECL_00626"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:119400"
     gene            complement(624238..624531)
                     /locus_tag="ECL_00627"
                     /db_xref="GeneID:9123136"
     CDS             complement(624238..624531)
                     /locus_tag="ECL_00627"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611142.1"
                     /db_xref="GeneID:9123136"
                     /translation="MGYIKAFDCYGKDSKWQYLCILAFQLAWFLGYLWIPYRSDYAIL
                     LFLLFFLPVISSNTRCINYYGRSRALCLLWLIAPYIMLFVPLFLTRRRDTEES"
     gene            complement(624509..624979)
                     /locus_tag="ECL_00628"
                     /db_xref="GeneID:9123137"
     CDS             complement(624509..624979)
                     /locus_tag="ECL_00628"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611143.1"
                     /db_xref="GeneID:9123137"
                     /translation="MNKKTHIVSLFILIIAAFIFGRSTYTEYLAWYYGSNNLIFSEVN
                     SALLSSLCNGFFFVLSACIIYASLTLLKRIPRNIVVSCLLQFCINIGLYTLFVAVERG
                     YSKLHTLGPGATDITYGYFLGALLTSTLLTVAIVSVIHAKFLSSKHKDGLHKGV"
     gene            complement(624976..625560)
                     /locus_tag="ECL_00629"
                     /db_xref="GeneID:9123138"
     CDS             complement(624976..625560)
                     /locus_tag="ECL_00629"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611144.1"
                     /db_xref="GeneID:9123138"
                     /translation="MSSINIDVARPTGIYFIIERLYSRDGLMPSFGEISPSLTQVHRT
                     VIQLKRKQDMFMDGVKVIPKDITLWQQIKYITGSKVTTKDTDTLVYTTDFIGSLVATT
                     PLGNIELENIPRFLTTESIHSLPQAVSYGRDPIPQVLLYGRKDIVFFMDNGGKGTPTA
                     IAKYNHNTRDLAIIKDQLEASKTMKELLSKGAKL"
     gene            complement(625779..626309)
                     /locus_tag="ECL_00630"
                     /db_xref="GeneID:9123139"
     CDS             complement(625779..626309)
                     /locus_tag="ECL_00630"
                     /codon_start=1
                     /transl_table=11
                     /product="inorganic pyrophosphatase"
                     /protein_id="YP_003611145.1"
                     /db_xref="GeneID:9123139"
                     /translation="MSLLNVPAGKELPEDIYVVIEIPANADPIKYEVDKESGALFVDR
                     FMSTAMFYPCNYGYINHTLSLDGDPVDVLVPTPYPLQPGAVIRCRPVGVLKMTDESGE
                     DAKLVAVPHTKLSKEYDHIKDVNDLPELLKAQITHFFEHYKDLEKGKWVKVDGWDNAE
                     AAKAEIIASFERAAKK"
     misc_feature    complement(625782..626309)
                     /locus_tag="ECL_00630"
                     /note="inorganic pyrophosphatase; Provisional; Region:
                     PRK01250"
                     /db_xref="CDD:179262"
     misc_feature    complement(order(626073..626078,626235..626240))
                     /locus_tag="ECL_00630"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238239"
     misc_feature    complement(order(625881..625886,626142..626144,
                     626178..626180,626220..626222))
                     /locus_tag="ECL_00630"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238239"
     misc_feature    complement(order(626001..626003,626016..626018,
                     626097..626099,626112..626114,626214..626216))
                     /locus_tag="ECL_00630"
                     /note="metal binding sites [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238239"
     gene            626670..627575
                     /locus_tag="ECL_00631"
                     /db_xref="GeneID:9123140"
     CDS             626670..627575
                     /locus_tag="ECL_00631"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="YP_003611146.1"
                     /db_xref="GeneID:9123140"
                     /translation="MAMAAPLTVGFSQVGSESGWRAAETNVAKSEAQKRGITLKIADG
                     QQKQENQIKAVRSFIAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDK
                     SLYMTTVTANNVLEGQLIGDWLVKQVDGKPCNVVELQGTVGASVAIDRKKGFAEAISK
                     APNIKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAG
                     LKPGKDILTGSIDGVPDIYKAMIDGEANASVELTPNMAGPAFDALEKFKKDGTMPEKV
                     TVTKSTLYLPDTAKEELEKKKNMGY"
     misc_feature    626673..627560
                     /locus_tag="ECL_00631"
                     /note="ABC-type sugar transport system, periplasmic
                     component, contains N-terminal xre family HTH domain
                     [Carbohydrate transport and metabolism]; Region: RbsB;
                     COG1879"
                     /db_xref="CDD:224791"
     misc_feature    626691..627521
                     /locus_tag="ECL_00631"
                     /note="Periplasmic binding domain of ABC-type YtfQ-like
                     transport systems; Region: PBP1_YtfQ_like; cd06309"
                     /db_xref="CDD:107304"
     misc_feature    order(626727..626729,626949..626951,627117..627119,
                     627360..627362,627420..627422)
                     /locus_tag="ECL_00631"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107304"
     gene            627682..629184
                     /locus_tag="ECL_00632"
                     /db_xref="GeneID:9123141"
     CDS             627682..629184
                     /locus_tag="ECL_00632"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="YP_003611147.1"
                     /db_xref="GeneID:9123141"
                     /translation="MTTEQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGEN
                     GAGKSTLIKALTGVYHADRGTIWLEGNAISPKNTAHAQQLGIGTVYQEVNLLPNMSVA
                     DNLFIGREPRRFGLLRRKEMEARATKLMASYGFSLDVREPLNRFSVAMQQIVAICRAI
                     DLSAKVLILDEPTASLDTQEVEMLFTLMRQLRNQGVSLIFVTHFLDQVYEVSDRITVL
                     RNGSFVGCRETRELPQIELVKMMLGRELESNALQRAGRTLLSEKPVAAFSDFGKKGVI
                     SPFNLEVRPGEIVGLAGLLGSGRTETAEVIFGIKPADSGTAQIKGKPQTLRSPHQASC
                     LGVGFCPEDRKTDGIIAAASVRENIILALQAQRGWLRPIPRKEQNAIAERFIRQLGIR
                     TPSAEQPIEFLSGGNQQKVLLSRWLLTKPQFLILDEPTRGIDVGAHAEIIRLIETLCA
                     DGLALLVISSELEELVGYADRVIIMRDRKQVAEIPLDKLSVPAIMNAIAA"
     misc_feature    627685..629181
                     /locus_tag="ECL_00632"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     gene            629282..630220
                     /locus_tag="ECL_00633"
                     /db_xref="GeneID:9123142"
     CDS             629282..630220
