GenomeNet

Database: RefSeq
Entry: NC_015437
LinkDB: NC_015437
Original site: NC_015437 
LOCUS       NC_015437            2568361 bp    DNA     circular CON 06-JUL-2013
DEFINITION  Selenomonas sputigena ATCC 35185 chromosome, complete genome.
ACCESSION   NC_015437
VERSION     NC_015437.1  GI:330837866
DBLINK      Project: 55329
            BioProject: PRJNA55329
KEYWORDS    GSC:MIGS:2.1; RefSeq.
SOURCE      Selenomonas sputigena ATCC 35185
  ORGANISM  Selenomonas sputigena ATCC 35185
            Bacteria; Firmicutes; Negativicutes; Selenomonadales;
            Veillonellaceae; Selenomonas.
REFERENCE   1  (bases 1 to 2568361)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Bruce,D., Goodwin,L.,
            Pitluck,S., Peters,L., Kyrpides,N., Mavromatis,K., Ivanova,N.,
            Ovchinnikova,G., Teshima,H., Detter,J.C., Tapia,R., Han,C.,
            Land,M., Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P.,
            Woyke,T., Wu,D., Gronow,S., Wellnitz,S., Schneider,S., Klenk,H.-P.
            and Eisen,J.A.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     The complete genome of Selenomonas sputigena DSM 20758
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 2568361)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-APR-2011) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 2568361)
  AUTHORS   Lucas,S., Copeland,A., Lapidus,A., Bruce,D., Goodwin,L.,
            Pitluck,S., Peters,L., Kyrpides,N., Mavromatis,K., Ivanova,N.,
            Ovchinnikova,G., Teshima,H., Detter,J.C., Tapia,R., Land,M.,
            Hauser,L., Markowitz,V., Cheng,J.-F., Hugenholtz,P., Woyke,T.,
            Wu,D., Gronow,S., Wellnitz,S., Schneider,S., Klenk,H.-P. and
            Eisen,J.A.
  CONSRTM   US DOE Joint Genome Institute (JGI-PGF)
  TITLE     Direct Submission
  JOURNAL   Submitted (06-APR-2011) US DOE Joint Genome Institute, 2800
            Mitchell Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to CP002637.
            URL -- http://www.jgi.doe.gov
            JGI Project ID: 4083024
            Source DNA and organism available from Hans-Peter Klenk at the
            German Collection of Microorganisms and Cell Cultures (DSMZ)
            (hans-peter.klenk@dsmz.de)
            Contacts: Jonathan A. Eisen (jaeisen@ucdavis.edu)
                      David Bruce (microbe@cuba.jgi-psf.org)
            Whole genome sequencing and draft assembly at JGI-PGF
            Finishing done by JGI-LANL
            Annotation by JGI-ORNL and JGI-PGF
            The JGI and collaborators endorse the principles for the
            distribution and use of large scale sequencing data adopted by the
            larger genome sequencing community and urge users of this data to
            follow them. It is our intention to publish the work of this
            project in a timely fashion and we welcome collaborative
            interaction on the project and analysis.
            (http://www.genome.gov/page.cfm?pageID=10506376).
            
            ##MIGS-Data-START##
            investigation_type  :: bacteria_archaea
            project_name        :: Selenomonas sputigena DSM 20758
            collection_date     :: Missing
            lat_lon             :: Missing
            depth               :: Missing
            alt_elev            :: Missing
            country             :: Missing
            environment         :: Gastrointestinal tract, Host, Respiratory
                                   tract
            num_replicons       :: 1
            ref_biomaterial     :: DSM 20758, ATCC 35185
            biotic_relationship :: Free living
            trophic_level       :: Missing
            rel_to_oxygen       :: Anaerobe
            isol_growth_condt   :: Missing
            sequencing_meth     :: WGS
            assembly            :: Newbler v. 2.3 (pre-release)
            finishing_strategy  :: Finished
            GOLD Stamp ID       :: Gi02256
            Type Strain         :: Yes
            Greengenes ID       :: 17310
            Funding Program     :: DOE-GEBA 2007
            Isolation Site      :: Subgingival sulcus
            Isolation Comments  :: isolated by W.E.C. Moore
            Host Name           :: Homo sapiens
            Cell Shape          :: Crescent-shaped
            Motility            :: Motile
            Temperature Range   :: Mesophile
            Temperature Optimum :: 37C
            Gram Staining       :: Gram+
            Diseases            :: Periodontitis, Septicemia
            Phenotypes          :: Pathogen
            ##MIGS-Data-END##
            
            ##Genome-Assembly-Data-START##
            Finishing Goal           :: Finished
            Current Finishing Status :: Finished
            Assembly Method          :: Newbler v. 2.3
            Genome Coverage          :: 30x
            Sequencing Technology    :: 454/Illumina
            ##Genome-Assembly-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..2568361
                     /organism="Selenomonas sputigena ATCC 35185"
                     /mol_type="genomic DNA"
                     /strain="ATCC 35185"
                     /isolation_source="subgingival sulcus"
                     /host="Homo sapiens"
                     /culture_collection="ATCC:35185"
                     /db_xref="taxon:546271"
                     /collected_by="W.E.C. Moore"
     gene            71..1537
                     /locus_tag="Selsp_0001"
                     /db_xref="GeneID:10498453"
     CDS             71..1537
                     /locus_tag="Selsp_0001"
                     /note="COGs: COG0593 ATPase involved in DNA replication
                     initiation;
                     InterPro IPR003593:IPR013317:IPR001957:IPR013159;
                     KEGG: tjr:TherJR_0001 chromosomal replication initiator
                     protein DnaA;
                     PFAM: Chromosomal replication control, initiator
                     (DnaA)/regulator (Hda); Chromosomal replication initiator,
                     DnaA C-terminal;
                     SMART: Chromosomal replication initiator, DnaA C-terminal;
                     ATPase, AAA+ type, core;
                     SPTR: Chromosomal replication initiator protein dnaA;
                     TIGRFAM: Chromosomal replication control, initiator DnaA;
                     IMG reference gene:2504585450;
                     PFAM: domain; Bacterial dnaA protein;
                     TIGRFAM: chromosomal replication initiator protein DnaA"
                     /codon_start=1
                     /transl_table=11
                     /product="chromosomal replication initiator protein DnaA"
                     /protein_id="YP_004412447.1"
                     /db_xref="GI:330837867"
                     /db_xref="InterPro:IPR001957"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR010921"
                     /db_xref="InterPro:IPR013159"
                     /db_xref="InterPro:IPR013317"
                     /db_xref="InterPro:IPR018312"
                     /db_xref="InterPro:IPR020591"
                     /db_xref="GeneID:10498453"
                     /translation="MEQSELQAIWEQILQKVLEQRSLTELALNDWLRPVKPLSLSDTT
                     LVLGAPTSLAREWIVKRYIPFLEDAVLDIAKKKLKIEIKNLNIEPAPTSPPVQETLLT
                     ETGTNPSVQEVKDAKKIPVPSQNAAPKKEDGSRSYEPPGMIAPGDASSLNSHYTFDTF
                     VTGNSNRFAHAAALAVAESPGRVYNPFFMYGGVGLGKTHLMHAIGHKILEKFPQMRVL
                     YISSEKFTNELINSIRDGNPESFRQKYRNIDVLLVDDIQFLSKKEHTQEEFFHTFNTL
                     HDANKHIILSSDRHPREIQTLEDRLRSRFEWGLITDIQAPDLETRIAILRKKAALEHL
                     DVPNDVMFSIANRIDNNIRELEGALTRVVAYASLTKQPVTTSLVNEALANIFPEEKTR
                     EVTMELIQEVVASYFKLRLDDLHGKKRTRNLAMPRQIAMYLCRELTGNSLPQIGNSFG
                     GRDHTTVIHACDKIGKERKEDSKLDRTIEQLMQRIESL"
     misc_feature    83..1531
                     /locus_tag="Selsp_0001"
                     /note="chromosomal replication initiation protein;
                     Reviewed; Region: dnaA; PRK00149"
                     /db_xref="CDD:234667"
     misc_feature    89..280
                     /locus_tag="Selsp_0001"
                     /note="DnaA N-terminal domain; Region: DnaA_N; pfam11638"
                     /db_xref="CDD:256535"
     misc_feature    608..997
                     /locus_tag="Selsp_0001"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    641..664
                     /locus_tag="Selsp_0001"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(644..667,830..832,932..934)
                     /locus_tag="Selsp_0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    818..835
                     /locus_tag="Selsp_0001"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    968..970
                     /locus_tag="Selsp_0001"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    1256..1525
                     /locus_tag="Selsp_0001"
                     /note="C-terminal domain of bacterial DnaA proteins. The
                     DNA-binding C-terminal domain of DnaA contains a
                     helix-turn-helix motif that specifically interacts with
                     the DnaA box, a 9-mer motif that occurs repetitively in
                     the replication origin oriC. Multiple...; Region:
                     Bac_DnaA_C; cd06571"
                     /db_xref="CDD:119330"
     misc_feature    order(1325..1327,1349..1354,1373..1375,1391..1399,
                     1424..1438,1445..1447,1454..1459)
                     /locus_tag="Selsp_0001"
                     /note="DnaA box-binding interface [nucleotide binding];
                     other site"
                     /db_xref="CDD:119330"
     gene            complement(1511..1723)
                     /locus_tag="Selsp_0002"
                     /db_xref="GeneID:10496202"
     CDS             complement(1511..1723)
                     /locus_tag="Selsp_0002"
                     /note="IMG reference gene:2504585451"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412448.1"
                     /db_xref="GI:330837868"
                     /db_xref="GeneID:10496202"
                     /translation="MWKRLLGLLIPMKEPCGKDVDKTYWNIHISTGESENKNCAHIGH
                     RISWCFSTGLCTDGAGSGSEAFDALH"
     gene            1827..2939
                     /locus_tag="Selsp_0003"
                     /db_xref="GeneID:10496203"
     CDS             1827..2939
                     /locus_tag="Selsp_0003"
                     /EC_number="2.7.7.7"
                     /note="COGs: COG0592 DNA polymerase sliding clamp subunit
                     (PCNA homolog);
                     InterPro IPR022635:IPR022634:IPR022637:IPR001001;
                     KEGG: vpr:Vpar_0002 DNA polymerase III, beta subunit;
                     PFAM: DNA polymerase III, beta chain, N-terminal; DNA
                     polymerase III, beta chain, C-terminal; DNA polymerase
                     III, beta chain, central;
                     PRIAM: DNA-directed DNA polymerase;
                     SMART: DNA polymerase III, beta chain;
                     SPTR: DNA polymerase III, beta subunit;
                     TIGRFAM: DNA polymerase III, beta chain;
                     IMG reference gene:2504585452;
                     PFAM: DNA polymerase III beta subunit, C-terminal domain;
                     DNA polymerase III beta subunit, N-terminal domain; DNA
                     polymerase III beta subunit, central domain;
                     TIGRFAM: DNA polymerase III, beta subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, beta subunit"
                     /protein_id="YP_004412449.1"
                     /db_xref="GI:330837869"
                     /db_xref="InterPro:IPR001001"
                     /db_xref="InterPro:IPR022634"
                     /db_xref="InterPro:IPR022635"
                     /db_xref="InterPro:IPR022637"
                     /db_xref="GeneID:10496203"
                     /translation="MKFTCHKNELAQAIQLVSKAIANKPQTPILSGIYMEATNNQVEL
                     HATDNEMGIISIIPSEVEQEGKLVLSGRYMQEVIRRLPGETVTISQEIDENISKIQSA
                     ASNFTLLSMPANDFPTVKRLEDGIRFKIQDNVLRDIIKKTVFACSTDEARPVFTGCQM
                     EINGETLKMAATNTHRLSVKKEVIANLSGDLHIIIPAKILNELLRALNSDMPVEVDVC
                     CSSNQASFQFENVVLMSRLIEGQFPNYDSVIPKNFATTVTLDTEDFLAAVDRVSLISR
                     SADYNIIRLEFGGNQVHISSNSPDIGKADEIVAASIDGPAVNIAFNAKYVTDVLKNID
                     SKNFRFLLNQSLQAAAVREEDNPTFVYIVTPVRTQN"
     misc_feature    1827..2930
                     /locus_tag="Selsp_0003"
                     /note="DNA polymerase III subunit beta; Validated; Region:
                     PRK05643"
                     /db_xref="CDD:235541"
     misc_feature    1827..2927
                     /locus_tag="Selsp_0003"
                     /note="Beta clamp domain.  The beta subunit (processivity
                     factor) of DNA polymerase III holoenzyme, refered to as
                     the beta clamp, forms a ring shaped dimer that encircles
                     dsDNA (sliding clamp) in bacteria.  The beta-clamp is
                     structurally similar to the trimeric...; Region:
                     beta_clamp; cd00140"
                     /db_xref="CDD:238082"
     misc_feature    order(1896..1898,2040..2042,2061..2063,2418..2420)
                     /locus_tag="Selsp_0003"
                     /note="putative DNA binding surface [nucleotide binding];
                     other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2043..2045,2052..2054,2133..2135,2139..2141,
                     2643..2645,2739..2744)
                     /locus_tag="Selsp_0003"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238082"
     misc_feature    order(2340..2342,2346..2357,2790..2792,2916..2927)
                     /locus_tag="Selsp_0003"
                     /note="beta-clamp/clamp loader binding surface; other
                     site"
                     /db_xref="CDD:238082"
     misc_feature    order(2340..2342,2346..2351,2568..2570,2676..2678,
                     2715..2720,2799..2801,2916..2927)
                     /locus_tag="Selsp_0003"
                     /note="beta-clamp/translesion DNA polymerase binding
                     surface; other site"
                     /db_xref="CDD:238082"
     gene            2946..4055
                     /locus_tag="Selsp_0004"
                     /db_xref="GeneID:10496204"
     CDS             2946..4055
                     /locus_tag="Selsp_0004"
                     /note="COGs: COG1195 Recombinational DNA repair ATPase
                     (RecF pathway);
                     InterPro IPR001238:IPR003395;
                     KEGG: aar:Acear_0004 DNA replication and repair protein
                     RecF;
                     PFAM: RecF/RecN/SMC;
                     SPTR: DNA replication and repair protein recF;
                     TIGRFAM: DNA-binding, RecF;
                     IMG reference gene:2504585453;
                     PFAM: RecF/RecN/SMC N terminal domain;
                     TIGRFAM: recF protein"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA replication and repair protein RecF"
                     /protein_id="YP_004412450.1"
                     /db_xref="GI:330837870"
                     /db_xref="InterPro:IPR001238"
                     /db_xref="InterPro:IPR003395"
                     /db_xref="InterPro:IPR018078"
                     /db_xref="GeneID:10496204"
                     /translation="MKAKSLRLKCFRNYEELDLSLSPNINVFLGENAQGKTNIAEALY
                     YAAIGRSHRTNADADLIAWDAPAAKIGLLFERLDVENTLEFQFQRGRRRSIRKNGEPI
                     KTKELFGVFNAVLFSPEDLFLIKGAPAERRRFLDGEISQASPSYGHELMQYTRILTQR
                     NSLLKKIRERRAGKEMLSLWDEQLAKSAAHIVEKRFLAVKKLNMLANLMQRRISAGKE
                     NLSLSYELCGAEEEPPCVTEELVPWYNKKLEESLDLDVLRGSTSVGPQRDDIRLEVNG
                     VNLRSFGSQGQQRTGVLALKLSELEFLRSETGEYPVLLLDDVMSELDGTRREKLLDFI
                     GREHIQTLLTATDAAYLPEKFMGNIFHVRAGKIFT"
     misc_feature    2946..4046
                     /locus_tag="Selsp_0004"
                     /note="recombination protein F; Reviewed; Region: recF;
                     PRK00064"
                     /db_xref="CDD:234608"
     misc_feature    2955..4046
                     /locus_tag="Selsp_0004"
                     /note="ATP-binding cassette domain of RecF; Region:
                     ABC_RecF; cd03242"
                     /db_xref="CDD:213209"
     misc_feature    3033..3056
                     /locus_tag="Selsp_0004"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    order(3042..3047,3051..3059,3249..3251,3891..3896,
                     3981..3983)
                     /locus_tag="Selsp_0004"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213209"
     misc_feature    3240..3251
                     /locus_tag="Selsp_0004"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213209"
     misc_feature    3792..3821
                     /locus_tag="Selsp_0004"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213209"
     misc_feature    3879..3896
                     /locus_tag="Selsp_0004"
                     /note="Walker B; other site"
                     /db_xref="CDD:213209"
     misc_feature    3903..3914
                     /locus_tag="Selsp_0004"
                     /note="D-loop; other site"
                     /db_xref="CDD:213209"
     misc_feature    3969..3989
                     /locus_tag="Selsp_0004"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213209"
     gene            4119..5111
                     /locus_tag="Selsp_0005"
                     /db_xref="GeneID:10496205"
     CDS             4119..5111
                     /locus_tag="Selsp_0005"
                     /note="InterPro IPR007922;
                     KEGG: nth:Nther_0005 hypothetical protein;
                     PFAM: Protein of unknown function DUF721/UPF0232;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585454;
                     PFAM: Protein of unknown function (DUF721)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412451.1"
                     /db_xref="GI:330837871"
                     /db_xref="InterPro:IPR007922"
                     /db_xref="GeneID:10496205"
                     /translation="MKRSYRRNPGMEKINQVIPKSIHALGKKIERTYQERFVLARWPE
                     IVGEGIASHVQPIGIEGEKLLLHASVPAWRNEITLMQMTILARFNTFAGFEMVKELAF
                     SWKKGDIVLFQASGRVQEEADEQEAYRKALREMTLTEEEQEACERSVSLVSEERLRKK
                     LRHISQRRKKREKALLSLGEKPCPQCGKLFSGEGVCPSCTCRERRERRRSVRRHLLDL
                     PWARYADIKDHLRCTPAMVASERTRLVQELARRIEFGDWESLEAKTLVMLYRSLRPEQ
                     LTEDVVRRTLYDLRREMAEGTVFRPFPKRSEVMKKTAKRGAKSGEGFHVSAPRR"
     misc_feature    4155..4424
                     /locus_tag="Selsp_0005"
                     /note="Protein of unknown function (DUF721); Region:
                     DUF721; pfam05258"
                     /db_xref="CDD:253119"
     gene            5089..5355
                     /locus_tag="Selsp_0006"
                     /db_xref="GeneID:10496206"
     CDS             5089..5355
                     /locus_tag="Selsp_0006"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585455"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412452.1"
                     /db_xref="GI:330837872"
                     /db_xref="GeneID:10496206"
                     /translation="MYLHLGDDSLVAVSSILAILDIEIYREKFGNALGKKDIAKSAAL
                     RKEPRSVIVTDEGLYFSVISAQSLKRRIQSPAYGMNLHDFAVQS"
     gene            5390..7462
                     /locus_tag="Selsp_0007"
                     /db_xref="GeneID:10496207"
     CDS             5390..7462
                     /locus_tag="Selsp_0007"
                     /EC_number="5.99.1.3"
                     /note="COGs: COG0187 Type IIA topoisomerase (DNA
                     gyrase/topo II topoisomerase IV) B subunit;
                     InterProIPR001241:IPR003594:IPR006171:IPR011557:IPR
                     013506:IPR002288;
                     KEGG: afn:Acfer_0008 DNA gyrase, B subunit;
                     PFAM: DNA topoisomerase, type IIA, subunit B, domain 2;
                     ATPase-like, ATP-binding domain; Toprim domain; DNA
                     topoisomerase, type IIA, subunit B, C-terminal;
                     PRIAM: DNA topoisomerase (ATP-hydrolyzing);
                     SMART: DNA topoisomerase, type IIA, subunit B/N-terminal;
                     ATPase-like, ATP-binding domain;
                     SPTR: DNA gyrase subunit B;
                     TIGRFAM: DNA gyrase, subunit B;
                     IMG reference gene:2504585456;
                     PFAM: Toprim domain; Histidine kinase-, DNA gyrase B-, and
                     HSP90-like ATPase; DNA gyrase B; DNA gyrase B subunit,
                     carboxyl terminus;
                     TIGRFAM: DNA gyrase, B subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA gyrase, B subunit"
                     /protein_id="YP_004412453.1"
                     /db_xref="GI:330837873"
                     /db_xref="InterPro:IPR000565"
                     /db_xref="InterPro:IPR001241"
                     /db_xref="InterPro:IPR002288"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR011557"
                     /db_xref="InterPro:IPR013506"
                     /db_xref="InterPro:IPR013759"
                     /db_xref="InterPro:IPR013760"
                     /db_xref="InterPro:IPR014721"
                     /db_xref="InterPro:IPR018522"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="GeneID:10496207"
                     /translation="MEKKKDALQKALDRAEQDAAEEKLREEEAAKFAEEVRDDDLDLE
                     NVEIHKDMDSADVTAVDGDYGANQIQILEGLEAVRKRPGMYIGSTSERGLHHLVYEVV
                     DNSIDEALAGYCDHIDVTIEKDNSITVVDNGRGIPVDMHESGKPAVEVVLTVLHAGGK
                     FGGEGYKVSGGLHGVGVSVVNALSTSMDVEVKRDGKIHSIRFEQGVTAAPLTVIGETE
                     KTGTKVHFVPDPEIFTVTQYSFDTLKHRLRELAFLNQGITIRLVDKRGEGREESYFYE
                     GGIRSFVEHLNRKKEVIHPTPIYFNGIKDDTVVEIAMQYNDSYMENIYSFVNNINTEE
                     GGTHLAGFKIALTRAANDFARKQGILKDKDGNLSGEDVREGLTCVISLKIHEPQFEGQ
                     TKTKLGNSEVRGIVDSIVTEGLTEYFEENPAITKKVIEKAIMASRAREAARKARELTR
                     RKNALEVSSLPGKLADCSIKDPEQAEIYLVEGDSAGGSAKQGRDRRFQAILPLRGKIL
                     NVEKARLDKIFANAEIRTMITAFGTGISDDFDIAKRRYGKIIIMTDADVDGSHIRTLL
                     LTFFYRYMKPLIERGHVYIAQPPLYQIRKGKKHWYTYSDDELAQKLNEVGRDNATVQR
                     YKGLGEMNPEQLWETTMDPEGRTMLQVRMEDAEEADELFTILMGDKVEPRRQFIEEHA
                     KHVRNLDI"
     misc_feature    5576..7459
                     /locus_tag="Selsp_0007"
                     /note="DNA gyrase subunit B; Validated; Region: gyrB;
                     PRK05644"
                     /db_xref="CDD:235542"
     misc_feature    5669..5962
                     /locus_tag="Selsp_0007"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(5687..5689,5699..5701,5708..5710,5774..5776,
                     5780..5782,5786..5788,5792..5797,5909..5920)
                     /locus_tag="Selsp_0007"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    5699..5701
                     /locus_tag="Selsp_0007"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(5786..5788,5792..5794,5909..5911,5915..5917)
                     /locus_tag="Selsp_0007"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     misc_feature    6218..6694
                     /locus_tag="Selsp_0007"
                     /note="TopoIIA_Trans_DNA_gyrase: Transducer domain, having
                     a ribosomal S5 domain 2-like fold, of the type found in
                     proteins of the type IIA family of DNA topoisomerases
                     similar to the B subunits of E. coli DNA gyrase and E.