                     /locus_tag="ECL_00633"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="YP_003611148.1"
                     /db_xref="GeneID:9123142"
                     /translation="MVLLVDSLVAPHFFQIIVQDGRLFGSPIDILNRAAPVALLAIGM
                     TLVIATGGIDLSVGAVMAIAGATAASMTVAGHSLPVVLLAALGTGVLAGLWNGILVAV
                     LKIQPFVATLILMVAGRGVAQLITSGQIVTFNSPNLAWLGSGKLLFFPTPVIIALVTL
                     VVFWIFTRKTALGMFIEAVGINIRAARNAGVNTRLMVMLTYVLSGVCAAIAGVIVAAD
                     IRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLLLSVIGALIIQGMNTGILLSGFQ
                     PELNQVVKAVVVLCVLIVQSPRFVSIIKGIRGHDKT"
     misc_feature    629318..630124
                     /locus_tag="ECL_00633"
                     /note="Ribose/xylose/arabinose/galactoside ABC-type
                     transport system, permease component [Carbohydrate
                     transport and metabolism]; Region: AraH; COG1172"
                     /db_xref="CDD:224093"
     misc_feature    629831..629887
                     /locus_tag="ECL_00633"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            630201..631208
                     /locus_tag="ECL_00634"
                     /db_xref="GeneID:9123143"
     CDS             630201..631208
                     /locus_tag="ECL_00634"
                     /codon_start=1
                     /transl_table=11
                     /product="inner membrane ABC transporter permease"
                     /protein_id="YP_003611149.1"
                     /db_xref="GeneID:9123143"
                     /translation="MAMIKRNLPLMITLGVFVLGYLYCLTQFPGFASTRVICNILTDN
                     AFLGIIAVGMTFVILSGGIDLSVGSVIAFTGVFLAKAIGFWGISPLVAFPLVLVMGCA
                     FGAFMGLLIDALKIPAFIITLAGMFFLRGVSYLVSEESIPINHPVYDTLSSLAWKIPG
                     GGRLSAMGLLMLGVVVIGIFLAHRTRFGNQVYAIGGNATSANLMGISTRSTTIRIYML
                     STGLATLAGIVFSIYTQAGYALAGVGVELDAIASVVIGGTLLSGGVGTVLGTLFGVAI
                     QGLIQTYINFDGTLSSWWTKIAIGILLFIFIALQRGLTVLWENRQSSPVTRVNTSVTE
                     R"
     misc_feature    630207..631157
                     /locus_tag="ECL_00634"
                     /note="inner membrane ABC transporter permease protein
                     YjfF; Provisional; Region: PRK11618"
                     /db_xref="CDD:183235"
     gene            631302..632873
                     /locus_tag="ECL_00635"
                     /db_xref="GeneID:9123144"
     CDS             631302..632873
                     /locus_tag="ECL_00635"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_003611150.1"
                     /db_xref="GeneID:9123144"
                     /translation="MLKTLSIRTGLLSLLAVMTLLLLIVSGIGIYALTQSSSSLQRIN
                     HLQGEQMVQLNSGYTLILRARNEAGQAVRMMEIGLLDDAAKSVKSINQEIALAQKTLK
                     GVIDAGVADPQGQQLLDKVAASLAAYNQQGINPMLKALNEQSADSYYDLLESKLIPVA
                     KQFDNDMQAFQMWSDARGKAEVSAVQSSKTRVLVLIVVAALLTAGIIVLAWLVLRHML
                     LKPLSASIAQLENVAAGDLTHTLNAPASQEFNRLNAAIEGMRQSLMHSVLRVRDASSQ
                     IDTGSRELTAGNRDLAERTESTATSLEQTAASMEEITATVKLNADNAEQAHQLAKSVS
                     DTADHGSEMVCYVIEKMRDISGSSARIADILSVIDGIAFQTNILALNASVEAARAGEQ
                     GRGFAVVAGEVRNLASRSADAAKEIRSLISDSQTHVNEGSELAQQAGETMDEIATEVL
                     RMTKLMREIATASQEQSRGIEQVNIAVNQMDETAQQNAALVQQSSAATRSLEEQSRQL
                     MEAMSSFKLTTQSVA"
     misc_feature    631377..631856
                     /locus_tag="ECL_00635"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:320779"
     misc_feature    order(631434..631436,631443..631445,631473..631478,
                     631485..631490,631494..631499,631506..631511,
                     631518..631523,631527..631532,631752..631757,
                     631761..631763,631767..631772,631779..631781)
                     /locus_tag="ECL_00635"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206638"
     misc_feature    order(631494..631496,631509..631511,631521..631523,
                     631752..631757,631761..631763,631767..631769)
                     /locus_tag="ECL_00635"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:206638"
     misc_feature    <631893..632870
                     /locus_tag="ECL_00635"
                     /note="Methyl-accepting chemotaxis protein (MCP)
                     signalling domain; Region: MCPsignal; cl28165"
                     /db_xref="CDD:332985"
     gene            complement(632841..633203)
                     /locus_tag="ECL_00636"
                     /db_xref="GeneID:9123145"
     CDS             complement(632841..633203)
                     /locus_tag="ECL_00636"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="YP_003611151.1"
                     /db_xref="GeneID:9123145"
                     /translation="MTKNYSRANTGIDLNLIPVFIEVVRCGSMAKASVRLEMSRPAVS
                     LALKRFSQLFAEPLFIRKGLYLEPTEKALTLTHHLEILLGNIHDNISAINLSENNTLV
                     QNVQGRGILCDTLRRQFK"
     misc_feature    complement(<632940..633170)
                     /locus_tag="ECL_00636"
                     /note="DNA-binding transcriptional regulator, LysR family
                     [Transcription]; Region: LysR; COG0583"
                     /db_xref="CDD:223656"
     gene            complement(633349..634347)
                     /locus_tag="ECL_00637"
                     /db_xref="GeneID:9123146"
     CDS             complement(633349..634347)
                     /locus_tag="ECL_00637"
                     /codon_start=1
                     /transl_table=11
                     /product="fructose-1,6-bisphosphatase"
                     /protein_id="YP_003611152.1"
                     /db_xref="GeneID:9123146"
                     /translation="MKTLGEFIVEKQHEFSHATGELTALLSAIKLGAKIIHRDINKAG
                     LVDILGASGAENVQGEVQQKLDLFANEKLKAALRARDIVAGIASEEEDEIVVFEGCEH
                     AKYVVLMDPLDGSSNIDVNVSVGTIFSIYRRVTPVGTPVTEEDFLQPGSQQVAAGYVV
                     YGSSTMLVYTTGCGVHAFTYDPSLGVFCLCQERMRFPEKGNTYSINEGNYIKFPTGVK
                     KYIKFCQEEDKATQRPYTSRYIGSLVADFHRNLLKGGIYLYPSTASHPDGKLRLLYEC
                     NPMAFLAEQAGGKASDGKERILDIVPESLHQRRSFFVGNNHMVEDVERFIREYPDA"
     misc_feature    complement(633358..634347)
                     /locus_tag="ECL_00637"
                     /note="fructose-1,6-bisphosphatase; Provisional; Region:
                     PRK09293"
                     /db_xref="CDD:236458"
     misc_feature    complement(order(633952..633954,634033..634038,
                     634279..634287,634291..634293,634315..634317,
                     634324..634326))
                     /locus_tag="ECL_00637"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:238214"
     misc_feature    complement(order(633523..633525,634012..634014,
                     634018..634020,634078..634083,634150..634152))
                     /locus_tag="ECL_00637"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238214"
     misc_feature    complement(order(633541..633543,633571..633573,
                     633619..633621,633631..633636,633721..633723,
                     634000..634005,634009..634011))
                     /locus_tag="ECL_00637"
                     /note="active site"
                     /db_xref="CDD:238214"
     gene            634545..635918
                     /locus_tag="ECL_00638"
                     /db_xref="GeneID:9123147"
     CDS             634545..635918
                     /locus_tag="ECL_00638"
                     /codon_start=1
                     /transl_table=11
                     /product="putative ligase"
                     /protein_id="YP_003611153.1"
                     /db_xref="GeneID:9123147"
                     /translation="MRIHILGICGTFMGGLAMLARSLGHEVTGSDANVYPPMSTLLEK
                     QGISLIQGYDASQLDPAPDLVIIGNAMTRGNPCVEAVLERNIPFMSGPQWLHDFVLRD
                     RWVVAVAGTHGKTTTAGMATWILEACGYKPGFVIGGVPGNFDVSARLGESPFFVIEAD
                     EYDCAFFDKRSKFVHYCPRTLILNNLEFDHADIFDDLKAIQKQFHHLVRIVPGQGRII
                     LPENDINLKQTMAMGCWSEQELVGEQGHWQAKKLNVDASEWEVWLDGEKVGEVKWGLV
                     GEHNMHNGLMAIAAARHVGVQPADAANALGSFINARRRLELRGEAHGVTVYDDFAHHP
                     TAILATLAALRGKVGGTARILAVLEPRSNTMKMGICKDDLAPSLGRADEVFLLQPQHI
                     PWQVAEVADACIQPAHWSADVDALADMVVKAAQPGDHILVMSNGGFGGIHQKLLDGLA
                     KKAEAAE"
     misc_feature    634548..635894
                     /locus_tag="ECL_00638"
                     /note="UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-
                     meso-diaminopimelate ligase; Region: mpl; TIGR01081"
                     /db_xref="CDD:130153"
     gene            complement(636021..636572)
                     /locus_tag="ECL_00639"
                     /db_xref="GeneID:9123148"
     CDS             complement(636021..636572)
                     /locus_tag="ECL_00639"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611154.1"
                     /db_xref="GeneID:9123148"
                     /translation="MTKQPEDWLDDVPGDDIEDEDDEIIWVSKSEIKRDAEELKQLGA
                     EMVELGKNALDKIPLDQDLRDAIELAQKIKKEGRRRQLQLIGKMLRQRDVDPIRQALD
                     KLKNRHNQQVALFHKLEQIRDRLIEQGDDAVPEVLNLWPDADRQQLRSLIRNAKKEKE
                     GNKPPKSARLIFQYLRELSENEE"
     misc_feature    complement(636033..636542)
                     /locus_tag="ECL_00639"
                     /note="hypothetical protein; Provisional; Region:
                     PRK05255"
                     /db_xref="CDD:235377"
     gene            636680..638020
                     /locus_tag="ECL_00640"
                     /db_xref="GeneID:9123149"
     CDS             636680..638020
                     /locus_tag="ECL_00640"
                     /codon_start=1
                     /transl_table=11
                     /product="putative peptide maturation protein"
                     /protein_id="YP_003611155.1"
                     /db_xref="GeneID:9123149"
                     /translation="MKVTSQVEAQRKILEEAVSTALTLASGKSDGAEVAVSKTTGISV
                     STRYGEVENVEFNSDGALGITVYHQNRKGSASSTDLSPDAIARTVQAALDIARYTSPD
                     PYAGVADKDLLAFDAPDLDLFHPAEVTPDEAIELAARAEQASLQADKRITNTEGGSFN
                     SHYGIKVFGNSHGMLQGYCSTRHSLSSCVIAEENGDMERDYAYTIGRALGDLQSPEWV
                     GKACAERTLSRLSPRKLSTMKAPVIFANEVATGLFGHLVGAIAGGSVYRKSTFLLDSL
                     GKQILPEWLTIEEHPHLLKGLASTPFDSEGVRTERRDIVKDGILTQWLLTNYSARKLG
                     LKSTGHAGGIHNWRIAGQGLNFEQMLKEMGTGLVVTELMGQGVSGITGDYSRGAAGFW
                     VENGEIQYPVSEITIAGNLKDMWRNIVTVGNDIETRSNIQCGSVLLPEMKIAGQ"
     misc_feature    636680..638017
                     /locus_tag="ECL_00640"
                     /note="peptidase PmbA; Provisional; Region: PRK11040"
                     /db_xref="CDD:182922"
     gene            638061..638447
                     /locus_tag="ECL_00641"
                     /db_xref="GeneID:9123150"
     CDS             638061..638447
                     /locus_tag="ECL_00641"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome b562"
                     /protein_id="YP_003611156.1"
                     /db_xref="GeneID:9123150"
                     /translation="MRKHLLAIVAASTLVLGSSAFAADLEDNMDILSQNLKVVQKTDN
                     AAEMKSALTKMREAALDAQKATPPKLESKAADSAEMKDYRHGFDVLVGQIDGALKLAN
                     EGKVKEAQAAADQFVATRNTYHKKYR"
     misc_feature    638061..638444
                     /locus_tag="ECL_00641"
                     /note="Cytochrome b562; Region: Cytochrom_B562; cl01546"
                     /db_xref="CDD:321561"
     gene            639107..639427
                     /locus_tag="ECL_00642"
                     /db_xref="GeneID:9123151"
     CDS             639107..639427
                     /locus_tag="ECL_00642"
                     /codon_start=1
                     /transl_table=11
                     /product="PRD domain-containing protein"
                     /protein_id="YP_003611157.1"
                     /db_xref="GeneID:9123151"
                     /translation="MNDVGDHAEQTEKLANTMLQQVYALLARHNIIPNAVQEQMLTSH
                     VRAMAHRSVTGEPLPEVEAELFDEISPDSMRLAREVVAHFGNLPDEEAWLLSVHFEVA
                     KDNL"
     misc_feature    639131..639421
                     /locus_tag="ECL_00642"
                     /note="PRD domain protein EF_0829/AHA_3910; Region:
                     EF_0829; TIGR03582"
                     /db_xref="CDD:132621"
     gene            639438..639800
                     /locus_tag="ECL_00643"
                     /db_xref="GeneID:9123152"
     CDS             639438..639800
                     /locus_tag="ECL_00643"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611158.1"
                     /db_xref="GeneID:9123152"
                     /translation="MEQITVVIGDRLGKGQKVAAGVEKAGGRAVVVPGMAADMKLGDV
                     MKAENATFGISFCGSGGAGAITAQTKYGYKAKYGMRSVDEGVTAINEGCNVLGFGFMD
                     KEELGERLVQAWQKKHGA"
     misc_feature    639447..639791
                     /locus_tag="ECL_00643"