                     coli Topoisomerase IV which are; Region:
                     TopoII_Trans_DNA_gyrase; cd00822"
                     /db_xref="CDD:238419"
     misc_feature    6371..6373
                     /locus_tag="Selsp_0007"
                     /note="anchoring element; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(6545..6547,6554..6559,6563..6565)
                     /locus_tag="Selsp_0007"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    order(6563..6565,6569..6571)
                     /locus_tag="Selsp_0007"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238419"
     misc_feature    6812..7153
                     /locus_tag="Selsp_0007"
                     /note="TOPRIM_TopoIIA_GyrB: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in proteins of the type IIA family of DNA topoisomerases
                     similar to the Escherichia coli GyrB subunit. TopoIIA
                     enzymes cut both strands of the...; Region:
                     TOPRIM_TopoIIA_GyrB; cd03366"
                     /db_xref="CDD:173786"
     misc_feature    order(6830..6835,6842..6844,7049..7051,7055..7057,
                     7061..7063)
                     /locus_tag="Selsp_0007"
                     /note="active site"
                     /db_xref="CDD:173786"
     misc_feature    order(6830..6832,7049..7051)
                     /locus_tag="Selsp_0007"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173786"
     misc_feature    7235..7426
                     /locus_tag="Selsp_0007"
                     /note="DNA gyrase B subunit, carboxyl terminus; Region:
                     DNA_gyraseB_C; pfam00986"
                     /db_xref="CDD:250273"
     gene            7560..8774
                     /locus_tag="Selsp_0008"
                     /db_xref="GeneID:10496208"
     CDS             7560..8774
                     /locus_tag="Selsp_0008"
                     /note="COGs: COG1373 ATPase (AAA+ superfamily);
                     KEGG: dhd:Dhaf_4768 hypothetical protein;
                     SPTR: ATPase;
                     IMG reference gene:2504585457"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412454.1"
                     /db_xref="GI:330837874"
                     /db_xref="GeneID:10496208"
                     /translation="MKLIERASYMDFLQRNRERPIIKVVSGVRRCGKSTLFSLYQHHL
                     LQDGVTEEQIHVINFENLEFEDLQEYHALYRYVCERLVPGKWNYVFLDEIQHVPQFEK
                     AVDSLFIKEKVDIYITGSNAYFMSSDLATLLSGRYVELRMLPLSFREFCSREMLQERF
                     SLRELYEKYTRESSFPYAMQLDGREKDINEYMQGIYSTILLKDIVARLRIADAKMLES
                     VTKYLFLHVGSLLSPKKIADSMTSAGRKIDAKTVERYLQGLQDGLLVYQADRFNLVGK
                     EVLRINSKYYVVDVAMRFFLIGRKGQDTGHVLENIVYLELLRRGYRVYVGALPSGEVD
                     FVVQNEKGHVYIQVAESTQQPEVLERELKSLRSIKDNYPKYLLTLDEVNATADYDGIK
                     KRNVLRWLLEEE"
     misc_feature    7560..8768
                     /locus_tag="Selsp_0008"
                     /note="Predicted ATPase (AAA+ superfamily) [General
                     function prediction only]; Region: COG1373"
                     /db_xref="CDD:224292"
     misc_feature    7623..8012
                     /locus_tag="Selsp_0008"
                     /note="AAA domain; Region: AAA_14; pfam13173"
                     /db_xref="CDD:257541"
     misc_feature    8157..8603
                     /locus_tag="Selsp_0008"
                     /note="Domain of unknown function (DUF4143); Region:
                     DUF4143; pfam13635"
                     /db_xref="CDD:257945"
     gene            complement(8837..9223)
                     /locus_tag="Selsp_0009"
                     /db_xref="GeneID:10496209"
     CDS             complement(8837..9223)
                     /locus_tag="Selsp_0009"
                     /note="COGs: COG3412 conserved hypothetical protein;
                     InterPro IPR012844:IPR004701;
                     KEGG: elm:ELI_3082 dihydroxyacetone kinase;
                     PFAM: Phosphotransferase system, fructose subfamily IIA
                     component;
                     SPTR: Dihydroxyacetone kinase, phosphotransfer subunit;
                     TIGRFAM: Dihydroxyacetone kinase, subunit
                     phosphotransferase;
                     IMG reference gene:2504585458;
                     PFAM: PTS system fructose IIA component;
                     TIGRFAM: dihydroxyacetone kinase, phosphotransfer subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase, phosphotransfer
                     subunit"
                     /protein_id="YP_004412455.1"
                     /db_xref="GI:330837875"
                     /db_xref="InterPro:IPR004701"
                     /db_xref="InterPro:IPR012844"
                     /db_xref="GeneID:10496209"
                     /translation="MFSIVVVSHSEKLAEGVAEVAKMMARDVTIVAAGGMEDGSLGTS
                     YEKIAAAIDKAYTDDGVALFMDMGSAVMTAEMVLESMSDRRLKLIDAPLVEGVVLAAV
                     EASSGTALEDLAGKMQQARDMHKIGI"
     misc_feature    complement(8888..9223)
                     /locus_tag="Selsp_0009"
                     /note="PTS_IIA, PTS system, mannose/sorbose specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIA_man; cl00025"
                     /db_xref="CDD:260144"
     misc_feature    complement(order(8927..8929,9011..9013,9119..9121,
                     9149..9154,9197..9199))
                     /locus_tag="Selsp_0009"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    complement(order(9011..9013,9026..9028,9197..9199))
                     /locus_tag="Selsp_0009"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    complement(9197..9199)
                     /locus_tag="Selsp_0009"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            complement(9237..9857)
                     /locus_tag="Selsp_0010"
                     /db_xref="GeneID:10496210"
     CDS             complement(9237..9857)
                     /locus_tag="Selsp_0010"
                     /note="COGs: COG2376 Dihydroxyacetone kinase;
                     InterPro IPR012737:IPR004007;
                     KEGG: elm:ELI_3083 hypothetical protein;
                     PFAM: Dak phosphatase;
                     SPTR: Dihydroxyacetone kinase, L subunit;
                     TIGRFAM: Dihydroxyacetone kinase, subunit L;
                     IMG reference gene:2504585459;
                     PFAM: DAK2 domain;
                     TIGRFAM: dihydroxyacetone kinase,
                     phosphoprotein-dependent, L subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxyacetone kinase, L subunit"
                     /protein_id="YP_004412456.1"
                     /db_xref="GI:330837876"
                     /db_xref="InterPro:IPR004007"
                     /db_xref="GeneID:10496210"
                     /translation="MDTKKLLEIMKAISEKIEAEKDVLTELDSAIGDGDHGINMARGA
                     KTVMEKLPSLIGKDSGAIFKGIGMAVVSSVGGASGPLYGTAFMKAGDALKGKMELSAE
                     DFLAAFSASVAGIKMRGKSTIGEKTMLDALCPAERAMREAVEAKKTLKEALEAAAVAA
                     EKGAERTKDLVATKGRASYLGERSLGHRDPGAVSSSFMLRAMADAM"
     misc_feature    complement(9249..9839)
                     /locus_tag="Selsp_0010"
                     /note="dihydroxyacetone kinase, phosphoprotein-dependent,
                     L subunit; Region: dha_L_ycgS; TIGR02365"
                     /db_xref="CDD:233837"
     gene            complement(9910..10674)
                     /locus_tag="Selsp_0011"
                     /pseudo
                     /db_xref="GeneID:10496211"
     gene            complement(10675..11658)
                     /locus_tag="Selsp_0012"
                     /pseudo
                     /db_xref="GeneID:10496212"
     gene            complement(11740..12399)
                     /locus_tag="Selsp_0013"
                     /db_xref="GeneID:10496213"
     CDS             complement(11740..12399)
                     /locus_tag="Selsp_0013"
                     /note="COGs: COG0279 Phosphoheptose isomerase;
                     InterPro IPR001347;
                     KEGG: dma:DMR_p1_00410 putative phosphoheptose isomerase;
                     PFAM: Sugar isomerase (SIS);
                     SPTR: Phosphoheptose isomerase;
                     IMG reference gene:2504585462;
                     PFAM: SIS domain"
                     /codon_start=1
                     /transl_table=11
                     /product="sugar isomerase (SIS)"
                     /protein_id="YP_004412457.1"
                     /db_xref="GI:330837877"
                     /db_xref="InterPro:IPR001347"
                     /db_xref="GeneID:10496213"
                     /translation="MAKETTLATIDHLIERYPVLAPMEEPLKAAVETIVNCYRKGGKL
                     LICGNGGSAADAEHITGELMKGFLLPRRLGEDKRQKLMDACPEDAAYLIENLQEALPA
                     LSLVNQIALGTAFANDQAPDLVFAQQVFGLGREGDVLLAISTSGNSQNVLYAAQVARA
                     FGISVISLTGMGGGKLRALTDILLAVPDKETYRIQELHLPIYHALCIAAEEEFFGTND
                     K"
     misc_feature    complement(11782..12342)
                     /locus_tag="Selsp_0013"
                     /note="Phosphoheptose isomerase is a member of the SIS
                     (Sugar ISomerase) superfamily. Phosphoheptose isomerase
                     catalyzes the isomerization of sedoheptulose 7-phosphate
                     into D-glycero-D-mannoheptose 7-phosphate. This is the
                     first step of the biosynthesis of...; Region: SIS_GmhA;
                     cd05006"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(11791..11793,11800..11802,11812..11817,
                     12226..12231,12247..12249,12307..12309,12316..12318))
                     /locus_tag="Selsp_0013"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240139"
     misc_feature    complement(order(11815..11817,11827..11829,11956..11958,
                     11965..11973,12247..12255))
                     /locus_tag="Selsp_0013"
                     /note="active site"
                     /db_xref="CDD:240139"
     gene            complement(12415..12822)
                     /locus_tag="Selsp_0014"
                     /db_xref="GeneID:10496214"
     CDS             complement(12415..12822)
                     /locus_tag="Selsp_0014"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585463"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412458.1"
                     /db_xref="GI:330837878"
                     /db_xref="GeneID:10496214"
                     /translation="MKSVFCGFCLCKGCALIFQRSLRKEERIMHFIPSRKKIIAALMM
                     GAFAGGMAPIFVAGANTACISTVSVAHAASCPTPTKRYQEAARDDSEDKAADATESVS
                     DNIFKAAWRIALLVAIVFLARIGWKHFHKKKNA"
     gene            complement(12830..12988)
                     /locus_tag="Selsp_0015"
                     /db_xref="GeneID:10496215"
     CDS             complement(12830..12988)
                     /locus_tag="Selsp_0015"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585464"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412459.1"
                     /db_xref="GI:330837879"
                     /db_xref="GeneID:10496215"
                     /translation="MSLTDETRQKLQKQIDALKKRMLYDANDLDYETHLFLVRTLQKM
                     LDRKKCKP"
     gene            complement(12985..13134)
                     /locus_tag="Selsp_0016"
                     /db_xref="GeneID:10496216"
     CDS             complement(12985..13134)
                     /locus_tag="Selsp_0016"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585465"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412460.1"
                     /db_xref="GI:330837880"
                     /db_xref="GeneID:10496216"
                     /translation="MNKADFDEMDPETQEILDRLSPAPEKLQEEGWNSRAQQQMMLEE
                     NGHNA"
     gene            13348..13466
                     /locus_tag="Selsp_R0001"
                     /db_xref="GeneID:10496217"
     ncRNA           13348..13466
                     /locus_tag="Selsp_R0001"
                     /ncRNA_class="SRP_RNA"
                     /product="RNA component of signal recognition particle"
                     /note="IMG reference gene:2504585466"
                     /db_xref="GeneID:10496217"
     gene            13567..15561
                     /locus_tag="Selsp_0017"
                     /db_xref="GeneID:10496218"
     CDS             13567..15561
                     /locus_tag="Selsp_0017"
                     /EC_number="2.7.7.7"
                     /note="COGs: COG2812 DNA polymerase III gamma/tau
                     subunits;
                     InterPro IPR012763:IPR003593:IPR003959;
                     KEGG: afn:Acfer_1728 DNA polymerase III, subunits gamma
                     and tau;
                     PFAM: ATPase, AAA-type, core;
                     PRIAM: DNA-directed DNA polymerase;
                     SMART: ATPase, AAA+ type, core;
                     SPTR: DNA polymerase III, gamma and tau subunit;
                     TIGRFAM: DNA polymerase III, subunit gamma/ tau;
                     IMG reference gene:2504585467;
                     PFAM: ATPase family associated with various cellular
                     activities (AAA); DNA polymerase III subunits gamma and
                     tau domain III;
                     TIGRFAM: DNA polymerase III, delta' subunit; DNA
                     polymerase III, subunit gamma and tau"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III, subunits gamma and tau"
                     /protein_id="YP_004412461.1"
                     /db_xref="GI:330837881"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR008921"
                     /db_xref="InterPro:IPR022754"
                     /db_xref="GeneID:10496218"
                     /translation="MAYIALYRQWRPGSFKDLVGQTAVSRTLSHAISAGRIAHAYLFS
                     GPRGTGKTSTAKILAKSLNCEKGPTPEPCGVCKNCTKIADGTALDVFEIDAASNRGID
                     EMRDLREKVKFTPAEGRYKVYIIDEVHMLTTEAFNALLKTLEEPPAHVVFILATTEPH
                     KVPATIQSRCQRFDFRRITVEEIEARLAYVAQEMKIPCEKEALRLIARQADGGMRDAL
                     SLLDQCASLDGDTLTAACVEENLGLIGHEPIYRLTKAIGERAKGEVLETIAELLALGK
                     DPMQLLAELTIHLRSLMIYEAAGALAALNLADDTGAALEEQKALFTQAQIMAMIARLH
                     EAMAELRWTPQPRITLEVALLSLCRENVEDGAEGAPAPTPAAAPAPAEAARVARLEAE
                     LAALKAQLSAQPVRAAAPAASPLPTARKRAASRTNEAASSGTPARNSAPLASSAPAAQ
                     AAPNPEGEKIYAELLSRLQEKQRISVLACLKGASFAGNGTGTFRLHFSSPLLARRTMR
                     DDYRKIIEELLAEIAGTPLAISCEAQAVPPAAPPPAPKKKPPLAALDEIEPRGLSPKP
                     LEIDENELSPEERSRLKNAVSLLGGHLVDLPEEQRIAALAASGKAVTKSVTETAEKKD
                     APPLDDAPVLDDISLPDDAPVPDDVPPPDDGDAPPPEENS"
     misc_feature    13567..15171
                     /locus_tag="Selsp_0017"
                     /note="DNA polymerase III subunits gamma and tau;
                     Validated; Region: PRK05563"
                     /db_xref="CDD:235505"
     misc_feature    13621..14082
                     /locus_tag="Selsp_0017"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    13699..13722
                     /locus_tag="Selsp_0017"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(13702..13725,13942..13944,14035..14037)
                     /locus_tag="Selsp_0017"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    13930..13947
                     /locus_tag="Selsp_0017"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    14071..14073
                     /locus_tag="Selsp_0017"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    14260..14640
                     /locus_tag="Selsp_0017"
                     /note="DNA polymerase III subunits gamma and tau domain
                     III; Region: DNA_pol3_gamma3; pfam12169"
                     /db_xref="CDD:256887"
     gene            15636..15971
                     /locus_tag="Selsp_0018"
                     /db_xref="GeneID:10496219"
     CDS             15636..15971
                     /locus_tag="Selsp_0018"
                     /note="COGs: COG0718 conserved hypothetical protein;
                     InterPro IPR004401;
                     KEGG: vpr:Vpar_1635 hypothetical protein;
                     PFAM: Uncharacterised protein family UPF0133;
                     SPTR: UPF0133 protein SELSPUOL_01346;
                     TIGRFAM: Uncharacterised protein family UPF0133;
                     IMG reference gene:2504585468;
                     PFAM: Uncharacterised BCR, YbaB family COG0718;
                     TIGRFAM: DNA-binding protein, YbaB/EbfC family"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized protein family UPF0133"
                     /protein_id="YP_004412462.1"
                     /db_xref="GI:330837882"
                     /db_xref="InterPro:IPR004401"
                     /db_xref="GeneID:10496219"
                     /translation="MFGGMGNMGNMQGMMKKVQKLQNDMKKMQEELKKKTVEVSAGGG
                     AVKIVMNGEKEVQSLHIDPAAVDPEDVEMLQDLLSAAFNESVKKVDDMMAGEMGKLTG
                     GLGLPPGMF"
     misc_feature    15654..15968
                     /locus_tag="Selsp_0018"
                     /note="hypothetical protein; Validated; Region: PRK00153"
                     /db_xref="CDD:234669"
     gene            15973..16578
                     /locus_tag="Selsp_0019"
                     /db_xref="GeneID:10496220"
     CDS             15973..16578
                     /locus_tag="Selsp_0019"
                     /note="COGs: COG0353 Recombinational DNA repair protein
                     (RecF pathway);
                     InterPro IPR015967:IPR006171:IPR000093;
                     KEGG: tjr:TherJR_0070 recombination protein RecR;
                     SMART: Toprim domain;
                     SPTR: Recombination protein recR;
                     TIGRFAM: RecR protein;
                     IMG reference gene:2504585469;
                     PFAM: Toprim domain; RecR protein;
                     TIGRFAM: recombination protein RecR"
                     /codon_start=1
                     /transl_table=11
                     /product="recombination protein RecR"
                     /protein_id="YP_004412463.1"
                     /db_xref="GI:330837883"
                     /db_xref="InterPro:IPR000093"
                     /db_xref="InterPro:IPR006171"
                     /db_xref="InterPro:IPR015967"
                     /db_xref="GeneID:10496220"
                     /translation="MQYIAPLAKLIEHFRALPGIGSKTAVRLAYHVLDMDAAKARALA
                     EAIVEAREKIGFCSVCCNLSDQDPCAICASEKRDRSKICVVEQPQDVAAVERMKDYKG
                     LYHVLHGSLSPLSGVGPENLRVKELLHRLEGEAGAEVQEIIMATNPTVEGEATAMYLA
                     RLLKPAGLKVTRIAHGLPIGGDLEYADEVTLAKALENRKEI"
     misc_feature    15976..16575
                     /locus_tag="Selsp_0019"
                     /note="recombination protein RecR; Reviewed; Region: recR;
                     PRK00076"
                     /db_xref="CDD:234616"
     misc_feature    <16111..16206
                     /locus_tag="Selsp_0019"
                     /note="RecR protein; Region: RecR; pfam02132"
                     /db_xref="CDD:251108"
     misc_feature    16210..16554
                     /locus_tag="Selsp_0019"
                     /note="TOPRIM_recR: topoisomerase-primase (TOPRIM)
                     nucleotidyl transferase/hydrolase domain of the type found
                     in Escherichia coli RecR.  RecR participates in the RecFOR
                     pathway of homologous recombinational repair in
                     prokaryotes. This pathway provides a...; Region:
                     TOPRIM_recR; cd01025"
                     /db_xref="CDD:173775"
     misc_feature    order(16228..16233,16240..16242,16411..16413,16417..16419,
                     16423..16425)
                     /locus_tag="Selsp_0019"
                     /note="putative active site [active]"
                     /db_xref="CDD:173775"
     misc_feature    order(16228..16230,16411..16413)
                     /locus_tag="Selsp_0019"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173775"
     misc_feature    order(16246..16254,16258..16263,16393..16395,16399..16401,
                     16405..16407,16414..16416,16450..16452,16480..16515,
                     16519..16521,16534..16536,16540..16542,16546..16554)
                     /locus_tag="Selsp_0019"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:173775"
     gene            16580..16822
                     /locus_tag="Selsp_0020"
                     /db_xref="GeneID:10496221"
     CDS             16580..16822
                     /locus_tag="Selsp_0020"
                     /note="InterPro IPR010001;
                     KEGG: cno:NT01CX_0822 sigma-K factor processing regulatory
                     protein BofA;
                     PFAM: SigmaK-factor processing regulatory BofA;
                     SPTR: Sigma-K factor processing regulatory protein BofA;
                     IMG reference gene:2504585470;
                     PFAM: SigmaK-factor processing regulatory protein BofA;
                     TIGRFAM: pro-sigmaK processing inhibitor BofA"
                     /codon_start=1
                     /transl_table=11
                     /product="sigmaK-factor processing regulatory BofA"
                     /protein_id="YP_004412464.1"
                     /db_xref="GI:330837884"
                     /db_xref="InterPro:IPR010001"
                     /db_xref="GeneID:10496221"
                     /translation="MLEIIASLAVGILLLSIAAKLLDLPLRLLKKFIVNSVVGAVLLS
                     IVKLLGFHVTINIFTSLAAGIFGVPGVLMVLAWSYL"
     gene            16904..18076
                     /locus_tag="Selsp_0021"
                     /db_xref="GeneID:10496222"
     CDS             16904..18076
                     /locus_tag="Selsp_0021"
                     /note="COGs: COG2814 Arabinose efflux permease;
                     InterPro IPR011701;
                     KEGG: vpr:Vpar_0600 major facilitator superfamily MFS_1;
                     PFAM: Major facilitator superfamily MFS-1;
                     SPTR: Major facilitator family transporter;
                     IMG reference gene:2504585471;
                     PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="YP_004412465.1"
                     /db_xref="GI:330837885"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:10496222"
                     /translation="MNEEKARNVETLWTAEFIGMSATNFFHLMAQYILIVGLPIYIMN
                     EMKGGELEAGLAMTFFQIGAVSSRPFAGRLIDSLHKGRLLLGATLAFFAIMLAFCFAH
                     TEEAIYTLRLLQGIEFALGTTAAATLAALVLPAAKKGTGIGYFALSTNLAMVVGPLTG
                     LLIIRSFGMMALFVFLAASALFTLWLANRRKLPDEIVVPKEKKGRGFSLVERQALPAA
                     LIGGLMFFAYGGVLTFIPLYARTLGMEEDVSAFFAIFALIIVVTRPFIGRIFDQRGAD
                     YTVYPGLLLFFLGFLCFAAAESSAAFLASAAILGAGFGSASPALQTLAVASVAPERAG
                     LATATYFWALDISVGLAAATLGLVAAHFGYAALYGILCPAVLVLAVIFYTIWRRRR"
     misc_feature    16952..18061
                     /locus_tag="Selsp_0021"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    16961..17959
                     /locus_tag="Selsp_0021"
                     /note="Major Facilitator Superfamily; Region: MFS_1;
                     pfam07690"
                     /db_xref="CDD:254360"
     misc_feature    order(16994..16996,17003..17011,17015..17020,17072..17074,
                     17081..17086,17093..17095,17105..17110,17114..17119,
                     17255..17260,17267..17272,17279..17284,17291..17293,
                     17327..17332,17339..17344,17360..17362,17576..17578,
                     17585..17590,17597..17602,17609..17611,17645..17647,
                     17657..17659,17669..17671,17678..17680,17690..17692,
                     17831..17833,17840..17845,17852..17854,17864..17869,
                     17876..17878,17909..17914,17921..17926,17933..17938,
                     17945..17947)
                     /locus_tag="Selsp_0021"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            18142..19452
                     /locus_tag="Selsp_0022"
                     /db_xref="GeneID:10496223"
     CDS             18142..19452
                     /locus_tag="Selsp_0022"
                     /note="KEGG: cow:Calow_2025 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585472"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412466.1"
                     /db_xref="GI:330837886"
                     /db_xref="GeneID:10496223"
                     /translation="MFHKKKFFILLLLVISVMASGCFRISSDTAIHKDGSVDIKNTMV
                     GVPLLAEQIQEARESAKKNHPNASLKDVQDGNMSGIEETTHYKTIDEMAKADGNMFKT
                     VEGKAKGVQQKKGWLYDTYAVDVLFEGKKDTQANMDQDERAMMQAMLSSVRADVSLSL
                     PYAPESHNADKVTDGGTTLVWDLASALMNGGDKSIQATFRIWNMTHIYITIGIAVVLI
                     LVFLGGLIGGFLCRKGSPLQFSIFGLGLVALLALLGIGGFSLYSVTNLPALKEQDIIS
                     ATAAKSSINQLQDALGSSANDQALSKAKKGALSDSSSAKTKAQTPAAPNPASSGSQDA
                     VRTFETFHRNITNRNLRAAYNALGSEMQSQMTYEGWAPGFNTTVSSTPLNVEVQSATQ
                     DRVTLTYTLRAVDNPGGTRYFNGRAVLTRHGSVWKIDEIVNKPK"
     gene            complement(19534..20373)
                     /locus_tag="Selsp_0023"
                     /db_xref="GeneID:10496224"
     CDS             complement(19534..20373)
                     /locus_tag="Selsp_0023"
                     /note="COGs: COG1427 periplasmic solute-binding protein;
                     InterPro IPR003773;
                     KEGG: swo:Swol_1158 hypothetical protein;
                     PFAM: Protein of unknown function DUF178;
                     SPTR: Hypothetical cytosolic protein;
                     IMG reference gene:2504585473;
                     PFAM: Putative periplasminc binding protein (DUF178)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412467.1"
                     /db_xref="GI:330837887"
                     /db_xref="InterPro:IPR003773"
                     /db_xref="GeneID:10496224"
                     /translation="MAEPRVGHIHFLNILPLTWSFAHGGNRGLHLVPGVPAELNRELL
                     AGRLDVSGISSIIYAQGDESLVILPDICVRTDKAVTSILLVTKKPLEEIRDDRIILTA
                     KSATSHCLLKIILKEGYDASPNYYVRHIVPQNPVPDDAAGSLFIGDDALWLYHHRRED
                     LHYYDLGAEWHKLTGLGMVYSLWTANRTFARESPEKLQLVYERLVRGMAEGVANKYAT
                     IESVREEKDFTFQQLEEYLQVIHWDLKDEHLEGLELFYRKAHELNLINHVPKLCFADV
                     KRI"
     misc_feature    complement(19591..20364)
                     /locus_tag="Selsp_0023"
                     /note="Menaquinone biosynthesis; Region: VitK2_biosynth;
                     pfam02621"
                     /db_xref="CDD:251424"
     gene            complement(20415..21206)
                     /locus_tag="Selsp_0024"
                     /db_xref="GeneID:10496225"
     CDS             complement(20415..21206)
                     /locus_tag="Selsp_0024"
                     /EC_number="2.7.4.7"
                     /note="COGs: COG0351
                     Hydroxymethylpyrimidine/phosphomethylpyrimidine kinase;
                     InterPro IPR004399:IPR013749;
                     KEGG: cac:CA_C3095 hydroxyethylthiazole kinase ThiM/ThiK;
                     PFAM: Phosphomethylpyrimidine kinase type-1;
                     PRIAM: Phosphomethylpyrimidine kinase;
                     SPTR: Phosphomethylpyrimidine kinase;
                     TIGRFAM: Phosphomethylpyrimidine kinase type-2;
                     IMG reference gene:2504585474;
                     PFAM: Phosphomethylpyrimidine kinase;
                     TIGRFAM: phosphomethylpyrimidine kinase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphomethylpyrimidine kinase"
                     /protein_id="YP_004412468.1"
                     /db_xref="GI:330837888"
                     /db_xref="InterPro:IPR013749"
                     /db_xref="GeneID:10496225"
                     /translation="MKDIRKVLTIAGSDPSGGAGIQADIKTITAHKMYAMNISTALTV
                     QNTTGIRDTFVIPPDFIAEQLDAIYDDIRPDAVKIGMVANDAIVHTIAEKLREKDAKN
                     IVLDPVIASTSGCDLITSDTLFAMVDELLPLVDIVTPNLPEAAAITGVAITDEDSMLK
                     AAKVLTERFPIAVLIKGGHLVESADDLLYADGKARWYKQTRIDNENTHGTGCALSTAI
                     ACGLAAGKPLTIAVEDAKAYITGAIRAGLNIGKGRGPLLHMWEYM"
     misc_feature    complement(20469..21191)
                     /locus_tag="Selsp_0024"
                     /note="4-amino-5-hydroxymethyl-2-methyl-pyrimidine
                     phosphate kinase (HMPP-kinase) catalyzes two consecutive
                     phosphorylation steps in the thiamine phosphate
                     biosynthesis pathway, leading to the synthesis of vitamin
                     B1. The first step is the phosphorylation of...; Region:
                     HMPP_kinase; cd01169"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(21003..21008,21018..21020,21027..21029,
                     21036..21041,21045..21047,21051..21056,21069..21083,
                     21090..21092,21096..21113,21120..21122,21129..21134,
                     21141..21143,21153..21155,21159..21164,21168..21170,
                     21189..21191))
                     /locus_tag="Selsp_0024"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(20571..20573,20964..20966,21072..21074,
                     21135..21137,21171..21173))
                     /locus_tag="Selsp_0024"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238574"
     misc_feature    complement(order(20574..20576,20580..20582,20679..20681,
                     20778..20780,20889..20891))
                     /locus_tag="Selsp_0024"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238574"
     gene            complement(21290..22003)
                     /locus_tag="Selsp_0025"
                     /db_xref="GeneID:10496226"
     CDS             complement(21290..22003)
                     /locus_tag="Selsp_0025"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585475"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412469.1"
                     /db_xref="GI:330837889"
                     /db_xref="GeneID:10496226"
                     /translation="MRIVRYAILFCVLVALFTGAMLYYSSTHRDETQSALALLEEETL
                     SPEEREQEAAQREAREAERLAEEARRKEREARIEKLKEGMERTDSGAYTWYSYPEEKK
                     LAGGLYVQPLLGHSRDSTFRCNILYYYSMHESSMRGWIFGDHFAIEADGERRTWEIAE
                     KKRRDHLDKDVEFLTERSQIALGEEGAFILRRASNAHAARFIYWSTAEGKSISHTLTS
                     EEKRRLRNMIALYDLWQEP"
     misc_feature    complement(<21671..>21904)
                     /locus_tag="Selsp_0025"
                     /note="Atrophin-1 family; Region: Atrophin-1; pfam03154"
                     /db_xref="CDD:251763"
     gene            complement(22274..22361)
                     /locus_tag="Selsp_R0002"
                     /db_xref="GeneID:10496227"
     tRNA            complement(22274..22361)
                     /locus_tag="Selsp_R0002"
                     /product="tRNA-Ser"
                     /note="IMG reference gene:2504585476"
                     /db_xref="GeneID:10496227"
     gene            complement(22482..23132)
                     /locus_tag="Selsp_0026"
                     /db_xref="GeneID:10496228"
     CDS             complement(22482..23132)
                     /locus_tag="Selsp_0026"
                     /note="COGs: COG0035 Uracil phosphoribosyltransferase;
                     InterPro IPR005765:IPR000836;
                     KEGG: vpr:Vpar_1092 uracil phosphoribosyltransferase;
                     PFAM: Phosphoribosyltransferase;
                     SPTR: Uracil phosphoribosyltransferase;
                     TIGRFAM: Uracil phosphoribosyl transferase;
                     IMG reference gene:2504585477;
                     PFAM: Phosphoribosyl transferase domain;
                     TIGRFAM: uracil phosphoribosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="uracil phosphoribosyltransferase"
                     /protein_id="YP_004412470.1"
                     /db_xref="GI:330837890"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR005765"
                     /db_xref="GeneID:10496228"
                     /translation="MTQENQADLAVHIVDHPLVQHKLTLMRQKETGTKDFRELLEEIA
                     MLMAYEITRDLPLEDVEIETPVAPCRVKKLAGKKLGIVPILRAGLGMAEGVLRLIPAA
                     RVGHIGLYRDPDTLQPVEYFCKLPGDIGERMFIVVDPMLATGGSSAAALDLLKKKGAK
                     SIVLLCLVAAPEGVRTVNAAHPDIPIYVAAVDDCLNEHGYIVPGLGDAGDRIFGTL"
     misc_feature    complement(22560..22925)
                     /locus_tag="Selsp_0026"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    complement(order(22623..22625,22695..22709,22713..22721,
                     22872..22874,22878..22880))
                     /locus_tag="Selsp_0026"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(23144..24391)
                     /locus_tag="Selsp_0027"
                     /db_xref="GeneID:10496229"
     CDS             complement(23144..24391)
                     /locus_tag="Selsp_0027"
                     /EC_number="2.1.2.1"
                     /note="COGs: COG0112 Glycine/serine
                     hydroxymethyltransferase;
                     InterPro IPR001085;
                     KEGG: vpr:Vpar_1093 glycine hydroxymethyltransferase;
                     PFAM: Serine hydroxymethyltransferase;
                     PRIAM: Glycine hydroxymethyltransferase;
                     SPTR: Serine hydroxymethyltransferase;
                     IMG reference gene:2504585478;
                     PFAM: Serine hydroxymethyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Glycine hydroxymethyltransferase"
                     /protein_id="YP_004412471.1"
                     /db_xref="GI:330837891"
                     /db_xref="InterPro:IPR001085"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR019798"
                     /db_xref="GeneID:10496229"
                     /translation="MALMDTLKKTDEKIASALEAELSRQRHKLELIASENIVSRAVME
                     AQGSVLTNKYAEGYPGKRYYGGCECVDVVEALAIERAKELFGAGYVNVQPHSGAQANM
                     AVFFSLLSPGDTYMGMNLTDGGHLTHGSAVNMSGKYFHVVPYGVDKETECIDYDALEK
                     QAKEVKPKLIVAGASAYARIIDFERLSAIAKAIGAYLMVDMAHIAGLVAGGMHPSPLP
                     WADVVTTTTHKTLRGPRGGMILTKDAEFGAQFNKAIFPGIQGGPLMHVIAAKAVALEE
                     ALQPAFKEYAAQVVKNAKTLAASLQEKGFRIVSGGTDNHLMLVDLRSKGVTGKEAQNL
                     LDGVGITANRNTIPFEPLSPFVTSGIRLGSPALTTRGFKEADMEKVAAIIALVLDHAT
                     DTAAQEEAKKRVDALCEKYPLYE"
     misc_feature    complement(23171..24370)
                     /locus_tag="Selsp_0027"
                     /note="Serine-glycine hydroxymethyltransferase (SHMT).