                     /note="conserved hypothetical protein EF_0830/AHA_3911;
                     Region: EF_0830; TIGR03577"
                     /db_xref="CDD:132616"
     gene            639803..640102
                     /locus_tag="ECL_00644"
                     /db_xref="GeneID:9123153"
     CDS             639803..640102
                     /locus_tag="ECL_00644"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cytoplasmic protein"
                     /protein_id="YP_003611159.1"
                     /db_xref="GeneID:9123153"
                     /translation="MKEQFTTTVRVKGKGDAKARAFADALNHVQAAVMKASPHILLRI
                     EPQDVQVVQAQEAVRKEAFLFFFLRRERRTYSVELDVTVNVTAINLDQVDFVTQR"
     misc_feature    639806..640093
                     /locus_tag="ECL_00644"
                     /note="Domain of unknown function (DUF4312); Region:
                     DUF4312; cl11917"
                     /db_xref="CDD:325138"
     gene            640125..640901
                     /locus_tag="ECL_00645"
                     /db_xref="GeneID:9123154"
     CDS             640125..640901
                     /locus_tag="ECL_00645"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611160.1"
                     /db_xref="GeneID:9123154"
                     /translation="MFLIILIKSLIIGGLVGVGVGAGAARMFHAPTTQGMGAFRTLGE
                     LNSCEGDPASHFSFGLGFFFNAWASSVAAGAFTQDVDHRIIPNWGAAALMIKNRNVGE
                     TLHDPRKMAIACGIIGMIVVTFLNLTASSVPAALQVTAVKVLVPAANLLVNTVMPVIF
                     WLAAIDAGKKSGFWATIFGGAAQLIMGNAVPGLVLGILIGKGVEESGWNHVTKVMMAA
                     IVLLFVLSGFFRGFDMKMIESFHLTVPNWLDMIHNSLSGK"
     misc_feature    640200..640898
                     /locus_tag="ECL_00645"
                     /note="conserved hypothetical protein EF_0832/AHA_3913;
                     Region: EF_0832; TIGR03580"
                     /db_xref="CDD:274659"
     gene            640915..641556
                     /locus_tag="ECL_00646"
                     /db_xref="GeneID:9123155"
     CDS             640915..641556
                     /locus_tag="ECL_00646"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611161.1"
                     /db_xref="GeneID:9123155"
                     /translation="MEQNKGFWYADWSFPIFVGLLSSGVFAGTHMYYLYGIGAFNEVA
                     FVAMLKAGIDTGVYGAVAAFGASFLFARIIEGSLVGILDIGGAIQTGVGLGVPALLLG
                     AGIMFPVTNFIASLITGLVIGLAIGYVIILARKFTINQSNSTYGADVMMGAGNASGRF
                     LGPLIILSAMTASIPIGVGSLLGALLFYIWQKPITGGAILGAMILGWLFPVAL"
     misc_feature    640921..641544
                     /locus_tag="ECL_00646"
                     /note="Domain of unknown function (DUF4310); Region:
                     DUF4310; pfam14187"
                     /db_xref="CDD:290890"
     gene            641599..642732
                     /locus_tag="ECL_00647"
                     /db_xref="GeneID:9123156"
     CDS             641599..642732
                     /locus_tag="ECL_00647"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroorotase"
                     /protein_id="YP_003611162.1"
                     /db_xref="GeneID:9123156"
                     /translation="MFDLLLRRARLSDDTLTDIAILDGKIAATGDIDAPARKTVELNG
                     DVFVSAGWIDSHVHCYPNSPIYHDEPDSVGIATGVTTVVDAGSTGADDVDDFYEITRK
                     ASTEVFALLNISRVGLIAQNELANMANIDAEAVKQAVKRHPDFIVGLKARMSSSVVGE
                     NGITPLERAKAIQKENGDLPLMVHIGNNPPNLDEIAELLSSGDIITHCYNGKPNRILT
                     PSGELRASITSALKRGVRLDVGHGTASFSFEVAKRAIAMGILPHTISSDIYCRNRING
                     PVGSLSSVMSKFLAIGMSLPQVIDCVTANAADGLRLTRKGRIEPGLDADLTLFTLKRQ
                     PTVLTDAENDSLQAEHILVPLAAIRAGKGYMTEQGSTEHAFDL"
     misc_feature    641608..642729
                     /locus_tag="ECL_00647"
                     /note="dihydroorotase; Provisional; Region: PRK09237"
                     /db_xref="CDD:236423"
     misc_feature    order(641764..641766,641770..641772,642148..642150,
                     642217..642219,642397..642399)
                     /locus_tag="ECL_00647"
                     /note="active site"
                     /db_xref="CDD:238632"
     gene            642716..643834
                     /locus_tag="ECL_00648"
                     /db_xref="GeneID:9123157"
     CDS             642716..643834
                     /locus_tag="ECL_00648"
                     /codon_start=1
                     /transl_table=11
                     /product="putative pyridoxal phosphate-dependent enzyme"
                     /protein_id="YP_003611163.1"
                     /db_xref="GeneID:9123157"
                     /translation="MPSIYEKYHLKQVINTSGRMTALGVSTPRPEVVQAAMDGMNHYF
                     EMKDLVNKTGEYIAKLLDVEGATVVSCASAGIAQSVAAVLVKDSDWLLENLHVTPIEN
                     NEIVLPKGHNVNFGAPVGTMVALGGGKLVEAGYANECSADQLAAAITPRTAAILYIKS
                     HHCVQKSMLSVEQAAVVARKHDLPLIVDAAAEEDLHTYYRSGADLVIYSGAKAIEGPT
                     SGLVIGKTQYVEWVKRQTAGIGRAMKVGKEGILGLTCAIEHYLTATKESGAEMVAKMT
                     PFIDALNTLNGVTARVVWDSAGRDIARTEIKFDEAVTGIGTGELVNALKQGEYAIYFR
                     GYKANEGIIEADVRSVNADQLNIVYRRISEVLGQEKKA"
     misc_feature    642725..643813
                     /locus_tag="ECL_00648"
                     /note="uncharacterized pyridoxal phosphate-dependent
                     enzyme; Region: selA_rel; TIGR01437"
                     /db_xref="CDD:273623"
     gene            643831..644571
                     /locus_tag="ECL_00649"
                     /db_xref="GeneID:9123158"
     CDS             643831..644571
                     /locus_tag="ECL_00649"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611164.1"
                     /db_xref="GeneID:9123158"
                     /translation="MKLTPNFYRDRVCLNVLAGSKANASAIYEAAEGHVLVGVLSKNY
                     PDVPSAVADMREYAALIDNALSVGLGAGDPNQSAMVSEISRQVQPQHVNQVFTGVATS
                     RALLGQNDSVVNGLVSPTGTVGMVKISTGPLSSAAPDGIVPVETAIALLKDFGGSSVK
                     YFPMGGLKCRDEYLAVAEACARHDFWLEPTGGIDLENYEAILQIALDAGVSKIIPHIY
                     SSIIDKASGDTRPEDVRTLLAMTKKLVK"
     misc_feature    643852..644532
                     /locus_tag="ECL_00649"
                     /note="conserved hypothetical protein EF_0839/AHA_3917;
                     Region: EF_0839; TIGR03581"
                     /db_xref="CDD:188342"
     gene            644698..645834
                     /locus_tag="ECL_00650"
                     /db_xref="GeneID:9123159"
     CDS             644698..645834