                     This family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). SHMT
                     carries out interconversion of serine and glycine; it
                     catalyzes the transfer of hydroxymethyl...; Region: SHMT;
                     cd00378"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(23549..23551,23603..23605,23978..23983,
                     24086..24088,24107..24109,24152..24154,24176..24181,
                     24233..24235,24287..24289,24302..24304,24329..24334,
                     24353..24355,24359..24361))
                     /locus_tag="Selsp_0027"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(23309..23311,23687..23689,23705..23710,
                     23783..23785,23792..23794,23867..23869,24017..24019,
                     24098..24103,24200..24202,24230..24232,24290..24292))
                     /locus_tag="Selsp_0027"
                     /note="glycine-pyridoxal phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(23309..23311,23705..23707,24017..24019,
                     24290..24292))
                     /locus_tag="Selsp_0027"
                     /note="active site"
                     /db_xref="CDD:99733"
     misc_feature    complement(order(23357..23359,23627..23629,24014..24016,
                     24020..24022,24032..24034,24203..24205,24224..24226))
                     /locus_tag="Selsp_0027"
                     /note="folate binding site [chemical binding]; other site"
                     /db_xref="CDD:99733"
     gene            24726..26258
                     /locus_tag="Selsp_0028"
                     /db_xref="GeneID:10496230"
     CDS             24726..26258
                     /locus_tag="Selsp_0028"
                     /EC_number="3.6.1.40"
                     /note="COGs: COG0248 Exopolyphosphatase;
                     InterPro IPR003695:IPR006674;
                     KEGG: vpr:Vpar_0618 Ppx/GppA phosphatase;
                     PFAM: Ppx/GppA phosphatase; Metal-dependent
                     phosphohydrolase, HD subdomain;
                     PRIAM: Guanosine-5'-triphosphate,3'-diphosphate
                     diphosphatase;
                     SPTR: Exopolyphosphatase;
                     IMG reference gene:2504585479;
                     PFAM: HD domain; Ppx/GppA phosphatase family;
                     TIGRFAM: exopolyphosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Ppx/GppA phosphatase"
                     /protein_id="YP_004412472.1"
                     /db_xref="GI:330837892"
                     /db_xref="InterPro:IPR003695"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:10496230"
                     /translation="MENLAIIDMGSNSIRFIVMQINDNHSYFLQYQQKEAIRLGKGMS
                     ETGRLNPDGVKRALECLHVYKHMMEVMQVTRCIAVATAAARSASDGTQFIERIREETG
                     IEIEIISGEREAYLGYLGVVNTIDAKDFIQFDLGGASIEVSLVLNRKIKESVSVPLGA
                     VTMTDKFGMQDIVTQGVLDKCIKHVEKKFREMIPWAKDRRLPVIGIGGTVRNLAKMDQ
                     YKTSYQLARIHNYIIPRERFEPCYQAIIKSSCTNRRKFGGLSTERADIIVAGATIARC
                     LMEFSGGKDLIVSGCGLRDGVFYEYYGKKYGAGSPVVKDVLKASVENYLKRVERRMEH
                     LGRVHDLALSLFDQLRRLHGAPKRSRDLLSVAAWLHDAGKIVNYYEHARNSAFIINNA
                     PLYGMTQKEQLKASFIAGFHHGISNKIMRSYRYAMMVTQPEWKEIRKLATLLALAEAA
                     DVTYEGLVTGFEAAATSEGVALSVIAAPDADTRATDFEMQSFCKQFKKEFGRPLVIVW
                     RK"
     misc_feature    24732..25634
                     /locus_tag="Selsp_0028"
                     /note="Ppx/GppA phosphatase family; Region: Ppx-GppA;
                     cl19483"
                     /db_xref="CDD:267836"
     misc_feature    24735..25967
                     /locus_tag="Selsp_0028"
                     /note="Exopolyphosphatase [Nucleotide transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: GppA; COG0248"
                     /db_xref="CDD:223326"
     misc_feature    25722..>25967
                     /locus_tag="Selsp_0028"
                     /note="CRISPR/Cas system-associated protein Cas3'';
                     Region: Cas3''_I; cl17503"
                     /db_xref="CDD:266734"
     gene            26384..27310
                     /locus_tag="Selsp_0029"
                     /db_xref="GeneID:10496231"
     CDS             26384..27310
                     /locus_tag="Selsp_0029"
                     /note="COGs: COG0739 Membrane protein related to
                     metalloendopeptidase;
                     InterPro IPR016047;
                     KEGG: pca:Pcar_2324 metalloendopeptidase-like membrane
                     protein;
                     PFAM: Peptidase M23;
                     SPTR: Peptidase, M23/M37 family;
                     IMG reference gene:2504585480;
                     PFAM: Peptidase family M23"
                     /codon_start=1
                     /transl_table=11
                     /product="Peptidase M23"
                     /protein_id="YP_004412473.1"
                     /db_xref="GI:330837893"
                     /db_xref="InterPro:IPR002886"
                     /db_xref="InterPro:IPR011055"
                     /db_xref="InterPro:IPR016047"
                     /db_xref="GeneID:10496231"
                     /translation="MNTKGKKPDKREYTLKVIPHQGETVRSYSFSVRRLKLLACALAA
                     LAVVLLAGFGYMSYSLWSGAADAKAETPAETGRQAELKELAQEAQNLQSEMEKLTERE
                     KTLRRLLDEGAADESAKHTGQGGPAVPAEVSQVRRALDAVSRGLPERRESLAKLEARY
                     EKQREEAAARAAEKDKMARTSVPGNVPSGWPTSGDISSPFGWRWNGTDFHPGIDIAND
                     MGTPIVATADGVVTTAGWNGGGYGNMVDIDHGNGILTRYGHASEVVVHEGQHVKRGEV
                     IAYMGSTGFSTGPHVHYEIHVNGETVNPASYL"
     misc_feature    <26588..26980
                     /locus_tag="Selsp_0029"
                     /note="ZW10 interactor; Region: Zwint; pfam15556"
                     /db_xref="CDD:259687"
     misc_feature    <26951..27307
                     /locus_tag="Selsp_0029"
                     /note="Membrane proteins related to metalloendopeptidases
                     [Cell envelope biogenesis, outer membrane]; Region: NlpD;
                     COG0739"
                     /db_xref="CDD:223810"
     misc_feature    27008..27295
                     /locus_tag="Selsp_0029"
                     /note="Peptidase family M23; Region: Peptidase_M23;
                     pfam01551"
                     /db_xref="CDD:250701"
     gene            27325..27825
                     /locus_tag="Selsp_0030"
                     /db_xref="GeneID:10496232"
     CDS             27325..27825
                     /locus_tag="Selsp_0030"
                     /note="COGs: COG1664 Integral membrane protein CcmA
                     involved in cell shape determination;
                     InterPro IPR007607;
                     KEGG: aar:Acear_2337 protein of unknown function DUF583;
                     PFAM: Protein of unknown function DUF583;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585481;
                     PFAM: Protein of unknown function, DUF583"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412474.1"
                     /db_xref="GI:330837894"
                     /db_xref="InterPro:IPR007607"
                     /db_xref="GeneID:10496232"
                     /translation="MFGVMKRRDDSSVSGDIETIIGKNTKIHGEISGTGNLRIDGEIE
                     GELKLSGSVIVGETGMVTGNVSARSLDISGTVHGNAQTEEGLTIHSAGQLIGDVKVNA
                     FQIEDGGIFKGRSEMNPRAGIELKVRPQPAARPPQEQVISTDASAKSPSKMAAQLKPP
                     TKAEKK"
     misc_feature    27373..27675
                     /locus_tag="Selsp_0030"
                     /note="Polymer-forming cytoskeletal; Region: Bactofilin;
                     pfam04519"
                     /db_xref="CDD:252647"
     gene            complement(27941..28567)
                     /locus_tag="Selsp_0031"
                     /db_xref="GeneID:10496233"
     CDS             complement(27941..28567)
                     /locus_tag="Selsp_0031"
                     /note="KEGG: dhd:Dhaf_2399 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585482"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412475.1"
                     /db_xref="GI:330837895"
                     /db_xref="GeneID:10496233"
                     /translation="MKTPLHYQISEYDCGPTSMLNAMSFLFSREELPPEILRNTMLYC
                     LDCYGKEGHPGKSGTSCMAMMFLSNWLDGLGKAGLLPVSSRYLRGEEVFIGEGSRLND
                     TLCRKGVAVVRLWFEVEHYVLMTGVEDEEILLFDPYYQEEAFEGAESPVRIDLAHPLW
                     YNRRVPFSFFNRETQELYALGKKEAREAVLLFNDTTKLTAEKSIEYFI"
     gene            complement(28833..28976)
                     /locus_tag="Selsp_0032"
                     /pseudo
                     /db_xref="GeneID:10496234"
     gene            29024..29668
                     /locus_tag="Selsp_0033"
                     /db_xref="GeneID:10496235"
     CDS             29024..29668
                     /locus_tag="Selsp_0033"
                     /EC_number="4.1.2.4"
                     /note="COGs: COG0274 Deoxyribose-phosphate aldolase;
                     InterPro IPR002915:IPR011343;
                     KEGG: afl:Aflv_2780 deoxyribose-phosphate aldolase;
                     PFAM: Deoxyribose-phosphate
                     aldolase/phospho-2-dehydro-3-deoxyheptonate aldolase;
                     PRIAM: Deoxyribose-phosphate aldolase;
                     SPTR: Deoxyribose-phosphate aldolase;
                     TIGRFAM: Deoxyribose-phosphate aldolase;
                     IMG reference gene:2504585484;
                     PFAM: DeoC/LacD family aldolase;
                     TIGRFAM: deoxyribose-phosphate aldolase"
                     /codon_start=1
                     /transl_table=11
                     /product="deoxyribose-phosphate aldolase"
                     /protein_id="YP_004412476.1"
                     /db_xref="GI:330837896"
                     /db_xref="InterPro:IPR002915"
                     /db_xref="InterPro:IPR011343"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:10496235"
                     /translation="MELAKYIDHTLLKTDAQRADVAKLIEEAKAYHFASVCVSPIWVS
                     YVSDALRGSGVKTCTVIGFPQGAMPSAVKAFETKQAVADGADEVDMVIAIGRLKDGDD
                     AYVKADIEAVVRAARGKALTKVIIETCLLTDEEKRRACLLAKEAGADFVKTSTGFAAG
                     GATAADVRLMRESVGEAMGVKAAGGIRSRADAEAMLAAGATRLGTSSGVKIVEG"
     misc_feature    29030..29641
                     /locus_tag="Selsp_0033"
                     /note="2-deoxyribose-5-phosphate aldolase (DERA) of the
                     DeoC family; Region: DeoC; cd00959"
                     /db_xref="CDD:188646"
     misc_feature    order(29057..29059,29063..29065,29069..29071,29141..29149,
                     29210..29212,29234..29236,29249..29251,29264..29275,
                     29300..29302,29306..29308,29363..29368,29411..29413)
                     /locus_tag="Selsp_0033"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:188646"
     misc_feature    order(29477..29479,29486..29488,29570..29578,29633..29641)
                     /locus_tag="Selsp_0033"
                     /note="active site"
                     /db_xref="CDD:188646"
     misc_feature    29477..29479
                     /locus_tag="Selsp_0033"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188646"
     gene            complement(29793..31274)
                     /locus_tag="Selsp_0034"
                     /db_xref="GeneID:10496236"
     CDS             complement(29793..31274)
                     /locus_tag="Selsp_0034"
                     /note="COGs: COG1807 4-amino-4-deoxy-L-arabinose
                     transferase and related glycosyltransferase of PMT family;
                     InterPro IPR003342;
                     KEGG: afn:Acfer_0165 glycosyl transferase family 39;
                     PFAM: Glycosyl transferase, family 39;
                     SPTR: Putative cell division ATP-binding protein FtsE;
                     IMG reference gene:2504585485;
                     PFAM: Dolichyl-phosphate-mannose-protein
                     mannosyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 39"
                     /protein_id="YP_004412477.1"
                     /db_xref="GI:330837897"
                     /db_xref="InterPro:IPR003342"
                     /db_xref="GeneID:10496236"
                     /translation="MVKREKREFLLLLIFGAIILLAANGSLAITDPVESNYALTAKEM
                     VASGDYLSPRIFGNYWYDKPAFFYWEMIASCLIFGVNEFALRFPSAFMGLLSLALLYF
                     FARRLYGHRTALLAGGLFASSVGFWYVGKAIITDMTLFFFMSATLVSFYLGYDSGKRV
                     RYYAAFFFAGLAVLTKGPIGFLLPGLLLAVYLVLRKDAKELLRLRWGGGMILFLLVGG
                     SWYYAMYSLHGADFLGTFFGTHNFLRATVSEHPGQNVWYYYILLFLASFFPWSLPLVW
                     CMAKKIWQEKGVALRRAFAEKDTLFLLVWALGTILVYQCMATKYPTYTFPSLFPIAIL
                     AARLLGSFDGKRMSLFIAAFGIFYLTLFVLVAVPMCRERGGAPAAALVHDLPAHIPVM
                     SYREHTYSVGCTFYSDKAIYLLTTREDVERNAPKPGTWTATNIMPFYAIEDLSALSEF
                     YVLCPKETPVKADFAAHTNLEGRKFTLCDSNEKDELWHISSVK"
     misc_feature    complement(<30120..31274)
                     /locus_tag="Selsp_0034"
                     /note="4-amino-4-deoxy-L-arabinose transferase and related
                     glycosyltransferases of PMT family [Cell envelope
                     biogenesis, outer membrane]; Region: ArnT; COG1807"
                     /db_xref="CDD:224720"
     misc_feature    complement(<30264..31274)
                     /locus_tag="Selsp_0034"
                     /note="Dolichyl-phosphate-mannose-protein
                     mannosyltransferase; Region: PMT_2; cl19158"
                     /db_xref="CDD:267511"
     gene            complement(31365..31901)
                     /locus_tag="Selsp_0035"
                     /db_xref="GeneID:10496237"
     CDS             complement(31365..31901)
                     /locus_tag="Selsp_0035"
                     /note="COGs: COG0778 Nitroreductase;
                     InterPro IPR000415;
                     KEGG: fnu:FN1223 dihydropteridine reductase;
                     PFAM: Nitroreductase-like;
                     SPTR: Oxygen-insensitive NAD(P)H nitroreductase;
                     IMG reference gene:2504585486;
                     PFAM: Nitroreductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="YP_004412478.1"
                     /db_xref="GI:330837898"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="GeneID:10496237"
                     /translation="MNEVMETIKKRRSVRAFLPTMPPADIVRDIVEAGLYAPRSMGSE
                     SIRTIVITDKVMREKLVELNCQIGHWKKGFDPFYGAPVILLVIADKDDVNYLCNGSIA
                     IATMMLAAESLDIHTCWIHRAKEELEQPLGQEILSRAGIFFRPGQYVGIGHLALGYAA
                     GDVPDPKPRNESRISYIS"
     misc_feature    complement(31428..31880)
                     /locus_tag="Selsp_0035"
                     /note="Proteins of this family catalyze the reduction of
                     flavin or nitrocompounds using NAD(P)H as electron donor
                     in a obligatory two-electron transfer,  utilizing FMN or
                     FAD as cofactor. They are often found to be homodimers.
                     Enzymes of this family are...; Region:
                     Nitro_FMN_reductase; cd02062"
                     /db_xref="CDD:239015"
     misc_feature    complement(order(31536..31541,31779..31781,31857..31859,
                     31863..31865,31869..31871))
                     /locus_tag="Selsp_0035"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239015"
     misc_feature    complement(order(31578..31580,31587..31592,31599..31604,
                     31608..31610))
                     /locus_tag="Selsp_0035"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239015"
     gene            32192..33025
                     /locus_tag="Selsp_0036"
                     /db_xref="GeneID:10496238"
     CDS             32192..33025
                     /locus_tag="Selsp_0036"
                     /note="COGs: COG1596 Periplasmic protein involved in
                     polysaccharide export;
                     InterPro IPR003715:IPR019554;
                     KEGG: afn:Acfer_0563 polysaccharide export protein;
                     PFAM: Polysaccharide export protein; Soluble ligand
                     binding domain;
                     SPTR: Putative polysaccharide export protein;
                     IMG reference gene:2504585487;
                     PFAM: Polysaccharide biosynthesis/export protein; SLBB
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide export protein"
                     /protein_id="YP_004412479.1"
                     /db_xref="GI:330837899"
                     /db_xref="InterPro:IPR003715"
                     /db_xref="InterPro:IPR019554"
                     /db_xref="GeneID:10496238"
                     /translation="MKKRSMLAAAVVLALSSSAAFSAPSAQDAAVEAASAGSVAREAS
                     SVQSHAQNAARAQEKATKKQAPMQNYVEAPEEFEIASLRRAETTPNYRLFKGDTFNVL
                     VIGFPDGIGVNNITVGIDGYVQLPYVGSVKMEGMTLDEAKEVLMESLGEYLRIPDMSL
                     LITSYGPRKVYVMGNVASPGIHDLSIDRMNAYAALASAGGWTDRARSTRIQVIRVRDN
                     VMYYRTLNMKDYTKKHDLTQNVVLEDGDIVYVPASNGIKFTEDVLPYVNAWALYRSLT
                     K"
     misc_feature    32429..32683
                     /locus_tag="Selsp_0036"
                     /note="Polysaccharide biosynthesis/export protein; Region:
                     Poly_export; pfam02563"
                     /db_xref="CDD:251377"
     misc_feature    32462..32950
                     /locus_tag="Selsp_0036"
                     /note="putative polysaccharide export protein, PEP-CTERM
                     sytem-associated; Region: pepcterm_export; TIGR03027"
                     /db_xref="CDD:132072"
     misc_feature    32696..>32836
                     /locus_tag="Selsp_0036"
                     /note="SLBB domain; Region: SLBB; pfam10531"
                     /db_xref="CDD:256045"
     gene            33051..34388
                     /locus_tag="Selsp_0037"
                     /db_xref="GeneID:10496239"
     CDS             33051..34388
                     /locus_tag="Selsp_0037"
                     /note="COGs: COG3206 Uncharacterized protein involved in
                     exopolysaccharide biosynthesis;
                     InterPro IPR003856;
                     KEGG: vpr:Vpar_0670 lipopolysaccharide biosynthesis
                     protein;
                     PFAM: Lipopolysaccharide biosynthesis;
                     SPTR: Putative chain length determinant protein;
                     IMG reference gene:2504585488;
                     PFAM: Chain length determinant protein"
                     /codon_start=1
                     /transl_table=11
                     /product="lipopolysaccharide biosynthesis protein"
                     /protein_id="YP_004412480.1"
                     /db_xref="GI:330837900"
                     /db_xref="InterPro:IPR003856"
                     /db_xref="GeneID:10496239"
                     /translation="MEQNEGMIDLSKLFQIMGARWKAMVTLVLICTLAALVLAFVLPK
                     QYESTTLVQTRNAGKVDASGAAAAMAILGVGGGTSSPTMNYIELMKTRTVLDPIIDSM
                     DFDDDKKPDAKSFAKQRLDVRNTKGTNLIEVAARGKTPEEAQRISQSVVDNFLLMQTD
                     MNQETQSLLVKFLEKRIAESKQESEEAEERLAKFSKEHKIYSPDDQVKAAIEQLAVFD
                     KAIGEVEVAQKSAQAELDTAEAKLVEQKMESKAYRVSDNAIVQKIRDQIVAKQVEIVG
                     LEERYTEKHPSVQQARNELRQLQGSLDAEVVASVDSNAATLNPAHSEVLKKQALAAVN
                     LAVAEAGERKLKEQREKKESEIGKLPDDVLEYMRLEREVKIKSEVYLNLVKQSEQSKI
                     QEAMESMDIQIVDRANLPDKPVAPRKILIVAMGFVIGVFLAVGYGLLLSRREA"
     misc_feature    33072..34382
                     /locus_tag="Selsp_0037"
                     /note="Uncharacterized protein involved in
                     exopolysaccharide biosynthesis [Cell envelope biogenesis,
                     outer membrane]; Region: GumC; COG3206"
                     /db_xref="CDD:225747"
     misc_feature    33072..33509
                     /locus_tag="Selsp_0037"
                     /note="Chain length determinant protein; Region: Wzz;
                     pfam02706"
                     /db_xref="CDD:251487"
     misc_feature    34143..34367
                     /locus_tag="Selsp_0037"
                     /note="G-rich domain on putative tyrosine kinase; Region:
                     GNVR; pfam13807"
                     /db_xref="CDD:258087"
     gene            34432..35871
                     /locus_tag="Selsp_0038"
                     /db_xref="GeneID:10496240"
     CDS             34432..35871
                     /locus_tag="Selsp_0038"
                     /EC_number="2.7.8.6"
                     /note="COGs: COG2148 Sugar transferase involved in
                     lipopolysaccharide synthesis;
                     InterPro IPR003362:IPR017475:IPR017472;
                     KEGG: vpr:Vpar_0021 exopolysaccharide biosynthesis
                     polyprenyl glycosylphosphotransferase;
                     PFAM: Bacterial sugar transferase;
                     PRIAM: Undecaprenyl-phosphate galactose
                     phosphotransferase;
                     SPTR: Undecaprenyl-phosphate galactose phosphotransferase;
                     TIGRFAM: Undecaprenyl-phosphate galactose
                     phosphotransferase, WbaP; Exopolysaccharide biosynthesis
                     polyprenyl glycosylphosphotransferase;
                     IMG reference gene:2504585489;
                     PFAM: Bacterial sugar transferase;
                     TIGRFAM: exopolysaccharide biosynthesis polyprenyl
                     glycosylphosphotransferase; Undecaprenyl-phosphate
                     galactose phosphotransferase, WbaP"
                     /codon_start=1
                     /transl_table=11
                     /product="Undecaprenyl-phosphate galactose
                     phosphotransferase, WbaP"
                     /protein_id="YP_004412481.1"
                     /db_xref="GI:330837901"
                     /db_xref="InterPro:IPR003362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017472"
                     /db_xref="InterPro:IPR017475"
                     /db_xref="GeneID:10496240"
                     /translation="MDVRLKIPVEIRRLCAPLVFLVFDYLAILLAEQLAFGLHDLYGA
                     SVGESYHIAETYVFLWIPLVFLAFLGITQTYTKMQPILETVRQIFYAVLYALITCLIV
                     LYFIQASVLASRLYVVAFACLAIFNLYIERYVLLKIFKMTRSLMKPVLLIGAGKTAEQ
                     ILRCFERDLGYRYEVVGILDDNPISKMLSQKFLLLGKIEDAAMVLKNFGIKTIIIAAP
                     GMKKKKLQELLDSIQPYVRDISFVPDLVGMPLYNVEAQTLFNEQVMLLSLRNNLARRR
                     NRWYKRIFDLVFGGLMCIPVLPILFLLALCVRFDSKGTVFFNAERIGKDGKVFTCYKF
                     RSMYMDSDRILQEYLAARPEARTEWDTFAKLREYDPRVTRVGAWMRKYSLDELPQILN
                     VIKGDMSLVGPRPYLPREQGDIGEHLLTITSTVPGITGYWQTSGRNDVSFAGRVAMDV
                     WYVRNWSIWLDLMYLFKTVKIVLTRKGAY"
     misc_feature    34501..35868
                     /locus_tag="Selsp_0038"
                     /note="Undecaprenyl-phosphate galactose
                     phosphotransferase, WbaP; Region: WbaP_sugtrans;
                     TIGR03022"
                     /db_xref="CDD:234091"
     misc_feature    34633..35160
                     /locus_tag="Selsp_0038"
                     /note="CoA binding domain; Region: CoA_binding; cl17356"
                     /db_xref="CDD:266646"
     misc_feature    35272..35868
                     /locus_tag="Selsp_0038"
                     /note="Bacterial sugar transferase; Region: Bac_transf;
                     pfam02397"
                     /db_xref="CDD:251270"
     gene            35872..36783
                     /locus_tag="Selsp_0039"
                     /db_xref="GeneID:10496241"
     CDS             35872..36783
                     /locus_tag="Selsp_0039"
                     /note="COGs: COG1215 Glycosyltransferase probably involved
                     in cell wall biogenesis;
                     InterPro IPR001173;
                     KEGG: hya:HY04AAS1_1578 glycosyl transferase family 2;
                     PFAM: Glycosyl transferase, family 2;
                     SPTR: Glycosyl transferase, group 2 family;
                     manually curated;
                     IMG reference gene:2504585490;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="YP_004412482.1"
                     /db_xref="GI:330837902"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:10496241"
                     /translation="MEIQVIIPVYRPDARFLQLLCMIKIQSLKNLPVLLIDSGKGMSY
                     AEEIKGMNVKVRKINIEEFNHGGTRQWGMDLCSGADIYVFLTQDAVFFDEYAVENLVA
                     AFTDDYVGCAYGRQVPHRGSGVFGAFARKFNYPLESHIYAIEDKRRYGIKTVFISNSF
                     AAYRKEAIQQVHGFPKHTILSEDMCVAAKMLLQGWKIAYVANAAVYHSHDYTIFQEFK
                     RYFDIGVFHAREPWIQQKFGKAEGEGKRFIMTEFRYVLKRCPYRFFEMILRDGMKFLG
                     YRLGRNEKYLKNKWKMKLSMSPRYWDV"
     misc_feature    35872..36717
                     /locus_tag="Selsp_0039"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    35884..36384
                     /locus_tag="Selsp_0039"
                     /note="Glycosyl transferase family 2; Region:
                     Glycos_transf_2; pfam00535"
                     /db_xref="CDD:249939"
     misc_feature    order(35893..35895,35899..35901,35977..35979,36127..36129,
                     36133..36135)
                     /locus_tag="Selsp_0039"
                     /note="active site"
                     /db_xref="CDD:132997"