                     /locus_tag="ECL_00650"
                     /codon_start=1
                     /transl_table=11
                     /product="putative cycloisomerase"
                     /protein_id="YP_003611165.1"
                     /db_xref="GeneID:9123159"
                     /translation="MHTRTLLVASLSLLANAAIAQPQYAWVGTYNPNGEGLYRFTVDP
                     NTGALGDKTLVSQLPNAAQLAVSHDGKTLYLASEVEQGVVQALRIDDNGELSELNQVS
                     SGGAGPVYLSLTPNGQHLLVANYVSGSIAVLPIKADGSLGDATDRHQDQGEPGAAKPE
                     AAAEGSFAISDHNGPHAHMIAADPSGKYVFSTDLGLDRIYQYRFDDRAGKLTPNDPPF
                     ISASSKGAGPRHFVFTPKGDALWLINEEASTLTHYTLDSNGRLKEGKTLSALPEGYKG
                     TSFAAGLALSADGKQLYVANRLHNSIGHFTVTAEGTLTHQDDVWTRGDYPRTLTLDKQ
                     GRWLYVMNQRSDNITRFRVGQDGKLSFESDYTPVGSPSQMVISP"
     misc_feature    644767..645813
                     /locus_tag="ECL_00650"
                     /note="Lactonase, 7-bladed beta-propeller; Region:
                     Lactonase; pfam10282"
                     /db_xref="CDD:313505"
     gene            645854..647763
                     /locus_tag="ECL_00651"
                     /note="BglB family transcriptional antiterminator"
                     /pseudo
                     /db_xref="GeneID:9123160"
     gene            647841..648083
                     /locus_tag="ECL_00653"
                     /db_xref="GeneID:9127632"
     CDS             647841..648083
                     /locus_tag="ECL_00653"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611166.1"
                     /db_xref="GeneID:9127632"
                     /translation="MATLNVRLDDKLKNEAYAVLEKLNITPTEAVRLLFQYVAETGRM
                     PVKTVTISDSEDALIQTVRERLANPQKGIKVSLDDL"
     misc_feature    647841..648080
                     /locus_tag="ECL_00653"
                     /note="bifunctional antitoxin/transcriptional repressor
                     RelB; Provisional; Region: PRK11235"
                     /db_xref="CDD:183047"
     gene            648073..648357
                     /locus_tag="ECL_00654"
                     /db_xref="GeneID:9123161"
     CDS             648073..648357
                     /locus_tag="ECL_00654"
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antitoxin"
                     /protein_id="YP_003611167.1"
                     /db_xref="GeneID:9123161"
                     /translation="MTYELEFDPRALKEWSKLGETVKKQFKKKLAGVLVNPRIESARL
                     HNLPDCYKIKLRSQGYRLVYQVQDNVVTVVVIAIGKREKLTVYHDANKRL"
     misc_feature    648073..648339
                     /locus_tag="ECL_00654"
                     /note="mRNA-degrading endonuclease RelE, toxin component
                     of the RelBE toxin-antitoxin system [Defense mechanisms];
                     Region: RelE; COG2026"
                     /db_xref="CDD:224937"
     gene            complement(648361..648825)
                     /locus_tag="ECL_00655"
                     /db_xref="GeneID:9123162"
     CDS             complement(648361..648825)
                     /locus_tag="ECL_00655"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside-triphosphate reductase
                     activating protein"
                     /protein_id="YP_003611168.1"
                     /db_xref="GeneID:9123162"
                     /translation="MRYHQYYPVDIVNGPGTRCTLFVSGCVHECPGCYNKSTWRLNSG
                     MPFTAEVEDRIINDLNDTRIKRQGISLSGGDPLHPQNVPEILKLVKRIRRECAGKDIW
                     VWTGYKLDELNAQQREVVDLINVLVDGKFVQDLKDPALIWRGSSNQVVHHLR"
     misc_feature    complement(648364..648825)
                     /locus_tag="ECL_00655"
                     /note="anaerobic ribonucleotide reductase-activating
                     protein; Provisional; Region: nrdG; PRK11121"
                     /db_xref="CDD:236853"
     misc_feature    complement(order(648448..648450,648511..648519,
                     648601..648606,648610..648612,648724..648732,
                     648736..648738,648742..648744,648748..648750))
                     /locus_tag="ECL_00655"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(648948..651086)
                     /locus_tag="ECL_00656"
                     /db_xref="GeneID:9123163"
     CDS             complement(648948..651086)
                     /locus_tag="ECL_00656"
                     /codon_start=1
                     /transl_table=11
                     /product="anaerobic ribonucleoside triphosphate reductase"
                     /protein_id="YP_003611169.1"
                     /db_xref="GeneID:9123163"
                     /translation="MTPHVMKRDGCKVPFKSERIQEAILRAAKAAGVDDADYCATVAD
                     VVSRQMNERSQVDISEIQTAVENQLMSGPYKQLARAYIEYRHDRDVQREKRGRLNQEI
                     RGLVEQTNSALLNENANKDSKVIPTQRDLLAGIVAKHYARQHLLPRDVVSAHERGEIH
                     YHDLDYSPFFPMFNCMLIDLKGMLTHGFKMGNAEIEPPKSISTATAVTAQIIAQVASH
                     IYGGTTINRIDEVLAPFVTASFKKHRKTAEEWQIPDADGYAHSRTEKECYDAFQSLEY
                     EVNTLHTANGQTPFVTFGFGLGTSWESRLIQQSILRNRISGLGKNRKTAVFPKLVFAI
                     RDGLNHKFGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKTPMGCRSFLGVYE
                     DENGEQVHDGRNNLGVISLNLPRIALEAKGNEDAFWALLDERLQLARKALMTRIARLE
                     GVKARVAPILYMEGACGVRLKADDDVSEIFKNGRASISLGYIGIHETINALFGNTHMY
                     DSDALREKGIAIVQRLRDAVDQWKEETGYGFSLYSTPSENLCDRFCRLDTAEFGIVEG
                     VTDKGYYTNSFHLDVEKKVNPYDKIDFEAAYPPIASGGFICYGEYPNIQHNLKALEDV
                     WDYSYQHVPYYGTNTPIDECYECGFTGEFECTSKGFTCPKCGNHDAARVSVTRRVCGY
                     LGSPDARPFNAGKQEEVKRRVKHLGNGQIG"
     misc_feature    complement(648954..651086)
                     /locus_tag="ECL_00656"
                     /note="anaerobic ribonucleoside triphosphate reductase;
                     Provisional; Region: PRK09263"
                     /db_xref="CDD:236436"
     gene            complement(651460..653103)
                     /locus_tag="ECL_00657"
                     /db_xref="GeneID:9123164"
     CDS             complement(651460..653103)
                     /locus_tag="ECL_00657"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose-6-phosphate hydrolase"
                     /protein_id="YP_003611170.1"
                     /db_xref="GeneID:9123164"
                     /translation="MNTLPHWWQNGVIYQIYPKSFQDTTGSGTGDLRGVTQRLDYLKT
                     LGIDAIWLTPFYISPQVDNGYDVANYTAIDPAYGTLDDFDELVAQAHERGIRIVLDMV
                     FNHTSTQHAWFRESLNKASPYRQFYIWRDGTPEQLPNNWRSKFGGNAWRWHAESEQYY