     misc_feature    <36355..36570
                     /locus_tag="Selsp_0039"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     gene            36814..38205
                     /locus_tag="Selsp_0040"
                     /db_xref="GeneID:10496242"
     CDS             36814..38205
                     /locus_tag="Selsp_0040"
                     /note="InterPro IPR007016;
                     KEGG: cno:NT01CX_1531 hypothetical protein;
                     PFAM: O-antigen ligase-related;
                     SPTR: O-antigen polymerase family protein;
                     IMG reference gene:2504585491;
                     PFAM: O-Antigen ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="O-antigen polymerase"
                     /protein_id="YP_004412483.1"
                     /db_xref="GI:330837903"
                     /db_xref="InterPro:IPR007016"
                     /db_xref="GeneID:10496242"
                     /translation="MKGSFKLIHRYLIAIAIVLLPVFNSLGTDKLGALGRSASTYPLL
                     LGVIVWLGTLVLQRGKVYYPRNLGFFFLLMFLLTAVLSGLFNLPDLYVLKYQGISGID
                     RFFIQIFALLFYVFIVIYIYNAFYHAGKEAERLFVTALSLSFFLAGGYSLFEIGAFLN
                     VPFSTEILGYIDTLFRANEELYGLRLRSLANEASMFAMYCTLIFPWIFSRFFRNRRSF
                     GDIIIVSYFILLMGLTFSRTAYIVFIIQLIVFFILYRKEIFSVGMHGAVYFFAIIGIL
                     TFGAISIYFSNMELFEKIDVTALVYSLVSDDVDNPHLLSNIARYSSQIAAIRMFFDHP
                     VLGVGLGGFGFYAPQYYPDSLGESWEIIAQSSNTIGGAWPVAHGLYVRILAEMGILGL
                     VFWLFLWGWNIFKSFASLRNLAREQIQYKKNLLISLIGMLLIGFVGDSLTWASYWIYL
                     GFLGIEESNGCRE"
     misc_feature    37477..38001
                     /locus_tag="Selsp_0040"
                     /note="O-Antigen ligase; Region: Wzy_C; pfam04932"
                     /db_xref="CDD:252887"
     gene            38210..39421
                     /locus_tag="Selsp_0041"
                     /db_xref="GeneID:10496243"
     CDS             38210..39421
                     /locus_tag="Selsp_0041"
                     /note="COGs: COG0438 Glycosyltransferase;
                     InterPro IPR001296;
                     KEGG: mpo:Mpop_2183 glycosyl transferase group 1;
                     PFAM: Glycosyl transferase, group 1;
                     SPTR: Lipopolysaccharide N-acetylglucosaminyltransferase;
                     IMG reference gene:2504585492;
                     PFAM: Glycosyl transferases group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase group 1"
                     /protein_id="YP_004412484.1"
                     /db_xref="GI:330837904"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:10496243"
                     /translation="MRVFILNDFAYVNGGASQIALNTALSLARKGIHTCLFTGMGPIS
                     PKLVEQERLKVICLEQYDILSDPSRFRAICQGLWNRKAARCLSEILQQYSPCDTIVHV
                     HGCQKVLSTSCIYAAKKLGFKIIYHLHDYGIACPNLGFYNYQRNQICRYVPLSADCIF
                     SHCDSRRYLHKVWRLMRQVIQKKWGGLPGYVDAFLSVSTFSQNILQSFLPHGSLIKVL
                     PNPHETCRHSLIDVKENKFFLFLGRLSAEKNPIEFAECVRDLDLPALFVGDGEYLDKV
                     KKTYPQAVFTGWLEKENLYEYIKQARCLVFPSSWYETQGLSVQEMASWGIPAIVSDVC
                     AAKEMIVHGVNGWIYESGNKDSLKKYLLKMTDDLKVRDMGKQSYELVKKIGISEEKYI
                     EELLIFYQKTL"
     misc_feature    38210..39418
                     /locus_tag="Selsp_0041"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     misc_feature    38219..39409
                     /locus_tag="Selsp_0041"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            39454..40542
                     /locus_tag="Selsp_0042"
                     /db_xref="GeneID:10496244"
     CDS             39454..40542
                     /locus_tag="Selsp_0042"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585493"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412485.1"
                     /db_xref="GI:330837905"
                     /db_xref="GeneID:10496244"
                     /translation="MNPIWCKKRIRDKVKVILQEHKRIACLLHFIRYGRDEAYLDSIL
                     KINHDPNVLELREYGSANADKNIFYIEFGGETGIGGTLRTTLHALYEADRLGFTPVVY
                     YKSKYLSMTSSLHEVENAFGYYFCQVSDISVEEVLRSQRVFLFRPAHLERIERDLGNL
                     NPELVVGYRVTDDYLKTMANVMHKYIRFNEETERYFEKSMGKLFQTRSHLDRVLAVHI
                     RGTDFALHWNNHPNMLMPEDYFSEIDVLLEREFEYIFLATDDSRRLESFLKRYDKKVL
                     YYEDTYRSSGNINIIHEKNARENAPFLNGLEALRDMYTLSRCGGFLSGCSQISIMTRI
                     LRLSTGRDFSYVKTLDRGIYKSDVISGT"
     misc_feature    39961..40476
                     /locus_tag="Selsp_0042"
                     /note="GDP-fucose protein O-fucosyltransferase and related
                     proteins; Region: O-FucT_like; cd11296"
                     /db_xref="CDD:211383"
     misc_feature    order(40102..40104,40108..40110,40222..40230,40375..40377,
                     40429..40437)
                     /locus_tag="Selsp_0042"
                     /note="GDP-Fucose binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:211383"
     gene            40576..41652
                     /locus_tag="Selsp_0043"
                     /db_xref="GeneID:10496245"
     CDS             40576..41652
                     /locus_tag="Selsp_0043"
                     /note="COGs: COG0438 Glycosyltransferase;
                     InterPro IPR001296;
                     KEGG: dae:Dtox_2838 glycosyl transferase group 1;
                     PFAM: Glycosyl transferase, group 1;
                     SPTR: Mannosyltransferase;
                     IMG reference gene:2504585494;
                     PFAM: Glycosyl transferases group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase group 1"
                     /protein_id="YP_004412486.1"
                     /db_xref="GI:330837906"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:10496245"
                     /translation="MNILYDSQIFFQQRYGGISRYFYELIRNMIKEESILLHEGVNIN
                     AYGLRNLCAYKKFWGYHIKRNYRLRALISKINAFHFRYFIRNENVDIYHPTYYTDYEV
                     HGAKKVVTVYDMIHELFPQDFLGDRTAEEKAKILRNADGIIAISESTKKDLMRLLDIS
                     AEKIRVIYLANSLSESVQDVPVMKGPYLLYVGNRSGYKNFMGLAQAFAGSQYKNDVQL
                     VCFGGGEFTKSERESLIRMGIWERTVYCSGGDDVLSNLYQFASAFVYPSIYEGFGLPL
                     LEAMHHGTLVLTGATSSIPEVAGDAAEYFNPNEPESIREVMDRLLSDSDRRQELRARG
                     RAREKMFSWQRCAEETLDFYRVLR"
     misc_feature    40579..41631
                     /locus_tag="Selsp_0043"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. mtfB (mannosyltransferase
                     B) in E. coli has been shown to direct the growth of the
                     O9-specific polysaccharide chain. It transfers two
                     mannoses into the position 3 of the...; Region:
                     GT1_mtfB_like; cd03809"
                     /db_xref="CDD:99981"
     misc_feature    40615..41649
                     /locus_tag="Selsp_0043"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            41667..42650
                     /locus_tag="Selsp_0044"
                     /db_xref="GeneID:10496246"
     CDS             41667..42650
                     /locus_tag="Selsp_0044"
                     /EC_number="4.2.1.47"
                     /note="COGs: COG1089 GDP-D-mannose dehydratase;
                     InterPro IPR001509;
                     KEGG: gur:Gura_3780 NAD-dependent epimerase/dehydratase;
                     PFAM: NAD-dependent epimerase/dehydratase;
                     PRIAM: GDP-mannose 4,6-dehydratase;
                     SPTR: GDP-mannose 4,6-dehydratase;
                     IMG reference gene:2504585495;
                     PFAM: NAD dependent epimerase/dehydratase family;
                     TIGRFAM: GDP-mannose 4,6-dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="YP_004412487.1"
                     /db_xref="GI:330837907"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR006368"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496246"
                     /translation="MKTALITGINGQDGSYLAEYLLDRGYEVYGVVRRSSIENAEKMR
                     NVLPFLNRIRVVPCALENALSVYKLFVQVRPDECYHLAASSFVSYALEDDLSIMMNNF
                     TTTHNILSSIVETCPSCRMYFAGSSEIFGNVKEAPQSEETAYNPRSVYGISKMAGHSL
                     IKNYRERYNVYACTGFTYNHESPRRGYNFVTRKITSFVAGIILGAENKLELGNLDAVR
                     DWGYAPEYVEAMHKMLQQDMPKDYVIATGALHSVRELLEIAFGKVGLDYQEYIHVNEA
                     FLRPEGAIPLVGNASAIYQDLGWRAKKGIEEIISDMVETDIQILKKRNEKR"
     misc_feature    41667..42635
                     /locus_tag="Selsp_0044"
                     /note="GDP-D-mannose dehydratase [Cell envelope
                     biogenesis, outer membrane]; Region: Gmd; COG1089"
                     /db_xref="CDD:224014"
     misc_feature    41673..42620
                     /locus_tag="Selsp_0044"
                     /note="GDP-mannose 4,6 dehydratase, extended (e) SDRs;
                     Region: GDP_MD_SDR_e; cd05260"
                     /db_xref="CDD:187570"
     misc_feature    order(41688..41705,41763..41771,41838..41846,41907..41915,
                     41919..41921,41964..41966,42036..42044,42114..42116,
                     42126..42128,42195..42209)
                     /locus_tag="Selsp_0044"
                     /note="NADP-binding site; other site"
                     /db_xref="CDD:187570"
     misc_feature    order(41694..41699,41763..41780,41787..41792,41835..41843,
                     41847..41861,41865..41873,41877..41879,41913..41924,
                     41931..41933,41937..41948,41958..41963,41973..41975,
                     41982..41987,41994..41996,42003..42008,42093..42104,
                     42108..42113,42120..42125,42129..42134,42141..42146,
                     42150..42158,42162..42170,42228..42233,42504..42509)
                     /locus_tag="Selsp_0044"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(41919..41927,42042..42050,42114..42116,42201..42203,
                     42228..42236,42243..42245,42294..42305,42312..42314,
                     42318..42320,42420..42422,42495..42497,42501..42503,
                     42510..42515)
                     /locus_tag="Selsp_0044"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(41937..41939,41946..41948,41958..41963,41970..41975,
                     41982..41987,41994..41996,42093..42104,42108..42113,
                     42120..42125,42129..42134,42141..42146,42150..42158,
                     42162..42170,42504..42509)
                     /locus_tag="Selsp_0044"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(41967..41969,42042..42044,42114..42116,42126..42128)
                     /locus_tag="Selsp_0044"
                     /note="active site"
                     /db_xref="CDD:187570"
     gene            42655..43689
                     /locus_tag="Selsp_0045"
                     /db_xref="GeneID:10496247"
     CDS             42655..43689
                     /locus_tag="Selsp_0045"
                     /EC_number="4.2.1.47"
                     /note="COGs: COG1089 GDP-D-mannose dehydratase;
                     InterPro IPR001509:IPR006368;
                     KEGG: cac:CA_C2180 GDP-D-mannose dehydratase;
                     PFAM: NAD-dependent epimerase/dehydratase;
                     PRIAM: GDP-mannose 4,6-dehydratase;
                     SPTR: GDP-mannose 4,6-dehydratase;
                     TIGRFAM: GDP-mannose 4,6-dehydratase;
                     IMG reference gene:2504585496;
                     PFAM: NAD dependent epimerase/dehydratase family;
                     TIGRFAM: GDP-mannose 4,6-dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-mannose 4,6-dehydratase"
                     /protein_id="YP_004412488.1"
                     /db_xref="GI:330837908"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR006368"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496247"
                     /translation="MKKALVTGITGQDGSYLAELLLEKGYEVHGMIRRHSTPCTERID
                     HICISDLMDEKFFLHYGDLTDSCNLLSLLGQIRPDEVYNLGAQSHVAVSFEVPEYTAD
                     ATGVGTIRLLEAIRQSGIQCKFYQASTSELFGGLPNTAPQSERTPFYPKSPYGAAKLY
                     SYWITVNYRESYGLFACNGILFNHESPRRGETFVTRKITVAVANIMAGKQEKLSLGNL
                     DAKRDWGFAGDYVEGMWRILQQEKPSDYVLATNETHTVREFVELAFGEVGVKLEWKGF
                     GVDEKGICTKTGKILVDVNPQYFRPAEVDLLWGDPTKAEKELGWRRKVGFKDLVSMMV
                     RADMQLYGKG"
     misc_feature    42655..43668
                     /locus_tag="Selsp_0045"
                     /note="GDP-D-mannose dehydratase [Cell envelope
                     biogenesis, outer membrane]; Region: Gmd; COG1089"
                     /db_xref="CDD:224014"
     misc_feature    42661..43671
                     /locus_tag="Selsp_0045"
                     /note="GDP-mannose 4,6 dehydratase, extended (e) SDRs;
                     Region: GDP_MD_SDR_e; cd05260"
                     /db_xref="CDD:187570"
     misc_feature    order(42676..42693,42751..42759,42835..42843,42904..42912,
                     42916..42918,42961..42963,43033..43041,43114..43116,
                     43126..43128,43195..43209)
                     /locus_tag="Selsp_0045"
                     /note="NADP-binding site; other site"
                     /db_xref="CDD:187570"
     misc_feature    order(42682..42687,42751..42768,42775..42780,42832..42840,
                     42844..42858,42862..42870,42874..42876,42910..42921,
                     42928..42930,42934..42945,42955..42960,42970..42972,
                     42979..42984,42991..42993,43000..43005,43093..43104,
                     43108..43113,43120..43125,43129..43134,43141..43146,
                     43150..43158,43162..43170,43228..43233,43555..43560)
                     /locus_tag="Selsp_0045"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(42916..42924,43039..43047,43114..43116,43201..43203,
                     43228..43236,43243..43245,43294..43305,43312..43314,
                     43318..43320,43420..43422,43546..43548,43552..43554,
                     43561..43566)
                     /locus_tag="Selsp_0045"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(42934..42936,42943..42945,42955..42960,42967..42972,
                     42979..42984,42991..42993,43093..43104,43108..43113,
                     43120..43125,43129..43134,43141..43146,43150..43158,
                     43162..43170,43555..43560)
                     /locus_tag="Selsp_0045"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187570"
     misc_feature    order(42964..42966,43039..43041,43114..43116,43126..43128)
                     /locus_tag="Selsp_0045"
                     /note="active site"
                     /db_xref="CDD:187570"
     gene            43694..44635
                     /locus_tag="Selsp_0046"
                     /db_xref="GeneID:10496248"
     CDS             43694..44635
                     /locus_tag="Selsp_0046"
                     /EC_number="1.1.1.271"
                     /note="COGs: COG0451 Nucleoside-diphosphate-sugar
                     epimerase;
                     InterPro IPR001509;
                     KEGG: bpb:bpr_I2578 NAD-dependent epimerase/dehydratase;
                     PFAM: NAD-dependent epimerase/dehydratase;
                     PRIAM: GDP-L-fucose synthase;
                     SPTR: GDP-L-fucose synthase;
                     manually curated;
                     IMG reference gene:2504585497;
                     PFAM: NAD dependent epimerase/dehydratase family"
                     /codon_start=1
                     /transl_table=11
                     /product="GDP-L-fucose synthase"
                     /protein_id="YP_004412489.1"
                     /db_xref="GI:330837909"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496248"
                     /translation="MEKSAKIYVAGHRGMVGSAIMRKLKADGYENLLLRSSKELDLTR
                     QDDVEKFFAEENPEYVFLAAAKVGGILANSRYPADFMYDNMMMEMNVIHAAYHNGVKK
                     LLFLGSSCIYPRLATQPMKESVLLTGALEETNEAYALAKISGLKYCEYLNRQCGTDYI
                     SVMPTNLYGPNDNYHAENSHVLPALIRRFYEAKEKNLPIVEIWGTGTPKREFLYVDDL
                     ADACVFLMQEYTGNETINIGTGKELSIAELAALVKQIVGYHGEIRYDASKPDGMPRKL
                     LDVGKLTALGWSYKTELSEGIRLAYEDFLSHSIRTER"
     misc_feature    43709..44608
                     /locus_tag="Selsp_0046"
                     /note="GDP-fucose synthetase, extended (e) SDRs; Region:
                     GDP_FS_SDR_e; cd05239"
                     /db_xref="CDD:187550"
     misc_feature    43715..44614
                     /locus_tag="Selsp_0046"
                     /note="GDP-4-keto-6-deoxymannose-3,
                     5-epimerase-4-reductase; Region: PLN02725"
                     /db_xref="CDD:178326"
     misc_feature    order(43724..43726,43730..43741,43802..43804,43811..43822,
                     43880..43888,43892..43894,43952..43954,44009..44017,
                     44102..44104,44114..44116,44183..44188,44192..44194)
                     /locus_tag="Selsp_0046"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187550"
     misc_feature    order(43943..43945,44015..44017,44102..44104,44114..44116)
                     /locus_tag="Selsp_0046"
                     /note="active site"
                     /db_xref="CDD:187550"
     misc_feature    order(44015..44017,44102..44104,44189..44191,44246..44248,
                     44297..44299,44321..44323)
                     /locus_tag="Selsp_0046"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187550"
     gene            44660..46405
                     /locus_tag="Selsp_0047"
                     /db_xref="GeneID:10496249"
     CDS             44660..46405
                     /locus_tag="Selsp_0047"
                     /EC_number="3.6.3.44"
                     /note="COGs: COG2274 ABC-type bacteriocin/lantibiotic
                     exporter contain an N-terminal double-glycine peptidase
                     domain;
                     InterPro IPR003593:IPR003439;
                     KEGG: tel:tll0214 ATP-binding protein of ABC transporter;
                     PFAM: ABC transporter-like;
                     PRIAM: Xenobiotic-transporting ATPase;
                     SMART: ATPase, AAA+ type, core;
                     SPTR: ATP-binding protein of ABC transporter;
                     IMG reference gene:2504585498;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Xenobiotic-transporting ATPase"
                     /protein_id="YP_004412490.1"
                     /db_xref="GI:330837910"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR011527"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="InterPro:IPR017940"
                     /db_xref="GeneID:10496249"
                     /translation="MLKSFFKIFTIFPRRELRYCAFIIACMVFGAVLEAVGIGAILPL
                     ISIMGQPDFLQTNPAVMTLAAFFHINTHTELIIFLAIGLMMLYVLKNMYLTWQINLQA
                     RFSMRQQVYYSNQLMATYLGKPYIYHLDHNSATLLRNVNSVGTAVFANILMPTFALLA
                     ETITAFAIWVMLVFVDAFTAILVAGFMGGMIYMIMKAFRRKIVRQGELQMAYASEYIK
                     WLNQGLGAIKETKVTGNEGYFLKRFSEAYDVFGNAYRIFQVFVQTPKLLIETFVISSL
                     LLLIVVKLFLGNAPMDIVPLLGVLALAAFRLMPSANRMVAISNGIKFQMPFFEELYDE
                     LIEIKYRQSKGRSILFKSTERIVSFKHAIHISDVCFQYPDTERKILDGVSLSFPKGAF
                     VGITGASGAGKTTFIDILLGLLKPVQGKIEVDGQDIWQDISAWRRILAYVPQSIYLID
                     GSIRENIALGISEEQIDDERIERVLRMAELSSFVKELPDGVETEVGERGVKLSGGQRQ
                     RIGIARALYLNPQILVLDEATSALDHETEQNITNTILNLRGHLTIIAVAHRTSTLESC
                     DLRVHFSEGRAELMV"
     misc_feature    44663..46387
                     /locus_tag="Selsp_0047"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     misc_feature    45746..46399
                     /locus_tag="Selsp_0047"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    45848..45871
                     /locus_tag="Selsp_0047"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(45857..45862,45866..45874,45989..45991,46235..46240,
                     46331..46333)
                     /locus_tag="Selsp_0047"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    45980..45991
                     /locus_tag="Selsp_0047"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    46163..46192
                     /locus_tag="Selsp_0047"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    46223..46240
                     /locus_tag="Selsp_0047"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    46247..46258
                     /locus_tag="Selsp_0047"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    46319..46339
                     /locus_tag="Selsp_0047"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            46454..48064
                     /locus_tag="Selsp_0048"
                     /db_xref="GeneID:10496250"
     CDS             46454..48064
                     /locus_tag="Selsp_0048"
                     /note="KEGG: tye:THEYE_A0483 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585499;
                     PFAM: Capsule polysaccharide biosynthesis protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412491.1"
                     /db_xref="GI:330837911"
                     /db_xref="InterPro:IPR007833"
                     /db_xref="GeneID:10496250"
                     /translation="MIERIGRFIKRNLKKRFCKPVSVGEMEFASLNAPFWQDEKIAST
                     VEKRILVYVAGDYITPVVETMLFAKRLSKEREMPLDVLGGSDILYKPVRSVYQSFHIR
                     SVLDAEMGWLEKAKVLYEAILAWRMWREGNDILAMTYDGIPIGEELYDAILSHNREQY
                     TVDKIELKHIYDAYLFYKNIHIAKRIFHSQRYGVFIFSDGDYINSPFVKFAAKYGAEI
                     YQTSVGRVLFHKIIKDFTLKYSSQITHQMYEECRAMVPRRIIDQYLTERFRGEAKADY
                     DRQAFFGKKEYSKEDLCKFSGLSFDSDCKFVVVAAHAFSDRPHSGDIMVYRDYYQWLI
                     ETLKLLDKVEGVVVFVKEHPSALLYGEKGSISHLVRQYGWKQIYTLPEDFHTYSIFRY
                     FDYVVTCKGTIGLEAASFGIPVFTAGQGYYYGFGVDINSTTTAEYEQRLQNIKRYERL
                     PETVQERARILLYLMGQITPPYAPSVIPADRFRSEIAQLRSEEYQYTYINQRLREGKS
                     IKDEYYERILKDIIVFDETVGTIYEDLS"
     misc_feature    <47219..47734
                     /locus_tag="Selsp_0048"
                     /note="Capsule polysaccharide biosynthesis protein;
                     Region: Capsule_synth; cl19502"
                     /db_xref="CDD:267855"
     gene            48048..49190
                     /locus_tag="Selsp_0049"
                     /db_xref="GeneID:10496251"
     CDS             48048..49190
                     /locus_tag="Selsp_0049"
                     /note="COGs: COG1035 Coenzyme F420-reducing hydrogenase
                     beta subunit;
                     InterPro IPR001450:IPR007525;
                     KEGG: amt:Amet_0212 4Fe-4S ferredoxin iron-sulfur binding
                     domain-containing protein;
                     PFAM: Coenzyme F420 hydrogenase/dehydrogenase beta
                     subunit, C-terminal; 4Fe-4S binding domain;
                     SPTR: Dehydrogenase, beta subunit;
                     IMG reference gene:2504585500;
                     PFAM: 4Fe-4S binding domain; Coenzyme F420
                     hydrogenase/dehydrogenase, beta subunit C terminus"
                     /codon_start=1
                     /transl_table=11
                     /product="coenzyme F420 hydrogenase/dehydrogenase beta
                     subunit domain protein"
                     /protein_id="YP_004412492.1"
                     /db_xref="GI:330837912"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR007525"
                     /db_xref="InterPro:IPR012285"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="GeneID:10496251"
                     /translation="MKICHDLESCTGCTACRHICPVSAITMRENSEGFLYPKVNESLC
                     VHCGRCVQVCPQNHVPTYYAPRAVYAVKHRMQSVRERSTSGGMFTALSDWILDQGGVI
                     YGAAFDEAFVVSHIVADNAIERNRMRGSKYVQSVLGDVFAHIESDLRENRYVLFTGTP
                     CQVDGLRNFIGKAHHKLFLVDIVCYGTPSPLLFRDYIQFIQKEYQTDIRWYTFRNKKA
                     SWRTGKSFLELENNKAVSKEKTEIFDRLFWSGNIIRTSCYACPYTKPIRISDITIGDC
                     WGLEKILPTFEDAYGVSLCLVNTKQGERIFDEIFQAIECHDISNSLEWQQPRMQSPTE
                     RPIAREAFWRDYHRKGFLYVARKYTHWNIFRITIRKIRFVLHRIFG"
     misc_feature    48063..48218
                     /locus_tag="Selsp_0049"
                     /note="4Fe-4S dicluster domain; Region: Fer4_8; pfam13183"
                     /db_xref="CDD:257551"
     misc_feature    48075..48218
                     /locus_tag="Selsp_0049"
                     /note="4Fe-4S dicluster domain; Region: Fer4_7; pfam12838"
                     /db_xref="CDD:257339"
     misc_feature    48501..48974
                     /locus_tag="Selsp_0049"
                     /note="Coenzyme F420 hydrogenase/dehydrogenase, beta
                     subunit C terminus; Region: FrhB_FdhB_C; pfam04432"
                     /db_xref="CDD:252593"
     gene            49268..49860
                     /locus_tag="Selsp_0050"
                     /pseudo
                     /db_xref="GeneID:10496252"
     gene            49832..50890
                     /locus_tag="Selsp_0051"
                     /db_xref="GeneID:10496253"
     CDS             49832..50890
                     /locus_tag="Selsp_0051"
                     /note="InterPro IPR007345;
                     KEGG: smd:Smed_3879 hypothetical protein;
                     PFAM: Polysaccharide pyruvyl transferase;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585502;
                     PFAM: Polysaccharide pyruvyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide pyruvyl transferase"
                     /protein_id="YP_004412493.1"