                     LHLFAPEQADLNWENPAVRAELKKVCEFWADRGVDGLRLDVINLISKDQAFPNDDIGD
                     GRRFYTDGPRIHEYLQEMSRDVFTPRNLMTVGEMSSTSLENCQQYASLDGRELSMTFN
                     FHHLKVDYPGGEKWTLAKPDFVALKTLFNHWQQGMHNKAWNALFWCNHDQPRIVSRFG
                     DEGEYRVPAAKMLGMVLHGMQGTPYIYQGEELGMTNPHFSRITDYRDVESLNMFAELR
                     ANGRDPNELLAILASKSRDNGRTPMQWDASHNAGFTEGEPWIGVCDNYETVNARAALD
                     DPDSVFYTYQSLIRLRKTLPVLTWGDYQDLQPEHPSLWCYRRQWQGKTLVVVANLSHQ
                     SHEWESDVLSGEWQAVMSNYPAPHTATLRPFEAVWWLQA"
     misc_feature    complement(651466..653103)
                     /locus_tag="ECL_00657"
                     /note="trehalose-6-phosphate hydrolase; Provisional;
                     Region: PRK10933"
                     /db_xref="CDD:182849"
     gene            complement(653155..654576)
                     /locus_tag="ECL_00658"
                     /db_xref="GeneID:9123165"
     CDS             complement(653155..654576)
                     /locus_tag="ECL_00658"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose(maltose)-specific PTS system
                     components IIBC"
                     /protein_id="YP_003611171.1"
                     /db_xref="GeneID:9123165"
                     /translation="MMSKVKQADIDQLIVLVGGRENIATVSHCITRLRFVLNDPAKAN
                     PKAIEALSMVKGCFTNAGQFQVVIGTEVGDYYQALLATTGHNAADKEQAKKAARQNMK
                     WHEQLISHFAEIFFPLLPALISGGLILGFRNVIGDVPMSDGKTLAQMYPALKTIYDFL
                     WLIGEAIFFYLPVGICWSAVRKMGGTPILGIVLGVTLVSPQLMNAYLLGQQAPEVWNF
                     GLFTIAKVGYQAQVIPALLAGLALGFIETRLKRIVPDYLYLVVVPVCSLILAVFLAHA
                     FIGPFGRMIGDGVAFAVRHLMTGSFAPIGAALFGFLYAPLVITGVHQTTLAIDMQMIQ
                     SLGGTPVWPIIALSNIAQASAVTGIILVSRKHNEREISVPAAISAYLGVTEPAMYGIN
                     LKYRFPMLCAMIGSGLAGLVCGLNGVMANGIGVGGLPGILSIQPAFWQVFALAMAIAI
                     IVPMALTTVVYQRKFRQGALQIV"
     misc_feature    complement(653158..654576)
                     /locus_tag="ECL_00658"
                     /note="PTS system trehalose(maltose)-specific transporter
                     subunits IIBC; Provisional; Region: PRK11007"
                     /db_xref="CDD:182896"
     misc_feature    complement(654475..654495)
                     /locus_tag="ECL_00658"
                     /note="active site turn [active]"
                     /db_xref="CDD:238130"
     misc_feature    complement(654490..654492)
                     /locus_tag="ECL_00658"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238130"
     gene            complement(654701..655648)
                     /locus_tag="ECL_00659"
                     /db_xref="GeneID:9123166"
     CDS             complement(654701..655648)
                     /locus_tag="ECL_00659"
                     /codon_start=1
                     /transl_table=11
                     /product="trehalose repressor"
                     /protein_id="YP_003611172.1"
                     /db_xref="GeneID:9123166"
                     /translation="MQNRLTIKDIARLSGVGKSTVSRVLNNESGVSERTRERVEAVMN
                     QHGFSPSRSARAMRGQSDKVVAIIVSRLDSLSENLAVQTMLPAFYEQGYDPIMMESQF
                     SPQLVEEHLGMLARRNIDGVVLFGFTGIKEEMLKPWQPSLVLLARDAHGFASVCYDDE
                     GAIITLMQRLYEKGHRHISYLGVPHADVTTGKRRHEAYLAFCKKHNLSAVASLPGLGM
                     KQGYEQVASVLTPQTTALVCATDTLALGASKYLQEQRIDDLQVASVGSTPLMKFLHPE
                     IITVDPGYAESGRQAAAQLIEQINGRAEPRQIVIPVHLS"
     misc_feature    complement(654704..655648)
                     /locus_tag="ECL_00659"
                     /note="trehalose repressor; Provisional; Region: treR;
                     PRK09492"
                     /db_xref="CDD:181905"
     gene            656034..658748
                     /locus_tag="ECL_00660"
                     /db_xref="GeneID:9123167"
     CDS             656034..658748
                     /locus_tag="ECL_00660"
                     /codon_start=1
                     /transl_table=11
                     /product="magnesium-transporting ATPase MgtA"
                     /protein_id="YP_003611173.1"
                     /db_xref="GeneID:9123167"
                     /translation="MTMFKNITRQLQALLSRHLPHRLVQRDPLPNGKNFSGATIPASL
                     TERCLNVAAMDENEVWRAFNGHPEGLNAAEVQKIRAVHGDNLIPAQKPAPWWVHLWIC
                     YRNPFNLLLTVLGIISYATEDLFAAGVIALMVGISTLLNFIQEARSTKAADALKAMVS
                     NTATVSRVINDLGENAWVELPIDQLVPGDLVKLAAGDMIPADLRIIQARDLFVAQASL
                     TGESLPVEKVARSRDPQQMNPLECDTLCFMGTTVVSGTAQAIVIATGGNTWFGQLAGR
                     VTEQESEPNAFQKGIGRVSMLLIRFMMVMTPIVLLINGYTKGDWWEAALFALSVAVGL
                     TPEMLPMIVTSTLARGAVKLSKQKVIVKHLDAIQNFGAMDILCTDKTGTLTQDKIVLE
                     NHTDIAGKTSERVLHSAWLNSHYQTGLKNLLDVAVLEGVDEESARSLSGRWQKVDEIP
                     FDFERRRMSVVVSEQPDVHQLICKGALQEILNVSTQVHYNGDIVPLDDTMLRRIKRVT
                     DNLNRQGLRVVAVASKFLPAREGDYQRIDESDLILEGYIAFLDPPKETTAPALKALKA
                     SGITVKILTGDSELVAAKVCHEVGLDAGDVVVGSDIEHLSDDELAQLARHTTLFARLT
                     PMHKERIVTLLRREGHVVGFMGDGINDAPALRAADIGISVDGAVDIAREAADIILLEK
                     SLMVLEEGVIEGRRTFANMLKYIKMTASSNFGNVFSVLVASAFLPFLPMLPLHLLIQN
                     LMYDVSQVAIPFDNVDDEQIQKAQRWNPADLGRFMLFFGPISSIFDILTFCLMWFVFH
                     ANTPEHQTLFQSGWFVVGLLSQTLIVHMIRTRRIPFIQSRAAWPLIVMTGIVMALGIA
                     LPFSPLASYLQLQALPLSYFPWLVAILAGYMVLTQMVKGFYARRYGWQ"
     misc_feature    656040..658745
                     /locus_tag="ECL_00660"
                     /note="magnesium-transporting ATPase MgtA; Provisional;
                     Region: PRK10517"
                     /db_xref="CDD:236705"
     gene            658926..661310
                     /locus_tag="ECL_00661"
                     /db_xref="GeneID:9123168"
     CDS             658926..661310
                     /locus_tag="ECL_00661"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-N-acetylhexosaminidase"
                     /protein_id="YP_003611174.1"
                     /db_xref="GeneID:9123168"
                     /translation="MLRYSLLTAGLLLGASAFAAPAGDLPLMPWPAKVERPTTQGALV
                     LNNQLSVSVSGDDLGDAVNRLRQRIALQTGWTLQPQADKPEKPTIRIAIAKKVKPQPL
                     PDSDESYKLTVDANGVDISANTRFGALRAIETLLQLVQNGAENTSVPWVTIEDSPRFP
                     WRGLLLDSARHFIPLADIKRQLDGMAAAKLNVLHWHLTDDQGWRFSSKRYPKLTQLAS
                     DGLFYTPEQMREIVRYAADRAIRVVPEIDMPGHASAIAVAYPALMSAPGPYEMERHWG
                     VLKPVLDPTKEATYAFADAMVSELAAIFPDPYLHIGGDEVDDSQWKANPAIQQFMRDH