                     /db_xref="GI:330837913"
                     /db_xref="InterPro:IPR007345"
                     /db_xref="GeneID:10496253"
                     /translation="MKIGILTFHDGINYGAYLQVYSLYRTLQKLGAEPEILNYKGFFH
                     WRWEYRCLIWTKRPARLAANLKKLIAFKRCQKLLKQTSFTFHRTCLPNYDKVIVGSDE
                     IWNYSVAHGDDIYFGVGVPAREKYAYAASFGSVDENDEIPKKLLSGLETFRNISVRDE
                     NSMRLLQRNLPQKECIKVLDPTLLYDFNGEEVEPVEKNYILIYTTDNAIPVSVRNEII
                     SFARQHNKTLVAVGYHMPWCEKNFNTLNPFEWAGFFKCADMIVTTMFHGTMFSIKYKK
                     EFCTILEPYRVNKLKDLLTEFGLEKRIYQEKSGLEDVFHAPIDYVSVEACLKERKKIS
                     FDYIKRIIGKGNCDLHKG"
     misc_feature    49868..50674
                     /locus_tag="Selsp_0051"
                     /note="Polysaccharide pyruvyl transferase; Region:
                     PS_pyruv_trans; pfam04230"
                     /db_xref="CDD:252466"
     gene            50920..51429
                     /locus_tag="Selsp_0052"
                     /db_xref="GeneID:10496254"
     CDS             50920..51429
                     /locus_tag="Selsp_0052"
                     /note="COGs: COG0110 Acetyltransferase (isoleucine patch
                     superfamily);
                     InterPro IPR001451;
                     KEGG: bde:BDP_1853 acetyltransferase;
                     SPTR: Nodulation protein l;
                     IMG reference gene:2504585503"
                     /codon_start=1
                     /transl_table=11
                     /product="acetyltransferase"
                     /protein_id="YP_004412494.1"
                     /db_xref="GI:330837914"
                     /db_xref="InterPro:IPR011004"
                     /db_xref="GeneID:10496254"
                     /translation="MLILNIYSHIRVLCKRLIYKILFGRKVSFGSHVHFRRGFSLLIL
                     EQGKVEIGRYVFFNNDCSIVAREYIFIGAYTMMGENVKLYDHNHRISNPNILKRDQGF
                     KNRPIKIGRNCWIGNNVTLLGGADIGDNSVVGAGCIVDCVIPADTIVTMNRELRMCPI
                     CWKDMGQLS"
     misc_feature    51061..51366
                     /locus_tag="Selsp_0052"
                     /note="Maltose O-acyltransferase (MAT)-like: This family
                     is composed of maltose O-acetyltransferase, galactoside
                     O-acetyltransferase (GAT), xenobiotic acyltransferase
                     (XAT) and similar proteins. MAT and GAT catalyze the
                     CoA-dependent acetylation of the...; Region: LbH_MAT_like;
                     cd04647"
                     /db_xref="CDD:100053"
     misc_feature    order(51079..51081,51085..51087,51109..51111,51139..51141,
                     51145..51147,51163..51165,51181..51189,51253..51255,
                     51259..51261,51268..51270,51325..51327)
                     /locus_tag="Selsp_0052"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100053"
     misc_feature    order(51085..51087,51091..51093,51181..51183,51187..51189,
                     51259..51261,51265..51270,51283..51285,51319..51324,
                     51337..51342)
                     /locus_tag="Selsp_0052"
                     /note="active site"
                     /db_xref="CDD:100053"
     misc_feature    order(51085..51087,51091..51093,51181..51183)
                     /locus_tag="Selsp_0052"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100053"
     misc_feature    order(51181..51183,51187..51189,51259..51261,51265..51270,
                     51283..51285,51313..51315,51319..51324,51337..51342,
                     51361..51363)
                     /locus_tag="Selsp_0052"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100053"
     gene            51608..52591
                     /locus_tag="Selsp_0053"
                     /db_xref="GeneID:10496255"
     CDS             51608..52591
                     /locus_tag="Selsp_0053"
                     /note="COGs: COG1086 nucleoside-diphosphate sugar
                     epimerase;
                     InterPro IPR020025:IPR003869;
                     KEGG: rpf:Rpic12D_0580 polysaccharide biosynthesis protein
                     CapD;
                     PFAM: Polysaccharide biosynthesis protein CapD-like;
                     SPTR: UDP-N-acetylglucosamine 4,6-dehydratase;
                     TIGRFAM: Pseudaminic acid biosynthesis, PseB;
                     IMG reference gene:2504585504;
                     PFAM: Polysaccharide biosynthesis protein;
                     TIGRFAM: UDP-N-acetylglucosamine 4,6-dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine 4,6-dehydratase"
                     /protein_id="YP_004412495.1"
                     /db_xref="GI:330837915"
                     /db_xref="InterPro:IPR003869"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496255"
                     /translation="MFNGKNILVTGGTGSFGKTFIKILLAQYQPNKIIVYSRDELKQF
                     EMQQSFNASCMRYFIGDVRDGERLKYAMEGVHFVVHAAALKQVPAAEYNPMECIKTNV
                     NGAQNVIDAALHAGVKKVIALSTDKAANPINLYGATKLCSDKLFTAANNFVGAKETRF
                     SVVRYGNVVGSRGSVVPFFKRLVHEGAKELPITDPRMTRFWLCLEDGVEFVLKSFARM
                     KGGEIFIPKIPSMRITDLAEAIAPGLPTKVIGIRPGEKLHEVMCPSDLYYETLEFADH
                     FVIMPSTQEQTVDYTTNALGETGRLVPDGFDYNSGNNPHFLTVQELREMNP"
     misc_feature    51608..52582
                     /locus_tag="Selsp_0053"
                     /note="UDP-N-acetylglucosamine 4,6-dehydratase; Region:
                     PseB; TIGR03589"
                     /db_xref="CDD:132628"
     misc_feature    51617..52441
                     /locus_tag="Selsp_0053"
                     /note="UDP-Glcnac (UDP-linked N-acetylglucosamine)
                     inverting 4,6-dehydratase, extended (e) SDRs; Region:
                     UDP_invert_4-6DH_SDR_e; cd05237"
                     /db_xref="CDD:187548"
     misc_feature    order(51638..51640,51644..51655,51716..51721,51785..51793,
                     51848..51856,51860..51862,51905..51907,51974..51976,
                     52022..52024,52100..52111,52118..52123)
                     /locus_tag="Selsp_0053"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187548"
     misc_feature    order(51719..51721,51725..51727,51737..51739,51749..51751,
                     51779..51790,51797..51799,51806..51808,51854..51865,
                     51872..51874,51884..51886,51893..51895,51902..51904,
                     52121..52126,52139..52141)
                     /locus_tag="Selsp_0053"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    order(51860..51862,51980..51988,52010..52012,52103..52108,
                     52124..52132,52139..52144,52178..52186,52196..52198,
                     52202..52204,52304..52306,52361..52363,52370..52372)
                     /locus_tag="Selsp_0053"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187548"
     misc_feature    order(51908..51910,51980..51982,52010..52012,52022..52024)
                     /locus_tag="Selsp_0053"
                     /note="active site"
                     /db_xref="CDD:187548"
     gene            52588..53745
                     /locus_tag="Selsp_0054"
                     /db_xref="GeneID:10496256"
     CDS             52588..53745
                     /locus_tag="Selsp_0054"
                     /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
                     apparently involved in regulation of cell wall biogenesis;
                     InterPro IPR000653:IPR020026;
                     KEGG: npu:Npun_R0689 DegT/DnrJ/EryC1/StrS
                     aminotransferase;
                     PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
                     SPTR: UDP-4-keto-6-deoxy-N-acetylglucosamine
                     4-aminotransferase;
                     TIGRFAM: Pseudaminic acid biosynthesis, PseC;
                     IMG reference gene:2504585505;
                     PFAM: DegT/DnrJ/EryC1/StrS aminotransferase family;
                     TIGRFAM: UDP-4-keto-6-deoxy-N-acetylglucosamine
                     4-aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-4-keto-6-deoxy-N-acetylglucosamine
                     4-aminotransferase"
                     /protein_id="YP_004412496.1"
                     /db_xref="GI:330837916"
                     /db_xref="InterPro:IPR000653"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="InterPro:IPR020026"
                     /db_xref="GeneID:10496256"
                     /translation="MIYYGKQDVNESDIQAVEDVLRSDFLTQGPAIERFENQVAAYCG
                     AKYAVAVTNATSALHIACLAAGLGEGDLLWTSPITFVASANCARYCGADVDFVDIDEK
                     TYNMSVPALEEKLQQAKQKGRLPKIVVPVHLAGQSCDMRAMRQLAEEYGFILLEDASH
                     AVGADYLDAKVGSCRFSDMTVFSFHPVKIITTGEGGMVLTNNKELYEKLVLYRSHGIT
                     RDPDKMTHAADGAWYYQQIFLGYNYRMTDIQAALGCSQMERLDDFVERRRTLAQQYDA
                     LLKGLPFVTPYVMDGTNPSWHIYIVRMNCRQIKKLKQQIFVEMKERGIALNLHYIPVH
                     RQPYYEKLGFRQGDFPHSEKYYEEAFTLPLYCSLTDAEQEHIVNCLQEILR"
     misc_feature    52624..53730
                     /locus_tag="Selsp_0054"
                     /note="3-amino-5-hydroxybenzoic acid synthase family
                     (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
                     (PLP)-dependent aspartate aminotransferase superfamily
                     (fold I). The members of this CD are involved in various
                     biosynthetic pathways for secondary...; Region: AHBA_syn;
                     cd00616"
                     /db_xref="CDD:99740"
     misc_feature    order(52747..52752,53056..53058,53065..53067,53134..53136,
                     53146..53151,53572..53574)
                     /locus_tag="Selsp_0054"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99740"
     misc_feature    order(52747..52752,52822..52824,53056..53058,53065..53067,
                     53134..53136,53149..53151)
                     /locus_tag="Selsp_0054"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99740"
     misc_feature    53149..53151
                     /locus_tag="Selsp_0054"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99740"
     gene            53775..54659
                     /locus_tag="Selsp_0055"
                     /db_xref="GeneID:10496257"
     CDS             53775..54659
                     /locus_tag="Selsp_0055"
                     /note="COGs: COG0667 oxidoreductase (related to
                     aryl-alcohol dehydrogenase);
                     InterPro IPR023210;
                     KEGG: swo:Swol_0202 oxidoreductase;
                     PFAM: NADP-dependent oxidoreductase domain;
                     SPTR: Putative oxidoreductase;
                     IMG reference gene:2504585506;
                     PFAM: Aldo/keto reductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="NADP-dependent oxidoreductase domain protein"
                     /protein_id="YP_004412497.1"
                     /db_xref="GI:330837917"
                     /db_xref="InterPro:IPR001395"
                     /db_xref="InterPro:IPR020471"
                     /db_xref="InterPro:IPR023210"
                     /db_xref="GeneID:10496257"
                     /translation="MMQDLTAKLCLGTVQLGMKYGVKNELGRQPTDEEAFSVLDAALA
                     AGITAFDTARAYGTAEELLGRFGLAEKGAHIVSKLHPNTANREEAVLSELHESLQSLR
                     AKKIFCYMLHRAGDLQKSGIMAGLSKAKALGLTKTIGVSIYEPEEAMEAALHPLVDVI
                     QIPYNVLDQRLDACGFFLQAAKNGKRVYARSAFLQGLLLMSPQEAEASVSGSGVFVSK
                     FQDIARKEGYMNTEAAMLYVLSHPQIDGVIFGVDTVEQLRENVKILKRGEEFSSCRKQ
                     FRRSFENVPREVVVPSLW"
     misc_feature    53799..54569
                     /locus_tag="Selsp_0055"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    order(53808..53816,53925..53927,53940..53942,54006..54008,
                     54108..54113,54195..54200,54255..54257,54342..54359,
                     54465..54467,54516..54527,54540..54542,54549..54554)
                     /locus_tag="Selsp_0055"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(53925..53927,53940..53942,54006..54008,54108..54110)
                     /locus_tag="Selsp_0055"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            54802..55557
                     /locus_tag="Selsp_0056"
                     /db_xref="GeneID:10496258"
     CDS             54802..55557
                     /locus_tag="Selsp_0056"
                     /note="COGs: COG1861 Spore coat polysaccharide
                     biosynthesis protein F CMP-KDO synthetase homolog;
                     InterPro IPR003329;
                     KEGG: tai:Taci_0677 acylneuraminate cytidylyltransferase;
                     PFAM: Acylneuraminate cytidylyltransferase;
                     SPTR: Spore coat polysaccharide biosynthesis protein SpsF;
                     IMG reference gene:2504585507;
                     PFAM: Cytidylyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="acylneuraminate cytidylyltransferase"
                     /protein_id="YP_004412498.1"
                     /db_xref="GI:330837918"
                     /db_xref="InterPro:IPR003329"
                     /db_xref="GeneID:10496258"
                     /translation="MILSIIQARTSSTRLPGKVLLPLAGKPMIVQEIQRLSRSQKIDK
                     IVLATSTDASDDELCTVVTTGGVEVYRGDLTDVLDRYYRCARKYGADHVVRITGDCPV
                     IDWRLVDTVIARHIAEQNDYTHMTERFPDGLDTEVMTFAALERAQREATLLSEREHVT
                     LYFRKHLEIFRIGTVDSQADYGDLRWTVDEMRDFTFIEAVYEHLFPLKNDFTMEDMIS
                     LLKEHKDLLEINRGITRNEGLQKSLAEEAAQSE"
     misc_feature    54814..55497
                     /locus_tag="Selsp_0056"
                     /note="SpsF is a glycosyltrnasferase implicated in the
                     synthesis of the spore coat; Region: GT2_SpsF; cd02518"
                     /db_xref="CDD:133011"
     misc_feature    order(54820..54822,54826..54828,55096..55098)
                     /locus_tag="Selsp_0056"
                     /note="ligand binding site; other site"
                     /db_xref="CDD:133011"
     gene            55613..56905
                     /locus_tag="Selsp_0057"
                     /db_xref="GeneID:10496259"
     CDS             55613..56905
                     /locus_tag="Selsp_0057"
                     /EC_number="5.4.3.8"
                     /note="COGs: COG0001 Glutamate-1-semialdehyde
                     aminotransferase;
                     InterPro IPR005814;
                     KEGG: cts:Ctha_2091 aminotransferase class-III;
                     PFAM: Aminotransferase class-III;
                     PRIAM: Glutamate-1-semialdehyde 2,1-aminomutase;
                     SPTR: Glutamate-1-semialdehyde 2,1-aminomutase;
                     IMG reference gene:2504585508;
                     PFAM: Aminotransferase class-III"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamate-1-semialdehyde 2,1-aminomutase"
                     /protein_id="YP_004412499.1"
                     /db_xref="GI:330837919"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496259"
                     /translation="MEINKRSLEKSEELWQTAQDTILSGCQLYSKGPETHIKGVSPIY
                     IDHGKGAHVWDLDGNEYIDYDMGLGPIILGYQYKAVDDAVRAQLQRGMGYSLVAPEEV
                     EYAKLCVKHIPSAGKVRFLKTGSSATEAAVRIARCYTGRKHIVRGEYHGWHEWTTAAE
                     SVRQGGILPEVRQFVHKFDYNDLAKVEEYFETYKGEIAAVITEAVEIEPPKEGFLKRL
                     KELCHRNGALLIFDEVVNGFRFSIGGAQAYFGVTPDLSTFGKAAANGMPLSIVAGRKD
                     IMEEVDKSIFISTTFGGECLSLAAGIAVMKALESGEVTKAIWEKGKYLQDNFRRLAKE
                     LDVPIDLSGYPCRLNLEYTDYEGRKDWLYNSIFMQESVKRGVLLGWHIFPCYSHTQED
                     LDFTLNVFEDAMKVYREALKSGHPERYMEGQPLKIVLG"
     misc_feature    55631..56827
                     /locus_tag="Selsp_0057"
                     /note="Glutamate-1-semialdehyde aminotransferase [Coenzyme
                     metabolism]; Region: HemL; COG0001"
                     /db_xref="CDD:223080"
     misc_feature    55736..56824
                     /locus_tag="Selsp_0057"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(55979..55987,56057..56062,56066..56068,56219..56221,
                     56306..56308,56312..56317,56390..56392)
                     /locus_tag="Selsp_0057"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(55982..55987,56057..56062,56219..56221,56306..56308,
                     56315..56317,56390..56392)
                     /locus_tag="Selsp_0057"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    56390..56392
                     /locus_tag="Selsp_0057"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            56940..57992
                     /locus_tag="Selsp_0058"
                     /db_xref="GeneID:10496260"
     CDS             56940..57992
                     /locus_tag="Selsp_0058"
                     /note="COGs: COG3980 Spore coat polysaccharide
                     biosynthesis protein predicted glycosyltransferase;
                     InterPro IPR007235:IPR020023;
                     KEGG: bae:BATR1942_16230 pseudaminic acid
                     biosynthesis-associated protein PseG;
                     PFAM: Glycosyl transferase, family 28, C-terminal;
                     SPTR: Pseudaminic acid biosynthesis-associated protein
                     PseG;
                     TIGRFAM: Pseudaminic acid biosynthesis-associated protein
                     PseG;
                     IMG reference gene:2504585509;
                     PFAM: Glycosyltransferase family 28 C-terminal domain;
                     TIGRFAM: pseudaminic acid biosynthesis-associated protein
                     PseG"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudaminic acid biosynthesis-associated protein
                     PseG"
                     /protein_id="YP_004412500.1"
                     /db_xref="GI:330837920"
                     /db_xref="InterPro:IPR007235"
                     /db_xref="InterPro:IPR020023"
                     /db_xref="GeneID:10496260"
                     /translation="MGCTVAVRVDSSELIGSGHLMRCLTLAERMCFDGADVHFICRDL
                     AGNLNHLVEERGFALHILPHHTPERSLMGYEAWLTVVPELDAEETAEVLRAIRPVSRL
                     VVDSYALDASWEQKMRPLASEIFVIDDLANRRHDCDFLLDQNFYRDLQHRYDDLVPEK
                     CKLLLGPRYALLRQEFYEVKARLVPRDGSLRRILVFYGGSDRTQETEKAIRALVQLQL
                     SSVAVDVVVGGSNPRREQIERLCRQHDFLRYHCQVENMAELMAKADLCLGAGGTTTWE
                     RCFLGLPTIVTAIAENQFEICRDCAEAGLIYSLGRWDKVTDRDIIRAVQEFLNVNSLS
                     RFQHNCQLECWRAMER"
     misc_feature    56949..57827
                     /locus_tag="Selsp_0058"
                     /note="pseudaminic acid biosynthesis-associated protein
                     PseG; Region: PseG; TIGR03590"
                     /db_xref="CDD:234270"
     misc_feature    56991..>57794
                     /locus_tag="Selsp_0058"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            58133..58789
                     /locus_tag="Selsp_0059"
                     /db_xref="GeneID:10496261"
     CDS             58133..58789
                     /locus_tag="Selsp_0059"
                     /note="COGs: COG0223 Methionyl-tRNA formyltransferase;
                     KEGG: swo:Swol_0208 methionyl-tRNA formyltransferase-like
                     protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585510;
                     PFAM: Formyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="methionyl-tRNA formyltransferase-like protein"
                     /protein_id="YP_004412501.1"
                     /db_xref="GI:330837921"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR015518"
                     /db_xref="GeneID:10496261"
                     /translation="MYKIAIVTDEQSWIKPYIERLERDLRSMGHTVVCRYDFDTENSY
                     DFVFLLSYQEIIKKEWLCLNRHNLVVHESDLPQGKGWSPLTWQILEGKSQITITLFEA
                     DEHVDAGKIYLQKKMCFDGTELIDELRRVQGETTHALCTAFVQDYPDILRTARKQVGE
                     ESFYPRRRAKDSRLDLDRTIREQINLFRVVDNDRYPAFFEWMGYRYYLKISREKEDLL
                     "
     misc_feature    <58265..58747
                     /locus_tag="Selsp_0059"
                     /note="Formyltransferase, catalytic core domain; Region:
                     FMT_core; cl00395"
                     /db_xref="CDD:260403"
     misc_feature    order(58277..58300,58337..58348,58370..58372,58430..58432,
                     58436..58441,58448..58453)
                     /locus_tag="Selsp_0059"
                     /note="active site"
                     /db_xref="CDD:187712"
     misc_feature    order(58277..58279,58286..58288,58292..58300,58337..58339,
                     58436..58441,58448..58453)
                     /locus_tag="Selsp_0059"
                     /note="cosubstrate binding site; other site"
                     /db_xref="CDD:187712"
     misc_feature    order(58280..58285,58340..58342,58346..58348,58538..58540)
                     /locus_tag="Selsp_0059"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187712"
     misc_feature    order(58337..58339,58343..58345,58451..58453)
                     /locus_tag="Selsp_0059"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187712"
     gene            58801..59487
                     /locus_tag="Selsp_0060"
                     /db_xref="GeneID:10496262"
     CDS             58801..59487
                     /locus_tag="Selsp_0060"
                     /note="COGs: COG0223 Methionyl-tRNA formyltransferase;
                     InterPro IPR002376;
                     KEGG: cth:Cthe_2224 putative methionyl-tRNA
                     formyltransferase;
                     PFAM: Formyl transferase, N-terminal;
                     SPTR: Putative methionyl-tRNA formyltransferase;
                     IMG reference gene:2504585511;
                     PFAM: Formyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="formyl transferase domain protein"
                     /protein_id="YP_004412502.1"
                     /db_xref="GI:330837922"
                     /db_xref="InterPro:IPR002376"
                     /db_xref="InterPro:IPR011034"
                     /db_xref="InterPro:IPR015518"
                     /db_xref="GeneID:10496262"
                     /translation="MHMVIVSNRAWNRRFVPEIETRTGIKVTYLEQRDDVSQEKMTAL
                     SPSWVFFPHWSYIIPAEVYENFRCVIFHMTDLPFGRGGSPLQNLIVRGIYETKITALR
                     CVKELDAGPVYIKRPLSLWGSAEEIYLRAGEITKEMIIELVQKNPVPHAQMGEGLAFK
                     RRTPADGNIGNLEDLSQVFDYIRMLDADGYPPAFLQMNHLRMEFSRASLKDGCVLADV
                     KITIWEEEDV"
     misc_feature    58804..59436
                     /locus_tag="Selsp_0060"
                     /note="Formyl transferase catalytic core domain found in a
                     group of proteins with unknown functions; Region:
                     FMT_core_like_1; cd08821"
                     /db_xref="CDD:187723"
     misc_feature    order(58819..58821,58831..58839,58951..58974,58987..58989,
                     59008..59019,59041..59043,59101..59103,59107..59112,
                     59119..59124)
                     /locus_tag="Selsp_0060"
                     /note="putative active site [active]"
                     /db_xref="CDD:187723"
     misc_feature    order(58843..58848,58954..58959,59011..59013,59017..59019,
                     59203..59205)
                     /locus_tag="Selsp_0060"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187723"
     misc_feature    order(58951..58953,58960..58962,58966..58974,58987..58989,
                     59008..59010,59107..59112,59119..59124)
                     /locus_tag="Selsp_0060"
                     /note="putative cosubstrate binding site; other site"
                     /db_xref="CDD:187723"
     misc_feature    order(59008..59010,59014..59016,59122..59124)
                     /locus_tag="Selsp_0060"
                     /note="catalytic site [active]"
                     /db_xref="CDD:187723"
     gene            59480..60169
                     /locus_tag="Selsp_0061"
                     /db_xref="GeneID:10496263"
     CDS             59480..60169
                     /locus_tag="Selsp_0061"
                     /note="COGs: COG2120 conserved hypothetical protein LmbE
                     homologs;
                     InterPro IPR003737;
                     KEGG: swo:Swol_0211 putative LmbE-like protein;
                     PFAM: N-acetylglucosaminyl phosphatidylinositol
                     deacetylase;
                     SPTR: N-acetylglucosaminylphosphatidylinositol deacetylase
                     family protein;
                     IMG reference gene:2504585512;
                     PFAM: GlcNAc-PI de-N-acetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="LmbE family protein"
                     /protein_id="YP_004412503.1"
                     /db_xref="GI:330837923"
                     /db_xref="InterPro:IPR003737"
                     /db_xref="GeneID:10496263"
                     /translation="MSKRVLVVAAHPDDEVLGVGGTIIRHAQVGDTVRILLMAEGLTS
                     RADQRDVESFQKGLDALHKNAQSVAHALGAESIQLANFPDNRMDCVELLDIVKVIEKE
                     IEDFHPEIVYTHHAGDVNIDHVQTHNAVVTACRSLPGKNVKELCFFETPSSTEWQMQT
                     SDKAFLPALYVDISNTFAQKIKALELYASEMRDYPHPRSYRAVEILARYRGYAVGIEF
                     AEAFSVGRIIR"
     misc_feature    59495..59845
                     /locus_tag="Selsp_0061"
                     /note="GlcNAc-PI de-N-acetylase; Region: PIG-L; pfam02585"
                     /db_xref="CDD:251394"
     gene            60180..61205
                     /locus_tag="Selsp_0062"