                     KLADSHALQAYFNRKLETILEKHHRQMVGWDEIYHPDLPKSILIQSWQGQDALGQVAQ
                     NGYKGILSTGFYLDQPQSTAYHYRNEIVPQALNGVDVIADTDSAQSWAFSMPRLKGKP
                     VEGSFTLVKGESGWRGFIDFAGKSRRAVDNIAWRDDNQVTFTVDTWMGETRPVVSVDN
                     DKLTGYFLVGNVRYPISGTRLDEVPKGTPPVVPDIAHQVNLLGGEAALWAENVVAPVL
                     DIRLWPRTFAVAERLWSAQDVTDVDNMYTRLQAMDSWSTVSVGLQQHTQQQVQFTRLA
                     GNADTLPLQILAQAVEPAQYYTRQHLKFQAGNYHQFEPLNRFADELNAESATVRQMNK
                     WADRLVSDAEDTESADALRHVFNRWQSNTSDALALSENSYQLKAIKPVIQEVDKLASI
                     GLRLTDLVARQGTLDDKEIASIQSELDNAAKVQDEVVIAAVYPLETLLRATRNQ"
     misc_feature    659004..659390
                     /locus_tag="ECL_00661"
                     /note="Glycosyl hydrolase family 20, domain 2; Region:
                     Glyco_hydro_20b; pfam02838"
                     /db_xref="CDD:308473"
     misc_feature    659400..660716
                     /locus_tag="ECL_00661"
                     /note="Beta-N-acetylhexosaminidases of glycosyl hydrolase
                     family 20 (GH20) catalyze the removal of beta-1,4-linked
                     N-acetyl-D-hexosamine residues from the non-reducing ends
                     of N-acetyl-beta-D-hexosaminides including
                     N-acetylglucosides and N-acetylgalactosides; Region:
                     GH20_hexosaminidase; cl02948"
                     /db_xref="CDD:322140"
     misc_feature    order(659433..659435,659676..659678,659865..659870,
                     660015..660017,660066..660068,660594..660596,
                     660600..660602)
                     /locus_tag="ECL_00661"
                     /note="active site"
                     /db_xref="CDD:119331"
     gene            complement(661400..662854)
                     /locus_tag="ECL_00662"
                     /db_xref="GeneID:9123169"
     CDS             complement(661400..662854)
                     /locus_tag="ECL_00662"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acetylglucosamine-binding protein A"
                     /protein_id="YP_003611175.1"
                     /db_xref="GeneID:9123169"
                     /translation="MKLSKIALAMATLTVASSALAHGYIESPASRAYMCKLGQNIDCG
                     SVQYEPQSVEKTSGFPGGAMPPDGQLASAGIANYSQLDKQSLNAWTKSPMTAGPHEFV
                     WYHTAPHKTTNWRYYITKQNWDPNKPLTRDQFELTPFCTVNGNGQAPAMRKAMTCNVP
                     ARTGYQVIYGVWEIADTSNSFYQAIDVDFGNGGNVTPDDGAGIESEWSKVLSGQIAGN
                     NLNVGDKVIARFFDAHGEVTSLRTEITIATAAQGDANQWSYDLAQKINTAHQDIRVGV
                     KDEGGDISPVHGANSVFVKEDSALQSVAISYEEQKAEVNETIAVSNLHYSKIENGNAT
                     VTFHVNTHGNVDFEAHVMNHHGAEKGYLKQEMNNANQDVTLTLTGVEAGHHMLKYYAT
                     NKDGTLFAQDVLNLMLEEEAAADNSTGQHDYIFPDNIASYKAGTVVLQPKDGKTYQCK
                     PFPYSGYCVQWSKYATQFEPGTGSHWKEAWVLKH"
     misc_feature    complement(661403..662854)
                     /locus_tag="ECL_00662"
                     /note="N-acetylglucosamine-binding protein A; Reviewed;
                     Region: PRK13211"
                     /db_xref="CDD:237309"
     gene            complement(662986..663372)
                     /locus_tag="ECL_00663"
                     /db_xref="GeneID:9123170"
     CDS             complement(662986..663372)
                     /locus_tag="ECL_00663"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611176.1"
                     /db_xref="GeneID:9123170"
                     /translation="MTKVLATENAPAAIGPYVQGVDLGSMIITSGQIPVNPKTGEVPA
                     DVAAQARQSLENVQAIVESAGLKVGDIVKTTVFVKDLNDFATVNATYEAFFTEHNASF
                     PARSCVEVARLPKDVKIEIEAIAVRR"
     misc_feature    complement(662992..663372)
                     /locus_tag="ECL_00663"
                     /note="YjgF, YER057c, and UK114 belong to a large family
                     of proteins present in bacteria, archaea, and eukaryotes
                     with no definitive function. The conserved domain is
                     similar in structure to chorismate mutase but there is no
                     sequence similarity and no...; Region:
                     YjgF_YER057c_UK114_family; cl10015"
                     /db_xref="CDD:299145"
     misc_feature    complement(order(663001..663003,663007..663009,
                     663013..663015,663043..663066,663100..663102,
                     663109..663111,663142..663144,663148..663150,
                     663154..663159,663163..663165,663280..663285,
                     663289..663291,663295..663297,663304..663306,
                     663310..663312,663319..663324))
                     /locus_tag="ECL_00663"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100004"
     misc_feature    complement(order(663013..663015,663058..663060,
                     663109..663111,663121..663123,663322..663324))
                     /locus_tag="ECL_00663"
                     /note="putative active site [active]"
                     /db_xref="CDD:100004"
     gene            complement(663447..663908)
                     /locus_tag="ECL_00664"
                     /db_xref="GeneID:9123171"
     CDS             complement(663447..663908)
                     /locus_tag="ECL_00664"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase regulatory
                     subunit"
                     /protein_id="YP_003611177.1"
                     /db_xref="GeneID:9123171"
                     /translation="MTHDNKLQVEAIKRGTVIDHIPAQVGFKLLTLFKLTETDQRITI
                     GLNLPSGEMGRKDLIKIENTFLTDEQVNQLSLYAPDATVNRIDNYDVVGKSRPSLPER
                     IESVLVCPNSNCISHAEPVSSSFAVKKRADDIALKCKYCEKEFSHYVVLAN"
     misc_feature    complement(663450..663905)
                     /locus_tag="ECL_00664"
                     /note="aspartate carbamoyltransferase regulatory subunit;
                     Reviewed; Region: PRK00893"
                     /db_xref="CDD:234859"
     gene            complement(663921..664853)
                     /locus_tag="ECL_00665"
                     /db_xref="GeneID:9123172"
     CDS             complement(663921..664853)
                     /locus_tag="ECL_00665"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate carbamoyltransferase catalytic
                     subunit"
                     /protein_id="YP_003611178.1"
                     /db_xref="GeneID:9123172"
                     /translation="MNPLYQKHIISINDLSREELELVLETAAKLKANPQPELLKHKVI