                     /db_xref="GeneID:10496264"
     CDS             60180..61205
                     /locus_tag="Selsp_0062"
                     /EC_number="2.5.1.56"
                     /note="COGs: COG2089 Sialic acid synthase;
                     InterPro IPR020030:IPR013974:IPR013132;
                     KEGG: swo:Swol_0210 N-acylneuraminate-9-phosphate
                     synthase;
                     PFAM: N-acetylneuraminic acid synthase, N-terminal; SAF
                     domain;
                     PRIAM: N-acetylneuraminate synthase;
                     SMART: SAF domain;
                     SPTR: Pseudaminic acid synthase;
                     TIGRFAM: Pseudaminic acid biosynthesis, PseI;
                     IMG reference gene:2504585513;
                     PFAM: SAF domain; NeuB family;
                     TIGRFAM: pseudaminic acid synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="pseudaminic acid synthase"
                     /protein_id="YP_004412504.1"
                     /db_xref="GI:330837924"
                     /db_xref="InterPro:IPR006190"
                     /db_xref="InterPro:IPR013132"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="InterPro:IPR013974"
                     /db_xref="GeneID:10496264"
                     /translation="MWSKEGMPFIIAEMSGNHNQSLERALAIVDAAAAAGVDAVKIQT
                     YTADTMTLDIAAGEFFIADQESLWKGESLYRLYEKAHTPWEWHKTIFDRCREHGIMGF
                     STPFDDSSVDFLEELDVPCYKIASFENVDLPLIRKVARTGKPMIASTGMTTVSELEDL
                     VRVARENGCRDLTLLKCTSSYPASAEGTNLRTIPHMRELFNCGVGLSDHTLGIGVAVA
                     SIALGASVIEKHFTLSRADGGVDAAFSLEPDEMAQLVRECRAAALAMGEVRYEIAEQE
                     KKSLRFRRSLYIVEDMKAGDAITEENVRRIRPGHGLSPKYNGMILGKRINRDVKRGTP
                     MSWDLLM"
     misc_feature    60201..61184
                     /locus_tag="Selsp_0062"
                     /note="pseudaminic acid synthase; Region: PseI; TIGR03586"
                     /db_xref="CDD:163337"
     misc_feature    60300..60989
                     /locus_tag="Selsp_0062"
                     /note="NeuB family; Region: NeuB; pfam03102"
                     /db_xref="CDD:251732"
     misc_feature    61026..61199
                     /locus_tag="Selsp_0062"
                     /note="C-terminal SAF domain of sialic acid synthetase;
                     Region: SAF_NeuB_like; cd11615"
                     /db_xref="CDD:212160"
     misc_feature    order(61026..61031,61044..61046,61092..61100,61116..61124)
                     /locus_tag="Selsp_0062"
                     /note="NeuB binding interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212160"
     misc_feature    61098..61100
                     /locus_tag="Selsp_0062"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:212160"
     gene            61310..61974
                     /locus_tag="Selsp_0063"
                     /pseudo
                     /db_xref="GeneID:10496265"
     gene            62013..63326
                     /locus_tag="Selsp_0064"
                     /db_xref="GeneID:10496266"
     CDS             62013..63326
                     /locus_tag="Selsp_0064"
                     /EC_number="2.7.7.13"
                     /note="COGs: COG0836 Mannose-1-phosphate
                     guanylyltransferase;
                     InterPro IPR005835:IPR013096;
                     KEGG: bpb:bpr_I2267 mannose-6-phosphate
                     isomerase/mannose-1-phosphate guanylyl transferase;
                     PFAM: Nucleotidyl transferase; Cupin 2, conserved barrel;
                     PRIAM: Mannose-1-phosphate guanylyltransferase;
                     SPTR: Mannose-6-phosphate isomerase mannose-1-phosphate
                     guanylyl transferase;
                     IMG reference gene:2504585515;
                     PFAM: Nucleotidyl transferase; Mannose-6-phosphate
                     isomerase;
                     TIGRFAM: mannose-1-phosphate
                     guanylyltransferase/mannose-6-phosphate isomerase"
                     /codon_start=1
                     /transl_table=11
                     /product="Mannose-1-phosphate guanylyltransferase"
                     /protein_id="YP_004412505.1"
                     /db_xref="GI:330837925"
                     /db_xref="InterPro:IPR001538"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:10496266"
                     /translation="MQIVLLSGGAGKRLWPLSNDLYSKQFLRILRREDGTLESMIQRV
                     CRQVQSVASDVPITVATGREQVSLIRRQLGSGVNISVEPCRRDTFPAIALVSAYLHEV
                     RGIPLDEAVAICPADPYVDEGYFRAVVQLLQEAEREGSANLILMGIEPTYPSEKYGYI
                     MPVSQESQSMVQSFKEKPDKEKAAEYIEQGALWNSGVFAFKLGYALDKARELLDYTDY
                     EDLFNRYEELSKISFDYAVVEKEKNIAVQRYSGTWLDIGTWNTLAEVMPEHTIGRVTM
                     DETCRNAHVVNTLPIPILCMGVKDVVVAASPEGIIVSDKERSSAMKPYAERLHTPVMY
                     TEKSWGEFQIVDAETESLTIKITLSPGRALTYHLHERRDETWTVIEGRGWVKLDGNEF
                     AVAEGQTVRIPRGAFHTIRAETLLKVMEIQTGEDIDAEDKIVWGG"
     misc_feature    62013..62798
                     /locus_tag="Selsp_0064"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    62022..63314
                     /locus_tag="Selsp_0064"
                     /note="mannose-1-phosphate
                     guanylyltransferase/mannose-6-phosphate isomerase; Region:
                     GMP_PMI; TIGR01479"
                     /db_xref="CDD:233431"
     misc_feature    order(62028..62030,62034..62036,62190..62192,62355..62357,
                     62361..62363)
                     /locus_tag="Selsp_0064"
                     /note="active site"
                     /db_xref="CDD:132997"
     misc_feature    62901..63314
                     /locus_tag="Selsp_0064"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            63446..63850
                     /locus_tag="Selsp_0065"
                     /pseudo
                     /db_xref="GeneID:10496267"
     gene            64083..64697
                     /locus_tag="Selsp_0066"
                     /db_xref="GeneID:10496268"
     CDS             64083..64697
                     /locus_tag="Selsp_0066"
                     /note="KEGG: bcr:BCAH187_E0057 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585517"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412506.1"
                     /db_xref="GI:330837926"
                     /db_xref="GeneID:10496268"
                     /translation="MELSEYTFRLMLLFLPGIIAFIIIDNLTIHKETKLHHWVIYSFL
                     LGFASYFPWTLLCEVHAVVYGGNSFSKFLSLLVNYDATINFYEVFIATMFSVVLGLCI
                     TKIINRRLLFKAASVLRVSDKFPEVDAWVNCLACYNPVWVRVRDIEHNRIYQGRLAST
                     SDPTERDGIVLEETVIYNEQGMKLYQVPVVYIPKKMEDVIIEFI"
     gene            65161..65280
                     /locus_tag="Selsp_0067"
                     /db_xref="GeneID:10496269"
     CDS             65161..65280
                     /locus_tag="Selsp_0067"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585518"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412507.1"
                     /db_xref="GI:330837927"
                     /db_xref="GeneID:10496269"
                     /translation="MVSCVAFLYLVKERAGSEFYQLELTLDFYKLLFAERCDN"
     gene            65432..65992
                     /locus_tag="Selsp_0068"
                     /db_xref="GeneID:10496270"
     CDS             65432..65992
                     /locus_tag="Selsp_0068"
                     /note="KEGG: cbt:CLH_2472 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585519"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412508.1"
                     /db_xref="GI:330837928"
                     /db_xref="GeneID:10496270"
                     /translation="MTYNVHRHIVRQKIIEAAARIVYTYTAHWKIVNRLQSRYEEFKI
                     AQIALTASASCGFLTALIKGSSCVTEIGGMLGGACSFLSLCLNLYMLNFDLPNQIKQH
                     TEAANELWEIRECYVAFITDFDMLSDEEVRSRRDDLTRVVAQVNKKYPGTDRRSYAEA
                     RVALKEKEEQTFNKGEAERLLNLMDD"
     gene            66208..68115
                     /locus_tag="Selsp_0069"
                     /db_xref="GeneID:10496271"
     CDS             66208..68115
                     /locus_tag="Selsp_0069"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585520;
                     PFAM: Reverse transcriptase (RNA-dependent DNA
                     polymerase)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412509.1"
                     /db_xref="GI:330837929"
                     /db_xref="InterPro:IPR000477"
                     /db_xref="GeneID:10496271"
                     /translation="MFDISYTDWKSVCEMCFNLKQNTCKAYLQWFPFGELPYQDKKYI
                     CSEKFYRKYIQNPAVFLYSKTMYQTENFLQKTDGSFRESFLVSPLLYLLLQGIGKVIH
                     DQYSSQRSSEISVYYAGSYEDKNMCASYKPSYDRFFKILNIYAKEYKYFIKTDIANFF
                     SNIKINKLISHVDAICNREKIAFSQMQLTLFKEILNYCGNGQFPLIENSVASSFLSTI
                     VYLDDIDAALYKYISTKVKCICSFRMVRYVDDMYILFSSESAFEELHETYNIIKNEYS
                     SILKGKGLALNMKKCCLKETTKLKGELKKSLYDRSFQEEKWRIKNTFVSEIGSFLDAL
                     LEELSNDSLDTERYNEIIDKYFSLNDMEVTPDEIFNSVIYESRNNLMWRNPFIVDKIM
                     RLIKKNIAFITLDPKRLTSMILKTREEKVIKAFLAQLFKKDKNDTWNAYDTTITISYL
                     VQRRFRHGDLLHVLNRRHPHLFQYYENYCRKSFIADLRKGENWRLITALVQDQIAYYL
                     YFMYLCEYKKGNFMTSFAYYKSYFDRVTADLAFLRNPKGENKPKYRKFYKKKRLCEFY
                     EEFDDSAYNIIDKAQALRYANPLTHSSSELLSDENTSERLKQSIRELSTLLDRYIAQY
                     DTRVNSSKLFC"
     misc_feature    66667..67116
                     /locus_tag="Selsp_0069"
                     /note="RT_Bac_retron_I: Reverse transcriptases (RTs) in
                     bacterial retrotransposons or retrons. The polymerase
                     reaction of this enzyme leads to the production of a
                     unique RNA-DNA complex called msDNA (multicopy
                     single-stranded (ss)DNA) in which a small ssDNA...;
                     Region: RT_Bac_retron_I; cd01646"
                     /db_xref="CDD:238824"
     misc_feature    order(66670..66687,66820..66822,66829..66831,66946..66948,
                     66952..66957)
                     /locus_tag="Selsp_0069"
                     /note="putative active site [active]"
                     /db_xref="CDD:238824"
     misc_feature    order(66670..66687,66820..66822,66952..66954)
                     /locus_tag="Selsp_0069"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238824"
     misc_feature    66829..66831
                     /locus_tag="Selsp_0069"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238824"
     gene            68488..69423
                     /locus_tag="Selsp_0070"
                     /db_xref="GeneID:10496272"
     CDS             68488..69423
                     /locus_tag="Selsp_0070"
                     /note="KEGG: afn:Acfer_0728 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585521"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412510.1"
                     /db_xref="GI:330837930"
                     /db_xref="GeneID:10496272"
                     /translation="MAKSNSERFYEGFQRFLTQSGHEQPTDDEMDALLQEYVKLMNEG
                     SPLLASMAEEESADVFLDRAQEAKSRRERLKWIRKAREIEPDHVDAALAEIEMTAKNP
                     YEEEMLLFELQQKAEKQLREQGDFGKEAIGDFWLIVGTRPYMRVCHAYVETLLVNRKM
                     RLAAKECESMLRLCSRDNLGIRYTLIHIYAYLEEEKAAQKIFKKYHGAEETRLPLSMA
                     LLSYKLGKEEAARRYLQMLLDNTADVKKFFSAYGTKKMETYTETLSPYSYRPHTMEEL
                     FLIFTDHLYAYGDSPAFFFWAKMALRGMKRSAGKG"
     misc_feature    68563..>68931
                     /locus_tag="Selsp_0070"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     gene            complement(69524..69694)
                     /locus_tag="Selsp_0071"
                     /pseudo
                     /db_xref="GeneID:10496273"
     gene            69915..71192
                     /locus_tag="Selsp_0072"
                     /db_xref="GeneID:10496274"
     CDS             69915..71192
                     /locus_tag="Selsp_0072"
                     /note="COGs: COG1106 ATPase;
                     KEGG: clj:CLJU_c32430 hypothetical protein;
                     SPTR: Putative abortive infection protein;
                     IMG reference gene:2504585523"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412511.1"
                     /db_xref="GI:330837931"
                     /db_xref="InterPro:IPR007406"
                     /db_xref="GeneID:10496274"
                     /translation="MLLQFSVSNFRSIKDEVVLSMLANENDDEHTEWLCSVGAERLIP
                     VAAIYGANAAGKSNILIAMAVAIKLIRYSDLRGINNTLPDVVPFLFDEEMHTQPTRFD
                     FIFVYKGKKYQYGFSADKYRIMEEYLYAYESSEATKIFERKGMNQYSFPEDDEKRFNE
                     YAEKNTANKLFLATATSWNCAETKEPYMWFAEAIDVYNFERIRSEGLNIIEEADQSLR
                     DFLMKTLKDSDFNISDYTFEDVPWTLAEFRQSGMSDVAAESLQRQMLEDGGKRYRITA
                     RHAIRTKAGNQYFDLPLQEESSGTEQMFFGAALIKRAMESEKTIIVDELSAGLHPLLL
                     QAIIKMFYDKELNQTNAQLIFSTHDISLFNLDLFRRDQIYFVEKENSTGISTLYSLDE
                     FSPAPVREDNVQESYLQGRYGAIPIISLEDTIW"
     misc_feature    69915..71183
                     /locus_tag="Selsp_0072"
                     /note="Predicted ATPases [General function prediction
                     only]; Region: COG1106"
                     /db_xref="CDD:224031"
     misc_feature    70047..>70286
                     /locus_tag="Selsp_0072"
                     /note="AAA domain; Region: AAA_21; pfam13304"
                     /db_xref="CDD:257641"
     misc_feature    <70836..71009
                     /locus_tag="Selsp_0072"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    70869..70886
                     /locus_tag="Selsp_0072"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    70893..70904
                     /locus_tag="Selsp_0072"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    70974..70994
                     /locus_tag="Selsp_0072"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            71186..71845
                     /locus_tag="Selsp_0073"
                     /db_xref="GeneID:10496275"
     CDS             71186..71845
                     /locus_tag="Selsp_0073"
                     /note="KEGG: sfu:Sfum_3792 abortive phage resistance
                     protein-like;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585524"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412512.1"
                     /db_xref="GI:330837932"
                     /db_xref="GeneID:10496275"
                     /translation="MVRRSAQRQRGERTLPVKRMVLIGTEGRNKTEESYFKNFNQIQN
                     QFIVKFSSGNSTDAVGIVEDVKKSRDKKRNFRHDDLAFAVFDADLWRTQGNQIQEALH
                     YAKRQNIEVILSNPCFEVWFVLHFEDGKSPYNSSNGVIDRLKQHIPDYQKNKDIFGLL
                     RERMNEAIYHAEQLREYHEGKKTSEQNPMTDVDRVVKLLCGTGRGNSRSGGVHVGSLG
                     K"
     misc_feature    71246..71782
                     /locus_tag="Selsp_0073"
                     /note="RloB-like protein; Region: RloB; pfam13707"
                     /db_xref="CDD:258005"
     gene            71968..73269
                     /locus_tag="Selsp_0074"
                     /db_xref="GeneID:10496276"
     CDS             71968..73269
                     /locus_tag="Selsp_0074"
                     /note="InterPro IPR006311:IPR004843;
                     KEGG: afn:Acfer_0329 metallophosphoesterase;
                     PFAM: Metallo-dependent phosphatase;
                     SPTR: Putative metallophosphoesterase;
                     IMG reference gene:2504585525;
                     PFAM: Calcineurin-like phosphoesterase"
                     /codon_start=1
                     /transl_table=11
                     /product="metallophosphoesterase"
                     /protein_id="YP_004412513.1"
                     /db_xref="GI:330837933"
                     /db_xref="InterPro:IPR004843"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR008963"
                     /db_xref="InterPro:IPR015914"
                     /db_xref="GeneID:10496276"
                     /translation="MATEHQFNRRTFLKLAGGAAVLAGGGFLAQRFDVFGQAAKRLDK
                     MANPRKIEADFVRQIITRDSSVSRTIMWQSEAAESAAAVEWREVETTLVQRAAATNED
                     FTDDGRAAVLHAAGIEGLMPGRRYEYRLVNGEEASEWRPLTTPAESDNFKALIFPDSQ
                     SSDYSVWRDVAQGAWQRNRDAGFFVNMGDLVDNGEDHTQWDAWLSAVAPMIEQIPFAP
                     VMGNHETYDRNWQVRLPEAYLQEFAVPDNGSEAFSRYYYSFDYGTCHFAVLNSQMDEV
                     ADFKQGLLEEQLAWLPKDMEKSRKRWKIALLHKDVLQYRIHDRPERKEGFSYFGEVFM
                     PVFDALGIDLVLTAHLHTYHNRGHIEAFRRSPKGPTYILTGVAGDVRYPNLWVDHALD
                     EVVAPQPETDNYLVLEAKDAQLVVECFLPDGTRIDRVEMVK"
     misc_feature    72418..73170
                     /locus_tag="Selsp_0074"
                     /note="metallophosphatase superfamily, metallophosphatase
                     domain; Region: MPP_superfamily; cl13995"
                     /db_xref="CDD:265413"
     misc_feature    order(72439..72441,72532..72534,72631..72636,72889..72891,
                     73012..73014)
                     /locus_tag="Selsp_0074"
                     /note="active site"
                     /db_xref="CDD:163614"
     misc_feature    order(72439..72441,72532..72534,72631..72633,72889..72891,
                     73012..73014)
                     /locus_tag="Selsp_0074"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:163614"
     gene            complement(73314..73592)
                     /locus_tag="Selsp_0075"
                     /db_xref="GeneID:10496277"
     CDS             complement(73314..73592)
                     /locus_tag="Selsp_0075"
                     /note="COGs: COG3041 conserved hypothetical protein;
                     InterPro IPR012753:IPR007712:IPR004386;
                     KEGG: tde:TDE0505 hypothetical protein;
                     PFAM: Plasmid stabilisation system;
                     SPTR: Toxin-antitoxin system, toxin component, RelE
                     family;
                     TIGRFAM: Addiction module toxin, RelE/StbE; Conserved
                     hypothetical protein CHP00053;
                     IMG reference gene:2504585526;
                     PFAM: Plasmid stabilisation system protein;
                     TIGRFAM: addiction module toxin component, YafQ family;
                     addiction module toxin, RelE/StbE family"
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module toxin, RelE/StbE family"
                     /protein_id="YP_004412514.1"
                     /db_xref="GI:330837934"
                     /db_xref="InterPro:IPR004386"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="InterPro:IPR012753"
                     /db_xref="GeneID:10496277"
                     /translation="MYEIVYTNRMKRDVRRAKKRGKDISKLIKTLQLLQKGSDIPEQY
                     RDHALGGNLKDFRECHIEPDWLLIYQIHEDMLILLATATGTHADLFGE"
     misc_feature    complement(73323..73592)
                     /locus_tag="Selsp_0075"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3041"
                     /db_xref="CDD:225583"
     gene            complement(73594..73863)
                     /locus_tag="Selsp_0076"
                     /db_xref="GeneID:10496278"
     CDS             complement(73594..73863)
                     /locus_tag="Selsp_0076"
                     /note="InterPro IPR007337;
                     KEGG: tde:TDE0302 hypothetical protein;
                     PFAM: RelB antitoxin;
                     SPTR: Toxin-antitoxin system protein;
                     TIGRFAM: RelB antitoxin;
                     IMG reference gene:2504585527;
                     PFAM: RelB antitoxin;
                     TIGRFAM: addiction module antitoxin, RelB/DinJ family"
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module antitoxin, RelB/DinJ family"
                     /protein_id="YP_004412515.1"
                     /db_xref="GI:330837935"
                     /db_xref="InterPro:IPR007337"
                     /db_xref="GeneID:10496278"
                     /translation="MTTLQINVDDAVKENADRLFFSLGLDTSTAIQIFLKAAIAHEGI
                     PFPIAHPHTGLPADLKEAVEDSRQRRNLHGPFDSADEAVASMLED"
     misc_feature    complement(73621..73860)
                     /locus_tag="Selsp_0076"
                     /note="RelB antitoxin; Region: RelB; cl01171"
                     /db_xref="CDD:260818"
     gene            74245..76074
                     /locus_tag="Selsp_0077"
                     /db_xref="GeneID:10496279"
     CDS             74245..76074
                     /locus_tag="Selsp_0077"
                     /note="COGs: COG2194 membrane-associated metal-dependent
                     hydrolase;
                     InterPro IPR000917;
                     KEGG: vpr:Vpar_0824 sulfatase;
                     PFAM: Sulfatase;
                     SPTR: Integral membrane protein;
                     IMG reference gene:2504585528;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004412516.1"
                     /db_xref="GI:330837936"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496279"
                     /translation="MRFSIEEKNEGMRYVVAAFVFYFALVSFYINIGEDMTPANYLPW
                     LLPVIGALALFQYGARKRLFSLNHAPHLFAGVLWCVTFPLLYSWSYATPWYVSLIRLD
                     FLCGTGIFLLLASWQSLAFSYGKLSRPVAALFAALDFVCLAIPFVQIVYFSIYQHCLT
                     PASLMALYLTNPDESVDFLEAMLGIPALIGIVIAFLAFLWLCYRGNMRQARHLAAHPL
                     TAGKRAALFLLGCVLGVYIPFFVLPETSIALSWKEVSDYVAETQEYSAYYDERFAGLK
                     LDTPEDTLAAKAPGTVIVVIGESASRTFMKAYTPTFPYDDTPWLAARMEDPDFVVFRH
                     AYSCWSQTVPVLQRALTEQSQYNDKEFYDSTSLIDVAKKAGYNTYWFSNQGRYGQYDS
                     AITLVAKTADRAEWVDDSYLFTEKYDENLLQYLTEIDGSKNNFIVLHIMGSHIYYNNR
                     YPASFERWVNAAGGAGTNAESYANSILYTDDNLRRIFEYARDNLNLQAMVYFSDHGED
                     LEISHNPDVFNFHMVRIPMFVYMSPACQAAEPAVAAALRGHESQYFTNDMIYDTVAGI
                     LHAQSNHYDATQDFSSSAYRFTRDNLTTMLGQHALTEDVEEEK"
     misc_feature    74542..75981
                     /locus_tag="Selsp_0077"
                     /note="putative metal dependent hydrolase; Provisional;
                     Region: PRK11598"
                     /db_xref="CDD:183224"
     misc_feature    75115..75843
                     /locus_tag="Selsp_0077"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            76071..76829
                     /locus_tag="Selsp_0078"
                     /db_xref="GeneID:10496280"
     CDS             76071..76829
                     /locus_tag="Selsp_0078"
                     /note="InterPro IPR002781;
                     KEGG: bpu:BPUM_3167 hypothetical protein;
                     PFAM: Protein of unknown function DUF81;
                     SPTR: Putative membrane protein;
                     IMG reference gene:2504585529;
                     PFAM: Sulfite exporter TauE/SafE"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412517.1"
                     /db_xref="GI:330837937"
                     /db_xref="InterPro:IPR002781"
                     /db_xref="GeneID:10496280"
                     /translation="MIFFSMLILGALIGFVGAGGAGVVITLLTVGFGVPIHTALGVAL
                     ASMLFTMLSGAVSHFREGEVVVKTGAVLGAGGVLGALLGAEVSNVMPSEELGFLTALM
                     LLLSAFTLYMKVYRADLLDRIFHVRGELLAGRKLVVYGLTLGFVNGFLSGAFGIGAAA
                     FIQLTLLCVFGVPLLQSIGTCMMVILPISAAGGLGYMMNGRLDLAIFVQTLFGLMIGA
                     FVGAKCTHLAPRPLLKAAIVGMPTIGGFIMLFFR"
     misc_feature    76158..76814
                     /locus_tag="Selsp_0078"
                     /note="Sulfite exporter TauE/SafE; Region: TauE;
                     pfam01925"
                     /db_xref="CDD:250972"
     gene            76943..77359
                     /locus_tag="Selsp_0079"
                     /db_xref="GeneID:10496281"
     CDS             76943..77359
                     /locus_tag="Selsp_0079"
                     /note="KEGG: afl:Aflv_2564 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585530"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412518.1"
                     /db_xref="GI:330837938"
                     /db_xref="GeneID:10496281"
                     /translation="MEDSTNLREWTRHDIENLDENVRRVSERLASGEAKLAAIDEKLA
                     EFDAHFAALDRRFAELNARFEAFNARYEAASGQISELEKETQEACRMTQEVRRSTAYI
                     NARLEALEMAAMAVDLAPHREALKVLQVTGGKETMH"
     misc_feature    <76943..>77275
                     /locus_tag="Selsp_0079"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:233757"
     gene            77618..77694
                     /locus_tag="Selsp_R0003"
                     /db_xref="GeneID:10496282"
     tRNA            77618..77694
                     /locus_tag="Selsp_R0003"
                     /product="tRNA-Val"
                     /note="IMG reference gene:2504585531"
                     /db_xref="GeneID:10496282"
     gene            77995..79827
                     /locus_tag="Selsp_0080"
                     /db_xref="GeneID:10496283"
     CDS             77995..79827
                     /locus_tag="Selsp_0080"
                     /note="COGs: COG4784 Putative Zn-dependent protease;
                     InterPro IPR019734:IPR001915:IPR001440;
                     KEGG: afn:Acfer_2088 peptidase M48 Ste24p;
                     PFAM: Peptidase M48; Tetratricopeptide TPR-1;
                     SPTR: TPR domain protein;
                     IMG reference gene:2504585532;
                     PFAM: Peptidase family M48"
                     /codon_start=1
                     /transl_table=11
                     /product="peptidase M48 Ste24p"
                     /protein_id="YP_004412519.1"
                     /db_xref="GI:330837939"
                     /db_xref="InterPro:IPR001915"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:10496283"
                     /translation="MKIGKKLCAAILAGLLSIAPLAPHFPLAAQAEAAALNPVMIGMS
                     AIGGFLAYQGTLKEMLAIGNNVDYQISGLKQDMEENGEDKDALDREVVDCVLGRITEH
                     GEYALSINSLPFLWRVNAGAAFNAACYPTDYITVNRGLVRALHHDEDELAAVLGHEMT
                     HGLRQHSAKNYAKAVAESYAGIAIGSAADNLDWQKLNAVVGYAIAKDVTLPSELEADE
                     GGFHLMTTAGFNPGGGAAAMARMAYYLTYETQDIGEYQDPFENPDAPNYNDHPAMYER
                     VERLAAMMTNYGMGHVTVENGADVLIDGEKLLSADWDADYNNTTENAYLIAGGIAKAF
                     HDHASFDGWHFSAAPGARIAYLDDSRVYEKLKKFVMRNHAEERLEELVRNAYASSKDK
                     EMREKVAAEEKKRTDAWQKIRENALDAKGDYVKQLRYNADRYSDNGMAKEALFLMERA
                     FAARNPDNVAENYAIRGRAKAVAGDYEAALADSNHAVELDAANIYNFLNRADVYRMMG
                     DREKALADLEKSQEIDAKNPYIYKMRGEIYSEMGEKEAALAAYKEYWKQAPNASDIPD
                     EYMQEVDAAAYDKIVKEREKKEQEKKEKEAAKKGTPENKMGEKP"
     misc_feature    <78367..78846
                     /locus_tag="Selsp_0080"
                     /note="Peptidase family M48; Region: Peptidase_M48;
                     cl12018"
                     /db_xref="CDD:264511"
     misc_feature    79366..79566
                     /locus_tag="Selsp_0080"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    79390..79674
                     /locus_tag="Selsp_0080"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(79393..79395,79429..79431,79441..79443,79450..79452,
                     79495..79497,79531..79533,79543..79545,79552..79554,
                     79597..79599,79633..79635,79645..79647,79654..79656)
                     /locus_tag="Selsp_0080"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(79396..79401,79486..79491,79495..79500,79507..79512,
                     79588..79593,79600..79605,79612..79617)
                     /locus_tag="Selsp_0080"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    79471..79671
                     /locus_tag="Selsp_0080"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     gene            79918..80136
                     /locus_tag="Selsp_0081"
                     /db_xref="GeneID:10496284"
     CDS             79918..80136
                     /locus_tag="Selsp_0081"
                     /note="SPTR: NADH-ubiquinone oxidoreductase chain 3;
                     IMG reference gene:2504585533"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412520.1"
                     /db_xref="GI:330837940"
                     /db_xref="GeneID:10496284"
                     /translation="MGILAAVLVILLAILFLDDMELTAVSLIIAIPLAVTYQLTDSAV
                     LAAFTTFGILMLLGLLYRYRAAALQMRK"
     gene            complement(80752..81630)
                     /locus_tag="Selsp_0082"
                     /db_xref="GeneID:10496285"
     CDS             complement(80752..81630)
                     /locus_tag="Selsp_0082"
                     /note="COGs: COG1235 Metal-dependent hydrolase of the
                     beta-lactamase superfamily I;
                     InterPro IPR001279;
                     KEGG: tmt:Tmath_2182 beta-lactamase domain protein;
                     PFAM: Beta-lactamase-like;
                     SMART: Beta-lactamase-like;
                     SPTR: VicX protein;
                     IMG reference gene:2504585534;
                     PFAM: Metallo-beta-lactamase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="beta-lactamase domain protein"
                     /protein_id="YP_004412521.1"
                     /db_xref="GI:330837941"
                     /db_xref="InterPro:IPR001279"
                     /db_xref="GeneID:10496285"
                     /translation="MTSGGFLRAAESLAARACAMAAQPVQQQATVPKSAERGLRVAML
                     ASGSKGNAAYIELDGTRLLIDAGISARRITRSLADLGVDAASLDGVFITHEHSDHIKG
                     LPTLLKQYHLPLFAPPATLRAIRESLAVPEDTFTPLTGNVMLGAVSVKSFSTLHDAVS
                     PVGYAVCGSEKCALATDLGFLTNDVMTAIEGADALILEANHDRELLQRGSYPWHLKQR
                     ILSNRGHLSNSAAAWALVRLKKRPRAVFLAHMSQENNRPELVEETVRTILAQQNVRQE
                     NIVLAAQDVPTCFTLT"
     misc_feature    complement(80830..81519)
                     /locus_tag="Selsp_0082"
                     /note="Metal-dependent hydrolases of the beta-lactamase
                     superfamily I [General function prediction only]; Region:
                     PhnP; COG1235"
                     /db_xref="CDD:224156"
     gene            complement(81639..82496)
                     /locus_tag="Selsp_0083"
                     /db_xref="GeneID:10496286"
     CDS             complement(81639..82496)
                     /locus_tag="Selsp_0083"
                     /note="KEGG: lma:LmjF34.0690 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585535"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412522.1"
                     /db_xref="GI:330837942"
                     /db_xref="GeneID:10496286"
                     /translation="MGKSIFSRAGLITAEDKKDLEKRLEELEQAIDDMHDARRQQDRD
                     SIRRERSILSRIDEVERSVAERLDAMQAGLVREINALARSLPRDLSAFRSGSGIDTSA
                     LGTMMQKEIARQMAALHTAQEKGTQDLKDSLALTLQYVASTQEQGFADLLKRHSAIEI
                     GLVETAGQIAEDIEREHEALSGRIASLDTAQRDNGEAAKERERKQDEQTHQLQKFLQH
                     AATALETLAKKQDIGLMEGLLRLQEASQRTQGMIEDAEEDAQKEPPSLLAEKKSASFL
                     ILPNGVKRP"
     misc_feature    complement(<81714..>82457)
                     /locus_tag="Selsp_0083"
                     /note="chromosome segregation protein SMC, common
                     bacterial type; Region: SMC_prok_B; TIGR02168"
                     /db_xref="CDD:233757"
     gene            complement(82731..83405)
                     /locus_tag="Selsp_0084"
                     /db_xref="GeneID:10496287"
     CDS             complement(82731..83405)
                     /locus_tag="Selsp_0084"
                     /note="COGs: COG0692 Uracil DNA glycosylase;
                     HAMAP: Uracil-DNA glycosylase;
                     InterPro IPR002043:IPR005122;
                     KEGG: gmc:GY4MC1_3764 uracil-DNA glycosylase;
                     PFAM: Uracil-DNA glycosylase-like;
                     SPTR: Uracil-DNA glycosylase;
                     TIGRFAM: Uracil-DNA glycosylase;
                     IMG reference gene:2504585536;
                     PFAM: Uracil DNA glycosylase superfamily;
                     TIGRFAM: uracil-DNA glycosylase"
                     /codon_start=1
                     /transl_table=11
                     /product="Uracil-DNA glycosylase"
                     /protein_id="YP_004412523.1"
                     /db_xref="GI:330837943"
                     /db_xref="InterPro:IPR002043"
                     /db_xref="InterPro:IPR005122"
                     /db_xref="InterPro:IPR018085"
                     /db_xref="GeneID:10496287"
                     /translation="MKIFQNDWEGLLTDEMKKPYYQELRRFLIEEYRTRRIFPDMYAI
                     FNALHYTSYAETKVVILGQDPYHGEGQAHGLSFSVQAGVEPPPSLKNIFEELSSDLGC
                     RTPNNGCLAPWAKQGVLLLNTVLTVRAHAAASHHGHGWEQFTDRIIELLSAREKPLVF
                     ILWGAPARRKKAMIAAPPHAVIESAHPSPLSAFRGFFGSRPFSRANAFLESTGQTPID
                     WQLPDV"
     misc_feature    complement(82749..83351)
                     /locus_tag="Selsp_0084"
                     /note="Family 1 of Uracil-DNA glycosylase (UDG) enzymes;
                     Region: UDG_F1; cd10027"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(82848..82850,83040..83042,83142..83144,
                     83175..83180,83208..83222))
                     /locus_tag="Selsp_0084"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(82833..82844,82848..82853,82911..82916,
                     83142..83150,83205..83210,83214..83219))
                     /locus_tag="Selsp_0084"
                     /note="active site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(82836..82844,82848..82850,82911..82916,
                     83010..83015,83142..83150,83202..83210,83217..83219))
                     /locus_tag="Selsp_0084"
                     /note="UGI interface [polypeptide binding]; other site"
                     /db_xref="CDD:198425"
     misc_feature    complement(order(82848..82850,83214..83216))
                     /locus_tag="Selsp_0084"
                     /note="catalytic site [active]"
                     /db_xref="CDD:198425"
     gene            83560..85773
                     /locus_tag="Selsp_0085"
                     /db_xref="GeneID:10496288"
     CDS             83560..85773
                     /locus_tag="Selsp_0085"
                     /note="COGs: COG2199 FOG: GGDEF domain;
                     InterPro IPR000160:IPR001638;
                     KEGG: cdf:CD1476 putative signaling protein;
                     PFAM: Diguanylate cyclase, predicted; Extracellular
                     solute-binding protein, family 3;
                     SMART: Diguanylate cyclase, predicted;
                     SPTR: Diguanylate cyclase/phosphodiesterase with PAS/PAC
                     sensor;
                     TIGRFAM: Diguanylate cyclase, predicted;
                     IMG reference gene:2504585537;
                     PFAM: GGDEF domain; Bacterial extracellular solute-binding
                     proteins, family 3;
                     TIGRFAM: diguanylate cyclase (GGDEF) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase with extracellular sensor"
                     /protein_id="YP_004412524.1"
                     /db_xref="GI:330837944"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001638"
                     /db_xref="GeneID:10496288"
                     /translation="MNPVMRCGIIFFFVLLMLLAPQRLLHAMDSAPVLRVGCLDVSSF
                     PDGSPERLLFNYAKRYLNEVARSTGWQYEYVEMDEWTAREMLREGRIDMYFPAREMPG
                     DEGAFSFSVDSAAYSILSLYVREDSSLETNNPAVLANMRIGVLQDGLYSYALMPLVRE
                     QGVRVDVVEHQTAEALHGALARGEVDAILDSASRRKDGEKLLLRVALMPAKFIAAKKR
                     EGLLKNLSDTILYTERVNPSFETYLGKAFLDRAQNQLVRFNASENTYLASAPDLRVVY
                     VGGHEPFFGDRLEKGVPEGIYPSLLQALGETLGLRFRFVRAEDNEHALKMLREGEADI
                     FFCVYNNLPSMRDLFFTATFATEDFSYVVRRGAGDVPTGTARVALPRWFHGMRTYLNM
                     QHPNWQIVPVDEPVDCLRMIEEDGCDFALLPSLFLQQSSLLSMHPSLVVLASHSAEIP
                     VSIAISGEQPRVLQSVMTKGILKMDPRRVQEIVNEHMTGRLTLTAIVARYPMQTVALA
                     VVFLLSVFIAVFLIERSRVQRRQSEVLLAKNEELEKAVEEQKKLMRARDIYKQEAEID
                     PLTGLLNKKAIQSACEEMLGGTLKEGAVHAFFVMDLDHFKEMNDTYGHQAGDDVLRRF
                     AQEVRSIFRQSDHIGRFGGDEFTVLMPNVTTLVAVEHHARRLMTAAQELEVRDDRSLL
                     SVSIGIALAPLHGTNYDDLFMAADAALYDVKRAGRNGWKIYDVKEDGGTLCPKEK"
     misc_feature    83737..>84126
                     /locus_tag="Selsp_0085"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(83797..83799,83851..83853,84004..84006)
                     /locus_tag="Selsp_0085"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(84076..84078,84088..84090,84109..84111)
                     /locus_tag="Selsp_0085"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    84373..84981
                     /locus_tag="Selsp_0085"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    85252..85719
                     /locus_tag="Selsp_0085"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(85360..85362,85489..85491)
                     /locus_tag="Selsp_0085"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(85375..85377,85384..85389,85399..85401,85411..85413,
                     85477..85479,85483..85494)
                     /locus_tag="Selsp_0085"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(85465..85467,85552..85554)
                     /locus_tag="Selsp_0085"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     gene            85755..87101
                     /locus_tag="Selsp_0086"
                     /db_xref="GeneID:10496289"
     CDS             85755..87101
                     /locus_tag="Selsp_0086"
                     /note="InterPro IPR019734:IPR013105:IPR001440;
                     KEGG: afn:Acfer_1229 hypothetical protein;
                     PFAM: Tetratricopeptide TPR2; Tetratricopeptide TPR-1;
                     SMART: Tetratricopeptide repeat;
                     SPTR: Putative lipoprotein;
                     IMG reference gene:2504585538;
                     PFAM: Mannosyl-glycoprotein
                     endo-beta-N-acetylglucosaminidase; Tetratricopeptide
                     repeat"
                     /codon_start=1
                     /transl_table=11
                     /product="Tetratricopeptide TPR_2 repeat-containing
                     protein"
                     /protein_id="YP_004412525.1"
                     /db_xref="GI:330837945"
                     /db_xref="InterPro:IPR001440"
                     /db_xref="InterPro:IPR002901"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:10496289"
                     /translation="MPEGKMTGTMRRLLARAALAALLAACAGAPLPSVAQAAQGTPDS
                     AVQGAQAATDTGAKKDAAVPVFVARPHFAADLPAEVNEKAAAEVRFFIAEPLTEPILE
                     EEAPPESIEILGAAEATQAQMAAFIRRRNPQPKLACSVEEIVRLYYEEAGAEGVRADI
                     ALCQALKETGFFAYGGDVLPAQNNYCGLGATGNKAKGAYFATPQEGVRAHIQHLMAYA
                     TTERPHAPLVDPRYDLVRLYRTDIYGKIKHWTGLNGVWAVPGTSYGQDILLLCREATT
                     PDASDASLAFAEKKLAEKKNAAAYVYRAIVFAKRGESERAAADLEAALRLSPKSAAAL
                     YDRALFFTAAGDEKRAKADLEALIKAQPDFVYAWYNLGVMNLKAGRNNAAMRDFERVL
                     ALVPQSANAQSNIGIALVREKKYREAWRAFAQAAEINTTNPTVLMNQIVFAACLKE"
     misc_feature    86190..>86483
                     /locus_tag="Selsp_0086"
                     /note="Mannosyl-glycoprotein
                     endo-beta-N-acetylglucosaminidase; Region:
                     Glucosaminidase; cl17361"
                     /db_xref="CDD:266650"
     misc_feature    86637..86840
                     /locus_tag="Selsp_0086"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    86649..86945
                     /locus_tag="Selsp_0086"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(86649..86651,86655..86660,86667..86672,86757..86762,
                     86766..86771,86778..86783,86859..86864,86871..86876,
                     86883..86888)
                     /locus_tag="Selsp_0086"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(86664..86666,86700..86702,86712..86714,86721..86723,
                     86766..86768,86802..86804,86814..86816,86823..86825,
                     86868..86870,86904..86906,86916..86918,86925..86927)
                     /locus_tag="Selsp_0086"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    86739..86942
                     /locus_tag="Selsp_0086"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    86850..>87068
                     /locus_tag="Selsp_0086"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(86850..86855,86859..86864,86871..86876,86961..86966,
                     86970..86975,86982..86987,87063..87068)
                     /locus_tag="Selsp_0086"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    86850..87041
                     /locus_tag="Selsp_0086"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    order(86868..86870,86904..86906,86916..86918,86925..86927,
                     86970..86972,87006..87008,87018..87020,87027..87029)
                     /locus_tag="Selsp_0086"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            87432..88322
                     /locus_tag="Selsp_0087"
                     /db_xref="GeneID:10496290"
     CDS             87432..88322
                     /locus_tag="Selsp_0087"
                     /note="InterPro IPR006842;
                     KEGG: tde:TDE0948 hypothetical protein;
                     PFAM: Transposase (putative), YhgA-like;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585539;
                     PFAM: Putative transposase, YhgA-like;
                     TIGRFAM: conserved hypothetical protein (putative
                     transposase or invertase)"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase YhgA family protein"
                     /protein_id="YP_004412526.1"
                     /db_xref="GI:330837946"
                     /db_xref="InterPro:IPR006842"
                     /db_xref="GeneID:10496290"
                     /translation="MEKEAKGRQYQDTVFRLYFNDEQRLKEVAGALHGRSYARDPLKI
                     VTLDGTFLSQIKNDISFLLAQQHLIFMEHQSTANKNMALRCLYYVCEQWRQYVPAKKL
                     YQNTRIELPAPEFHVFYSGDGDMPETYQMKLSDAYRKPESDENINLELKVCFHNISYD
                     EAKILLQKSRTLHDYSFFIDRIKKNMTSGMARAQAIREAMRYCEEHDIMAEFLQQHER
                     EVVDMVNFEWNQKDFEEAILEEGIERGMKRGRAEGCEEGKVAIVLEMLRDKLPLETIA
                     RLSKFSMERVQELGRRHSLL"
     misc_feature    <87633..88298
                     /locus_tag="Selsp_0087"
                     /note="conserved hypothetical protein (putative
                     transposase or invertase); Region: T_den_put_tspse;
                     TIGR01784"
                     /db_xref="CDD:130844"
     misc_feature    <87636..>87737
                     /locus_tag="Selsp_0087"
                     /note="Putative transposase, YhgA-like; Region:
                     Transposase_31; pfam04754"
                     /db_xref="CDD:252779"
     gene            89083..90897
                     /locus_tag="Selsp_0088"
                     /db_xref="GeneID:10496291"
     CDS             89083..90897
                     /locus_tag="Selsp_0088"
                     /note="COGs: COG2831 Hemolysin activation/secretion
                     protein;
                     InterPro IPR013686;
                     KEGG: avn:Avin_37880 hypothetical protein;
                     PFAM: Polypeptide-transport-associated, ShlB-type;
                     SPTR: Outer membrane protein, OMP85 family;
                     IMG reference gene:2504585540;
                     PFAM: POTRA domain, ShlB-type"
                     /codon_start=1
                     /transl_table=11
                     /product="Polypeptide-transport-associated domain protein
                     ShlB-type"
                     /protein_id="YP_004412527.1"
                     /db_xref="GI:330837947"
                     /db_xref="InterPro:IPR013686"
                     /db_xref="GeneID:10496291"
                     /translation="MKMQDAEKMRHRPFAVKRCRRLSFAVTLALFSAVLTPFCAEAGT
                     VSDAAGDAQRAMVRAAAGEAPMMGASAVDVPKTEGAEAAASPDVTRVGVEAPALRQAE
                     QQAAESAILVRRYTFSGENPVTDEELRALLKPHKLKYARLADLEEQAAEVTKYLRSKG
                     YFVAFAYLAPQDFADGTVDFTIVPGRYDKVVVNNNSYLTENAIRREMGLSSGELVKKA
                     PLNRGVWLTNDLSRVEARTQIKAGSRQGTSDIVIDVKNKGNRMWGYVGVDNGGYRYTG
                     RYQYSAFFNYASPFREGDLFSVGGVVSNGGMWSGSASYSTPLAKQGERVGVSYARSHY
                     TLGGAFSALDYTGTSETVSLWWQHNFQRSRDFNLYGTLRFDWKDLEDEAKGMAYKNPK
                     GAKNWVIGINGDNLDHIWTGGRNTFALNYTYGDLSIDDEVQRRYDAATARTAGHFGKW
                     NLNLTRLQHIDDRLSLYLSYSRQWANKNLDSSEKFSLGGPYGVRAYPVGEASGDDGWR
                     WTSELRWNLPTREGDENIWQLIAFVDGGHVGLYHDGWSGYTGPQSRSLYGAGVGVNWS
                     NQANWVAHLHYAWKIGREEATSDTDRSGRFWFQLYKFF"
     misc_feature    89113..>89520
                     /locus_tag="Selsp_0088"
                     /note="Protein of unknown function (DUF3348); Region:
                     DUF3348; pfam11828"
                     /db_xref="CDD:256652"
     misc_feature    89155..90891
                     /locus_tag="Selsp_0088"
                     /note="Hemolysin activation/secretion protein
                     [Intracellular trafficking and secretion]; Region: FhaC;
                     COG2831"
                     /db_xref="CDD:225387"
     misc_feature    89410..89637
                     /locus_tag="Selsp_0088"
                     /note="POTRA domain, ShlB-type; Region: POTRA_2;
                     pfam08479"
                     /db_xref="CDD:117056"
     misc_feature    89950..90894
                     /locus_tag="Selsp_0088"
                     /note="Surface antigen; Region: Bac_surface_Ag; pfam01103"
                     /db_xref="CDD:250364"
     gene            91000..93003
                     /locus_tag="Selsp_0089"
                     /db_xref="GeneID:10496292"
     CDS             91000..93003
                     /locus_tag="Selsp_0089"
                     /note="InterPro IPR006311:IPR008638:IPR011102;
                     KEGG: mgm:Mmc1_2695 filamentous haemagglutinin outer
                     membrane protein;
                     PFAM: Filamentous haemagglutinin, N-terminal, bacterial;
                     SMART: Signal transduction histidine kinase, HWE region;
                     SPTR: Putative uncharacterized protein;
                     TIGRFAM: Filamentous haemagglutinin, N-terminal,
                     bacterial; Twin-arginine translocation pathway, signal
                     sequence;
                     IMG reference gene:2504585541;
                     PFAM: haemagglutination activity domain;
                     TIGRFAM: filamentous haemagglutinin family N-terminal
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="filamentous hemagglutinin family outer membrane
                     protein"
                     /protein_id="YP_004412528.1"
                     /db_xref="GI:330837948"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="InterPro:IPR008638"
                     /db_xref="InterPro:IPR011050"
                     /db_xref="InterPro:IPR012334"
                     /db_xref="GeneID:10496292"
                     /translation="MRFMKKQRRARKERGESNPFLLRLQENVRRALLGGVGIVAAGAA
                     LVGTSSPASALPQGGEVAAGAADIAKSQAEMAIHQATENAVINWQSFNIAANERVNIF
                     QPNAQAALLNRVLGGSPSEIFGTLTANGRVFLVNPAGVLFAPGAQVDAGAITAAAMNI
                     TNADFMAGKYAFVGAAESGKVINRGTLRAADAGAVALLGKDVVNEGVIVAKKGAAVLA
                     AAEDVTLDFTGDGKVAVVPSKAAMKESVTNKGIVEADGGLVFMTAATGDALVSSAVNQ
                     EGVVRAASLDGKAGAIRMTANDVRLAAGSVTDVSGAKAGTVEIGGGWQGTGDLAHAEN
                     VTVERGAAVRADATAADAAGGTVAVWSDGRTKFAGEITARGAGTGAGGAVETSGKKVQ
                     ITGRVDASSAAGKAGEWLIDPGDIEVKTRGTGDPEAGSQADVQTVTNSLNGGTSVTIQ
                     TANLTGNDDHSITVTDAINKTAGGDATLSLKATGSVNINADISSTAGKLNVDITSDTN
                     HRAGGRVSVASGKNIKTLGGNVKIGGGLMDSGVGFANSQSAGEAGIMLNGVTIDTTDG
                     TTASGNVELAGSTTANAAGVSLAGTTITAGAGKVTLVGKSTGGGKGIALGGNITTRSV
                     ELRTEFPRPLGHDHGRWRPRRHGEGLDAFGREDHQLWHRHGRT"
     misc_feature    91096..>92796
                     /locus_tag="Selsp_0089"
                     /note="Large exoproteins involved in heme utilization or
                     adhesion [Intracellular trafficking and secretion];
                     Region: FhaB; COG3210"
                     /db_xref="CDD:225751"
     misc_feature    91252..91482
                     /locus_tag="Selsp_0089"
                     /note="filamentous hemagglutinin family N-terminal domain;
                     Region: adhes_NPXG; TIGR01901"
                     /db_xref="CDD:130956"
     gene            93104..102412
                     /locus_tag="Selsp_0090"
                     /db_xref="GeneID:10496293"
     CDS             93104..102412
                     /locus_tag="Selsp_0090"
                     /note="InterPro IPR008619;
                     KEGG: pin:Ping_2394 filamentous haemagglutinin outer
                     membrane protein;
                     SPTR: Hemaglutinin repeat-containing domain protein;
                     IMG reference gene:2504585542"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412529.1"
                     /db_xref="GI:330837949"
                     /db_xref="GeneID:10496293"
                     /translation="MTADEDLEMYTGAGTLTVSGAVNIASTHALTLGSKNAMTGAGVI
                     TADALKLDAADATVNLTGANAVKKLDGKAKGLTFKNSGNLTVGGETGLVTAAGGASLD
                     VTGDLTVGAHGMTNAAGAMKLKASGTLKLDANAEVKSTGAAATSLEANTVEFASASKV
                     STAGGTIDVKTDALTLPAGAQGTLSSANGKVTVETKTSGKTMSVGSSSADVHMNDLDF
                     INSGTGEVHLGNASTGNVEISTADVKAPLTVESGATLKFSGTLSNTAGKNTTFKANAV
                     DFAAGANLAAGAGTMTMVTDAVTNWSNVTFADSNAKGTFALQPKTVGNFTVGGSSALV
                     SDAGLGKLKAGNFYNVAIGTKENVGTATIAGIASGNLPKYTSILTKGKINVTGAVVGT
                     SADTLALHADAPGATLGDGLSQSAPITVGNLLLLGKGSMDLSTQANKIENIAADMADG
                     DLKLKNQTNMKVAVVENRTVTPKVNVDGLKTKSTDIKMDAGKKLTVAGNLRSTDDTKI
                     EADDLDLGNNKVNVGKKLTLEKATKSQAINIGTGAGDWNINNSAYGEIKIGGATQTGN
                     INIKGATFKKPSDIETTGDVTLTGATKAGADGKSDMKIKAHAATLPTASDTLAVKNLD
                     LDLSGGIDLGLGKINGQKDGKVTAKGASASQDIYISDNAADAPSTEFRIAYRTINNTL
                     DGFGGFDVAGEKHVYFYGGSVKKSINAAGKLGVEVRDNLTIEGKGTKLKIGADPTQAG
                     HDPASVITGGFTVKQGKTVHVKGVDGTSKENGAEINIQTAGNIHLEQGATLKVEGNYA
                     QATLNARNGDVVLNEDAKVQVAPGSTPVWVDVTGKKLQLDARAQLDSGTDTVGALRVH
                     TDEIVTPTADDNTTNIVGKSGLVITRKTAGDLTLNNASTGAGLHVTSDQLNGKLFGKD
                     FSELVLGDNRSQTVTIDGLEANNRVVVKTAETGKTVIGAGGLKVGTDGSGKDYKVTLT
                     TGEIENSGGAGIMNIGEGSTLNLYTNNITNLAAHGSSPSVTGTGTLGIGTYNGSKTIG
                     LGDGATGDLQLTNNKFTQVFGSNFSHYAIGNGTQGTINVKNSSLGKDVTLQADNINFA
                     GDMTLAAGKTLVVNAKTAANQTAGKITAANLAAVGGNIALEQANEIGTLAADALSVKV