                     ASCFFEASTRTRLSFETSMHRLGASVVGFSDSSNTSLGKKGETLADTISVISTYVDAI
                     VMRHPQEGAARLATEFSGGIPVLNAGDGANQHPTQTLLDLFTIQETQGRLENLNIAMV
                     GDLKYGRTVHSLTQALAKFNGNRFFFIAPDALAMPQYILDMLDEKSIPWSLHASIEEV
                     MGNVDILYMTRVQKERLDPSEYANVKAQFVLRASDLEGARDNMKVLHPLPRIDEITTD
                     VDKTPHAWYFQQAGNGIFARQALLALVLNRELAL"
     misc_feature    complement(663927..664853)
                     /locus_tag="ECL_00665"
                     /note="Aspartate carbamoyltransferase, catalytic chain
                     [Nucleotide transport and metabolism]; Region: PyrB;
                     COG0540"
                     /db_xref="CDD:223614"
     gene            664972..665106
                     /locus_tag="ECL_00666"
                     /db_xref="GeneID:9123173"
     CDS             664972..665106
                     /locus_tag="ECL_00666"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_003611179.1"
                     /db_xref="GeneID:9123173"
                     /translation="MSNTLDHASSRQIVGHYTHPDVRIKQFNARFTQCKRFFMNINAF
                     "
     gene            complement(665093..665572)
                     /locus_tag="ECL_00667"
                     /db_xref="GeneID:9123174"
     CDS             complement(665093..665572)
                     /locus_tag="ECL_00667"
                     /codon_start=1
                     /transl_table=11
                     /product="ArgR family transcriptional regulator"
                     /protein_id="YP_003611180.1"
                     /db_xref="GeneID:9123174"
                     /translation="MTEYGDYSPKEQLQLTVCQRLIAEKSYLSQEEIRRDLQERGFET
                     ISQSTVSRLLKLLGVIKIRNAKGLKIYSLNPLLRPAPDAARTVSEMVVSVEHNSEFIL
                     IHTVAGYGRAVARILDYHQLPEILGVVAGSSIVWVAPRVVKRTALVHKQINYLLRTH"
     misc_feature    complement(665105..665545)
                     /locus_tag="ECL_00667"
                     /note="Arginine repressor, DNA binding domain; Region:
                     Arg_repressor; cl27583"
                     /db_xref="CDD:332404"
     gene            complement(665648..667051)
                     /locus_tag="ECL_00668"
                     /db_xref="GeneID:9123175"
     CDS             complement(665648..667051)
                     /locus_tag="ECL_00668"
                     /codon_start=1
                     /transl_table=11
                     /product="C4-dicarboxylate anaerobic carrier"
                     /protein_id="YP_003611181.1"
                     /db_xref="GeneID:9123175"
                     /translation="MGKFKFPSAYTILFFLIAVVAVLTWIIPAGQYHMAMNEALGKDV
                     PVAGTYAHVAAHPQGLVSVLMAPIAGLYDPESGQAGAIDVALFILIIGGFLGIVTKTG
                     AIDAGIERVTTRLRGREEWMIPILMALFAAGGTIYGMAEESLPFYTLLVPVMLAARFD
                     PVVAASTVLLGAGIGTLGSTINPFATVIAANAAGIPFTNGIVLRVALLVIGWIICVAW
                     VMRYARKVRQDPSLSIVADKQEENRAHFLGNKDAQTLEFTPVRKIILVIFALAFAVMI
                     YGVAVLGWWMAEISAVFLASAIIVGLIARMSEEELTSTFINGARDLLGVALIIGIARG
                     IVVIMDKGMITHTILHSAEGLVSGLSTVAFINVMYWLEVVLSFLVPSSSGLAVLTMPI
                     MAPLADFANVNRDLVVTAYQSASGIVNLVTPTSAVVMGGLAIARVPYVRYLKWVAPLL
                     GILTVVIMVALSLGAVL"
     misc_feature    complement(665651..667051)
                     /locus_tag="ECL_00668"
                     /note="Uncharacterized membrane protein YfcC, ion
                     transporter superfamily [General function prediction
                     only]; Region: YfcC; COG1288"
                     /db_xref="CDD:224207"
     gene            complement(667099..668103)
                     /locus_tag="ECL_00669"
                     /db_xref="GeneID:9123176"
     CDS             complement(667099..668103)
                     /locus_tag="ECL_00669"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="YP_003611182.1"
                     /db_xref="GeneID:9123176"
                     /translation="MTINLKNRNFLKLLDYTPAEIQYLIDLAIELKAAKKAGREKQTL
                     VGKNIALIFEKTSTRTRCAFEVGAFDQGAQVTYLGPSGSQIGHKESMKDTARVLGRMY
                     DGIEYRGYGQAIVEELGEYAGVPVWNGLTDEFHPTQILADLMTMLEHSPGKTLPELSF
                     AYLGDARNNMGNSLMVGAAKMGMDIRLVAPKSFWPEAGLVEQCRAIAKETGARITLTD
                     DVEEGVQGADFLYTDVWVSMGEPKEAWAERVSLMKPYQINAQVMKATGNPNVKFMHCL
                     PAFHNEHTKVGREIEMAYGLKGLEVTEEVFESPNSIVFDEAENRMHTIKAVMVATLGD
                     "
     misc_feature    complement(667102..668103)
                     /locus_tag="ECL_00669"
                     /note="ornithine carbamoyltransferase; Validated; Region:
                     PRK02102"
                     /db_xref="CDD:179366"
     gene            complement(668196..669107)
                     /locus_tag="ECL_00670"
                     /db_xref="GeneID:9123177"
     CDS             complement(668196..669107)
                     /locus_tag="ECL_00670"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamate kinase"
                     /protein_id="YP_003611183.1"
                     /db_xref="GeneID:9123177"
                     /translation="MERKPTLVVALGGNALLKRGEPLEAEIQRKNIDLAARTIAGLTE
                     QWRVVLVHGNGPQVGLLALQNSAYDKVAPYPLDVLGAESQGMIGYMLQQALKNSLPQR
                     EVSVLLTQVEVDAADPAFSNPTKYIGPVYSEAQAKTLQAEKGWVFKADGSYFRRVVPS
                     PQPKRIVESDAIAALIQRDHLVICNGGGGVPVVENANGYHGIEAVIDKDLSAALLARQ
                     IEADALLILTDADAVYLDWGKPTQRPLAQVTPELLKGMAFDAGSMGPKVAACREFVEA
                     CNGIAGIGALADGAEILAGEKGTLIRN"
     misc_feature    complement(668199..669095)
                     /locus_tag="ECL_00670"
                     /note="carbamate kinase; Reviewed; Region: PRK12354"
                     /db_xref="CDD:183466"
     misc_feature    complement(order(668481..668489,668733..668735,
                     668943..668951,669069..669074,669078..669080))
                     /locus_tag="ECL_00670"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239768"
     misc_feature    complement(order(668310..668312,668319..668324,
                     668334..668336,668397..668399,668406..668408,
                     668421..668426,669069..669071))
                     /locus_tag="ECL_00670"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239768"
     misc_feature    complement(order(668310..668312,668319..668324,
                     668334..668336,668397..668399,668406..668408,
                     668421..668426,669069..669071))
                     /locus_tag="ECL_00670"
                     /note="nucle