                     KSNALTIGEITTPAGAPVPSRTITGVKAGESGGTAGDVVLSADAMTFTEGVEGKGNLT
                     VQQANAATNLNVGATGTGLNLPASLFGGAKIKDGFKHVYLGREDATGATKVGGNLNFV
                     DPTTIRSGKTAGSMTVDGSANIQTNGNDFALESKDLTTAAGSSIDTGTGALTLKTDAM
                     NLNGKMKGKKALNILPISHDRDIKLGGEVNDPAKLSLLDKYFNGNNRQFWEYEIINIG
                     DRGGGGRLYQSGTIDMPFTVNIQQAITSGQGGVNLSGSIKTHGRDYTVASREVNLDDA
                     HINADGADRDHDGNVAIQADKLNTANGSTITGHGDVSFDTYTPDKTLNFGTPGAGGSA
                     SDPTLPSDIFSGTGLLRKNSDGKGFRKIRIGGTNAGDIKVGNVDLPEGLADAVSIKTN
                     KDVTSTGVLKSVPTLEVDAHNVNLTGPNEIKNLGNITSATGVSVETKGGTNVTGVIKG
                     NNAAINIKNKDGGNVTIAPGGQIVGTGTSDVLIEAKGGAFKNKGGANAIQTAPGQRYV
                     VHTEDSVENEIDGLVFEFRRYGTDYTQRGSVTIPPGKNAMFYKYQPELKLYSTRAYGD
                     DNAAFFNSTAGFHIEDDGNLKRRALDKTEVDYIRNHVQDSGTHNFGTTKLTNVNADVN
                     TADGTVTNAMTDVTRRAGTHTYGSNSSIANEKITYQGHNDLNYKITVDYRIVPRVVTV
                     TGKTSTVNYDGNPHSYTGNAGVTFSNFANSQTENTTGLLSGAVSYTPIADAAKTSGYA
                     QGAVHAGEYSVDLKNSTLSATNYKFKYVPGKLTIKPIDIHFTAPSGERIYGTANDSVT
                     IPTPSYTGSLVSGDSFAKYTVTAVDGGGNAVTERTGVGSYTMSLQGVALTTGSRSLAT
                     DYNITSGTGTLTIKKRALTITAGDKSRVYGDANTTAGYVNHTAKVNVAAATATTGLVN
                     GDAIDDVTETIDPTATATTNAGTAGLWTKASAAHFSSGTAANYDITYVNGHFNITKRP
                     LTLVAGDKSRIYGTANSTANYVNGTNLFRVKSGTNLVNGDAVSTVTETIDARATVTTD
                     AGTAGLKTKIANAVFGTGNANNYDISYEDGSFAITPRDLTLRAGSKTRIYGTENSTAV
                     YTGGTSKFRADGATATTGLVNGDTIADVDESTDALVTTNAGTAGLKTQIANARFGAGR
                     ASNYNIHYVDGGFDITKRDLYITAGDKSRIYGDANETAHYVNGTNRLNVRAADATTGL
                     ANGDRISSITETIDPSATVTTNAGTAGLWTKVSAAQFSHGTAANYNIHYADGAFTITK
                     RALTLLAGDKSRIYGTANTTAGYVNGTNLFRVKAGTNLVNGDTVSTVAETIDSRATVT
                     TDAGTAGLKTKIANAVFGTGNANNYDISYEDGSFAVTPRDLTLRAGSKTRIYGTENST
                     AVYTGGTSKFRADASTATTGLVNGDAVADVDESTDALVTTNAGTAGLKTQIANARLMG
                     NRKASNYNIHYVDGGFDITKRDLYIKGGDKSRAYGAANSLAQYVNGTSRINVRHADAT
                     TGLVNGDRISSITETIDPLATITTDAGTPHLWTRVSDVQFGSGLASNYTIHYADGSFA
                     IVPREVLVTAGNASRDYGAPNPVVTEYTVERGDYTSERGLLAGDDLTGVATYYDAAIT
                     PQTAGGTYAGVIHVDPASVNAGYRGATALSNYRFSYAPGALKINLRGFDMSTPEGRVV
                     TTGSITASQIIANLSHGHTGGVSGMTGIGSGGASMRGGAGSIGGTSAGSANAGTSSGS
                     SAGTTGTAAGAPSAEQLHDTSFADGVAVDMPKDLAATNWQSRVVVTAGGASEAHDYVE
                     GADGSFGFDLAKTRGNYGIHDEIPGGTSEAIPVLFTDGGSRDLDGIYSVNYGPGKLAI
                     KPASKKVEIPDPKEIRHAAEKALSFLYQTKNGAFEVTFGNGIVTLYPKDAPALNIVVS
                     KDKKAERAVLASGLLTAIEDLGVTPVEIRAVYIFKELGESAE"
     gene            complement(102486..103349)
                     /locus_tag="Selsp_0091"
                     /db_xref="GeneID:10496294"
     CDS             complement(102486..103349)
                     /locus_tag="Selsp_0091"
                     /note="KEGG: tde:TDE0948 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585543;
                     PFAM: Putative transposase, YhgA-like"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412530.1"
                     /db_xref="GI:330837950"
                     /db_xref="InterPro:IPR006842"
                     /db_xref="GeneID:10496294"
                     /translation="MRRTKRSYKDSLFRDIFNNRERLPEIYEALLGLKATPQDITLAT
                     IDETLFSGIKNDVGFIVRNEYVLLAEHQSTINANMPLRLFMYLAEIYRQYVNEDAVYK
                     RESIALPAPRFYVFYNGSTEMPDCWEHHLSDAFGGRKGDMDLNVTVLNINDKPQRPIL
                     EKCPSLKSYSVFVAQVREHVKKGGTLESAIGEAVQYCIAHDYLRDYFRQKHTKEVFDM
                     LNFAWNQERALEVRAEEAMEKGLAQGVMQTTAASICHIMKSFNVSMEKAMDVLQIPTA
                     ERAKYAQLVKG"
     misc_feature    complement(<102978..103322)
                     /locus_tag="Selsp_0091"
                     /note="Putative transposase, YhgA-like; Region:
                     Transposase_31; pfam04754"
                     /db_xref="CDD:252779"
     gene            103632..104831
                     /locus_tag="Selsp_0092"
                     /db_xref="GeneID:10496295"
     CDS             103632..104831
                     /locus_tag="Selsp_0092"
                     /note="InterPro IPR001119;
                     KEGG: vpr:Vpar_0557 S-layer domain protein;
                     PFAM: S-layer homology domain;
                     SPTR: Putative S-layer domain protein;
                     IMG reference gene:2504585544;
                     PFAM: S-layer homology domain"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer domain-containing protein"
                     /protein_id="YP_004412531.1"
                     /db_xref="GI:330837951"
                     /db_xref="InterPro:IPR001119"
                     /db_xref="GeneID:10496295"
                     /translation="MKKTLTAALTTALVVGAASTTFAAANPFSDVPADHWAYDAVAQL
                     ADDGVIEGYGDGTYRGQNEITRYEMAQMVAKAMAKEDQVNAQQKAMIDRLAAEFSEEL
                     NNLGVRVSNLESRIDNVKWTGKLQYEYTRTKYDGVDATTEHDLKFRLEPTATVNDHWK
                     VKARLDAKWDTNNDTGKDGNVKLKRAYVAGHYGITDINAGLIPYYSEQGVVFDENLSG
                     ASVTVGADQTLSGTLVAGRKREGGEASNVQGVNITWRPTEEFTGAAEYYRASVSGEYN
                     NIWGIGATYNIAKTAALNGGYWKNTTQNDSDINRAWNVQLSYKGAEQENMHSFGLFAA
                     YRRLGEAVAVEPTFDAVKSGEKGWEVGGDYTFAKNIVGTLKYFNGRHITSDTKLNRFY
                     GSLEYFF"
     misc_feature    103710..103841
                     /locus_tag="Selsp_0092"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     misc_feature    103836..>104225
                     /locus_tag="Selsp_0092"
                     /note="Protein of unknown function (DUF3373); Region:
                     DUF3373; pfam11853"
                     /db_xref="CDD:256673"
     gene            104943..105155
                     /locus_tag="Selsp_0093"
                     /db_xref="GeneID:10496296"
     CDS             104943..105155
                     /locus_tag="Selsp_0093"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585545"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412532.1"
                     /db_xref="GI:330837952"
                     /db_xref="GeneID:10496296"
                     /translation="MRDFKKFMEENRDKLYKIAYANCKHDAEGHCLVPSDDPWMKDAE
                     GTARSRNFDPEGAECISIAEIIYRKI"
     gene            105742..108378
                     /locus_tag="Selsp_0094"
                     /db_xref="GeneID:10496297"
     CDS             105742..108378
                     /locus_tag="Selsp_0094"
                     /EC_number="3.6.3.8"
                     /note="COGs: COG0474 Cation transport ATPase;
                     InterProIPR006408:IPR001757:IPR004014:IPR008250:IPR
                     005834:IPR006068;
                     KEGG: aoe:Clos_2053 calcium-translocating P-type ATPase,
                     PMCA-type;
                     PFAM: ATPase, P-type, ATPase-associated domain; ATPase,
                     P-type cation-transporter, N-terminal; Haloacid
                     dehalogenase-like hydrolase; ATPase, P-type
                     cation-transporter, C-terminal;
                     PRIAM: Calcium-transporting ATPase;
                     SMART: ATPase, P-type cation-transporter, N-terminal;
                     SPTR: Calcium-translocating P-type ATPase, PMCA-type;
                     TIGRFAM: ATPase, P-type, calcium-transporting, PMCA-type;
                     ATPase, P-type, K/Mg/Cd/Cu/Zn/Na/Ca/Na/H-transporter;
                     IMG reference gene:2504585546;
                     PFAM: E1-E2 ATPase; Cation transporting ATPase,
                     C-terminus; haloacid dehalogenase-like hydrolase; Cation
                     transporter/ATPase, N-terminus;
                     TIGRFAM: plasma-membrane calcium-translocating P-type
                     ATPase; ATPase, P-type (transporting), HAD superfamily,
                     subfamily IC"
                     /codon_start=1
                     /transl_table=11
                     /product="calcium-translocating P-type ATPase, PMCA-type"
                     /protein_id="YP_004412533.1"
                     /db_xref="GI:330837953"
                     /db_xref="InterPro:IPR000695"
                     /db_xref="InterPro:IPR001757"
                     /db_xref="InterPro:IPR004014"
                     /db_xref="InterPro:IPR005834"
                     /db_xref="InterPro:IPR006068"
                     /db_xref="InterPro:IPR008250"
                     /db_xref="InterPro:IPR018303"
                     /db_xref="GeneID:10496297"
                     /translation="MKIQGLTDEEVRASRERHGTNGITEQKGEGFWEKLKGSFDDPII
                     KILCVALAINVVFAILGQVAWYESVGIALAVILATTVATYSEYQNENAFQKLQEEASL
                     IKCKVYRNGTLTEIPIDEIVMGDFVLLQTGDKIPADGVICDGSIQVDQSVLNGEAKEA
                     AKTPAPEGDEEAEKSSDFLHPHKVFRGSVVCGGNAVMRTTTLGDKTFYGKIAGELQAD
                     EDRDTPLKVKLSNLAHQISNFGYIGGVAIAIAFMFQRLVIHNGFDMARIMAYCSNWLV
                     VAHDLVDAVMLAVIIIVVAVPEGLPLMIAIVSAQNMGKMLKDNVLVRKISGIETAGSL
                     NLLFSDKTGTITKGQLEAVAFVDGAGTQYAAYSELGAGLKKLVNLSVRYNTSAVINGK
                     EVVGGNATERAIFGFVAADSAEMDEKVKNAVPFNSKNKYSLSEVAGEYSVTLAKGAPE
                     KILALCDSYYDENGEKKPLTNRAAITDCIDALAARAIRVLALAVYEGAIPADGTLPAS
                     GLVFVGAVGIRDEVRPESVEAIRRVHSAGVQVVMITGDRQDTASAIAREAGLLSRDDD
                     VAMTSDELAALDDAAVKALLPRLRVVARALPTDKSRLVRLAQEMNLVVGMTGDGVNDS
                     PALKQADVGFAMGSGTEVAKEASDIVILDDNFKSLARAILYGRTIYNSIRKFIVFQLT
                     INVAAVMISFAAPLLGMETPLSITQFLWINLVMDTLAALAFGGEPALRRFMDEKPKQR
                     DESIISKYMVSSIGVGSLWCFALSLYFLMSGAAHAYFRPDEANHYLLTGYFAFFIFMA
                     VFNAFNARTDSKNLFDNISHNPGFLRVMGLIVVIQVAMTYLGGEILHCYGLTLTEWAF
                     VLGMAVTIVPIDLLRKMVAGKV"
     misc_feature    105745..108342
                     /locus_tag="Selsp_0094"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: MgtA; COG0474"
                     /db_xref="CDD:223550"
     misc_feature    <105751..105900
                     /locus_tag="Selsp_0094"
                     /note="Cation transporter/ATPase, N-terminus; Region:
                     Cation_ATPase_N; pfam00690"
                     /db_xref="CDD:250059"
     misc_feature    105952..106731
                     /locus_tag="Selsp_0094"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    106891..107118
                     /locus_tag="Selsp_0094"
                     /note="Putative hydrolase of sodium-potassium ATPase alpha
                     subunit; Region: Hydrolase_like2; pfam13246"
                     /db_xref="CDD:257602"
     misc_feature    107245..107649
                     /locus_tag="Selsp_0094"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    order(107245..107247,107371..107376)
                     /locus_tag="Selsp_0094"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    107245..107256
                     /locus_tag="Selsp_0094"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    107371..107373
                     /locus_tag="Selsp_0094"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     misc_feature    107839..108363
                     /locus_tag="Selsp_0094"
                     /note="Cation transporting ATPase, C-terminus; Region:
                     Cation_ATPase_C; pfam00689"
                     /db_xref="CDD:250058"
     gene            108451..109926
                     /locus_tag="Selsp_0095"
                     /db_xref="GeneID:10496298"
     CDS             108451..109926
                     /locus_tag="Selsp_0095"
                     /note="COGs: COG4110 Uncharacterized protein involved in
                     stress response;
                     InterPro IPR003325:IPR019303;
                     KEGG: ppy:PPE_00942 tellurium resistance protein TerA;
                     PFAM: Bacterial stress protein; Tellurium resistance;
                     SPTR: Tellurium resistance protein TerA;
                     IMG reference gene:2504585547;
                     PFAM: Tellurium resistance protein; Bacterial stress
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="YP_004412534.1"
                     /db_xref="GI:330837954"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="InterPro:IPR019303"
                     /db_xref="GeneID:10496298"
                     /translation="MGMNISKGQKADLTKNNAGLRSVLVGMGWQANSAIDLDAAAFLL
                     GAGGKVAGDADFVFYGNARHASGAVEHIAAPSGGDRQQVRVDLAAVPASIEKIAVTAT
                     IYDADARRQNFSQVAGAYVRVLDAASGAELLRYDLGQGFSVETAIVVGELYRYKGEWK
                     FSAVGAGFSGGLEALCKNFGVEVGEGQGAAPAAPPAPPTAQPRPAAPPAPAAPPTAQP
                     RPAAPTAPPASPAPAAPPAQRPPLNLGRPGAAPAPAPHAPLNLGRPGGAPPVPPVPTA
                     APPVQPPTAPKKVELKKGQKVSLVKGGGGLGEIAINLNWHQQPQTKKQGLLASIFGGG
                     GGAGGIDLDLGCLYELQDGEIGCVQALGNDFGSLSRRPWIALDGDDRTGSNAAGETLR
                     VNGKMASKIKRILVYTFIYEGVANWQQADGVVTVKCPGSPDIIVRMDEYGSSKAMCAI
                     AMLENINDTFSVEKLVHFFSGHKSMDKAYHWGLRWEPGSKD"
     misc_feature    108508..108990
                     /locus_tag="Selsp_0095"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(108556..108558,108562..108564,108691..108693)
                     /locus_tag="Selsp_0095"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     misc_feature    109366..109890
                     /locus_tag="Selsp_0095"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(109471..109473,109477..109479,109615..109617)
                     /locus_tag="Selsp_0095"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            110138..110743
                     /locus_tag="Selsp_0096"
                     /db_xref="GeneID:10496299"
     CDS             110138..110743
                     /locus_tag="Selsp_0096"
                     /note="COGs: COG2310 Uncharacterized protein involved in
                     stress response homologs of TerZ and putative cAMP-binding
                     protein CABP1;
                     InterPro IPR019303:IPR003325;
                     KEGG: drm:Dred_0337 stress protein;
                     PFAM: Bacterial stress protein; Tellurium resistance;
                     SPTR: Tellurium resistance protein TerD;
                     IMG reference gene:2504585548;
                     PFAM: Tellurium resistance protein; Bacterial stress
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="YP_004412535.1"
                     /db_xref="GI:330837955"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="InterPro:IPR019303"
                     /db_xref="GeneID:10496299"
                     /translation="MGVNLQKGQKVNLKKSDGQALSRIRIGLGWDPVEQKKGGLFGSI
                     FGGSAPDIDCDASVIVCKGGRLSGKKDVVYFGNLKHPSGAIVHTGDNLTGEGEGDDEQ
                     ILVDLTAVPADYDKLVFVVNIYDCESRKQDFGMIANAFIRICDERTGEEFCRYNLSES
                     YAGMTAMIFGEIYRYNGEWKFNAIGQGTKDKGLNELARRYQ"
     misc_feature    110198..110737
                     /locus_tag="Selsp_0096"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(110294..110296,110300..110302,110438..110440)
                     /locus_tag="Selsp_0096"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            110900..111478
                     /locus_tag="Selsp_0097"
                     /db_xref="GeneID:10496300"
     CDS             110900..111478
                     /locus_tag="Selsp_0097"
                     /note="COGs: COG2310 Uncharacterized protein involved in
                     stress response homologs of TerZ and putative cAMP-binding
                     protein CABP1;
                     InterPro IPR003325;
                     KEGG: ctc:CTC02234 tellurium resistance protein TerD;
                     PFAM: Bacterial stress protein;
                     SPTR: Tellurium resistance protein TerD;
                     IMG reference gene:2504585549;
                     PFAM: Bacterial stress protein"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="YP_004412536.1"
                     /db_xref="GI:330837956"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="GeneID:10496300"
                     /translation="MAISLKKGQKVDLTKGNPGLSKLLIGLGWDTNKYDGGSDFDLDA
                     SAFLLGPNEKVTSDADFVFYGNLKHASGAVEHTGDNLTGEGEGDDEQIKVDLSKVPAS
                     IDKIDFTVTIYEADERKQNFGQVSNAFIRVVNEATGEELIRFDLGEDFSIETAVVVGR
                     LYRQGAEWKFNAIGAGYSGGLGALGKAYGVNV"
     misc_feature    110957..111466
                     /locus_tag="Selsp_0097"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(111020..111022,111026..111028,111167..111169)
                     /locus_tag="Selsp_0097"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            111587..112276
                     /locus_tag="Selsp_0098"
                     /db_xref="GeneID:10496301"
     CDS             111587..112276
                     /locus_tag="Selsp_0098"
                     /note="COGs: COG2013 conserved hypothetical protein;
                     InterPro IPR002838;
                     KEGG: dae:Dtox_1044 protein of unknown function DUF124;
                     PFAM: Protein of unknown function DUF124;
                     SPTR: Putative uncharacterized protein;
                     TIGRFAM: Protein of unknown function DUF124;
                     IMG reference gene:2504585550;
                     PFAM: Protein of unknown function DUF124;
                     TIGRFAM: TIGR00266 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412537.1"
                     /db_xref="GI:330837957"
                     /db_xref="InterPro:IPR002838"
                     /db_xref="InterPro:IPR016031"
                     /db_xref="GeneID:10496301"
                     /translation="MMEYKILYPEAFPVVECSLRHGEAIKAESDAMIAMDATVDVEGK
                     MEGGVLGGIMRRVFTGESFFLQRLVASRGAGKVLFGHPLPGGIMDVALDGSYGMIVQK
                     GGFLAAEETVNIDSKMQGLMQGFFSQEGFFLLKLTGKGIAFLSSYGVIHVLNLEAGEE
                     VIVDNGHLVAWPDYMNYKIEKASNGWISSVMSGECLVCRFRGPGPVLIQTRNPSGFET
                     WIQEIVRKGGK"
     misc_feature    111596..112222
                     /locus_tag="Selsp_0098"
                     /note="Mitochondrial biogenesis AIM24; Region: AIM24;
                     pfam01987"
                     /db_xref="CDD:251018"
     gene            112278..112862
                     /locus_tag="Selsp_0099"
                     /db_xref="GeneID:10496302"
     CDS             112278..112862
                     /locus_tag="Selsp_0099"
                     /note="COGs: COG2310 Uncharacterized protein involved in
                     stress response homologs of TerZ and putative cAMP-binding
                     protein CABP1;
                     InterPro IPR003325;
                     KEGG: cno:NT01CX_0666 stress protein;
                     PFAM: Bacterial stress protein;
                     SPTR: Tellurium resistance protein TerD;
                     IMG reference gene:2504585551;
                     PFAM: Bacterial stress protein"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="YP_004412538.1"
                     /db_xref="GI:330837958"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="GeneID:10496302"
                     /translation="MAVNLSKGQRVSLDKGMTMALVGLGWDVNQYDGGADFDLDASAF
                     LLGANGKVRKDEDFIFYGNLDSQDGSVHHTGDNLTGEGEGDDEVLTIDFTKVPADVDK
                     IAITVTIYEAQVRKQNFGQVSNAYVRVARMANAQDMQGTEVLRFDLMEEFSVETALVV
                     CEIYRHNGEWKFNAVGAGYQGGLEALCRAYGVNV"
     misc_feature    112341..112850
                     /locus_tag="Selsp_0099"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(112389..112391,112395..112397,112536..112538)
                     /locus_tag="Selsp_0099"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            113004..113885
                     /locus_tag="Selsp_0100"
                     /db_xref="GeneID:10496303"
     CDS             113004..113885
                     /locus_tag="Selsp_0100"
                     /note="COGs: COG2310 Uncharacterized protein involved in
                     stress response homologs of TerZ and putative cAMP-binding
                     protein CABP1;
                     InterPro IPR003325;
                     KEGG: dae:Dtox_2988 stress protein;
                     PFAM: Bacterial stress protein;
                     SPTR: Tellurium resistance protein TerD;
                     IMG reference gene:2504585552;
                     PFAM: Bacterial stress protein"
                     /codon_start=1
                     /transl_table=11
                     /product="stress protein"
                     /protein_id="YP_004412539.1"
                     /db_xref="GI:330837959"
                     /db_xref="InterPro:IPR003325"
                     /db_xref="GeneID:10496303"
                     /translation="MEREQARGESAMSTAGGSLAALPKFIDLGAFAPECENSFAVAAS
                     PEAEVRVTAEIADARVSPEVLPAGAGGFLLTLPAVRAGSVVYGALSMRSASEERRIFI
                     AGEARAGAPERRARSPEPPLPQLVRGERLRLAGSEKLAFRYEDEGREPGVEVDAYVFR
                     LYAGGRVHGDEDLIFFGNARADDDSIEVNAAGGVGASVDVAKVGAAVERLVLCFSVYD
                     DGTGRDFSHVRAPRLTLAEDGVPKYSFYLDGLRREKTVNAVEIYRHRGAWKLKLVGAG
                     YEAGLARLCEDYGLSVE"
     misc_feature    113448..113870
                     /locus_tag="Selsp_0100"
                     /note="Uncharacterized proteins involved in stress
                     response, similar to tellurium resistance terD; Region:
                     TerD_like; cd06974"
                     /db_xref="CDD:132992"
     misc_feature    order(113460..113462,113466..113468)
                     /locus_tag="Selsp_0100"
                     /note="putative metal binding site [ion binding]; other
                     site"
                     /db_xref="CDD:132992"
     gene            113934..114968
                     /locus_tag="Selsp_0101"
                     /db_xref="GeneID:10496304"
     CDS             113934..114968
                     /locus_tag="Selsp_0101"
                     /note="COGs: COG2301 Citrate lyase beta subunit;
                     KEGG: ppm:PPSC2_c1007 citrate lyase beta subunit-like
                     protein;
                     SPTR: Putative ATP/GTP-binding protein;
                     IMG reference gene:2504585553"
                     /codon_start=1
                     /transl_table=11
                     /product="citrate lyase beta subunit-like protein"
                     /protein_id="YP_004412540.1"
                     /db_xref="GI:330837960"
                     /db_xref="InterPro:IPR011206"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="GeneID:10496304"
                     /translation="MDVCSCDLSRREDREILQYKVGGLLYMPAYQENIVEKIRRQKNE
                     HLTAICFCLEDAIGDMAVADAERVLRTNLAALKEVCKEEGRETPLLFVRVRTADHMEH
                     FLDFVGAAGDILTGYVLPKVNLGNVEAYMELMRSVNDGAAKKRYLMPVLESPSIADIK
                     SRAAVLGELKAIFDAHREYVLNIRVGGNDFSNLYGVRRSIAHTIYEVGVVRDILIDIL
                     NIFARDYIVSGPVWNYFGDDPAGAWAAGLKRELELDRLSGFIGKTVIHPAQLPFVFES
                     LKAERADYEDAKMICGWQDEKAGVKKSWDGTRMNEVKTHAKWAKRVLTLAEIYGVKDD
                     GAAAAAESKR"
     misc_feature    113976..114950
                     /locus_tag="Selsp_0101"
                     /note="C-C_Bond_Lyase of the TIM-Barrel fold; Region:
                     C-C_Bond_Lyase; pfam15617"
                     /db_xref="CDD:259748"
     gene            114981..115997
                     /locus_tag="Selsp_0102"
                     /db_xref="GeneID:10496305"
     CDS             114981..115997
                     /locus_tag="Selsp_0102"
                     /note="KEGG: bbe:BBR47_58710 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585554"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412541.1"
                     /db_xref="GI:330837961"
                     /db_xref="InterPro:IPR005479"
                     /db_xref="InterPro:IPR013816"
                     /db_xref="InterPro:IPR013817"
                     /db_xref="GeneID:10496305"
                     /translation="MRIWFNQWFSTAYHLIELMRAGSPGKFTFVGSSANPNALYRLVS
                     DEWYTEPALPVSDEYVEYCLEFCKAHHIDIFFPRRALTLLSRYREEFLAAGTKLAVGS
                     DYKIMRLLDDKAATYAFFEARDASLVPAHLIAGTYEEFCAAYESLRPHCARVCYKLTK
                     DEGAETFRVIDDTLLRSGDVRRKPGMKLTWDMARTVVRGYDFSVPFMLMPYLEGQEIS
                     VDCLRTPGEEIIIPRFKTNHRYSEVRFDEEIVEKCRTMMNLLQIDVPINIQFKGDGEK
                     YCLLEINPRMSGGLQLSCLATGINVPDIAVHQLLGEEKPWQYPDRQKVYRVANLETPK
                     RLKA"
     misc_feature    114984..115988
                     /locus_tag="Selsp_0102"
                     /note="ATP-grasp in the biosynthetic pathway with Ter
                     operon; Region: ATPgrasp_Ter; pfam15632"
                     /db_xref="CDD:259762"
     misc_feature    115305..115847
                     /locus_tag="Selsp_0102"
                     /note="ATP-grasp domain; Region: ATP-grasp_4; cl17255"
                     /db_xref="CDD:266590"
     gene            116008..117132
                     /locus_tag="Selsp_0103"
                     /db_xref="GeneID:10496306"
     CDS             116008..117132
                     /locus_tag="Selsp_0103"
                     /note="InterPro IPR000836:IPR022537;
                     KEGG: nwa:Nwat_2032 hypothetical protein;
                     PFAM: Domain of unknown function DUF3706;
                     Phosphoribosyltransferase;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585555;
                     PFAM: Phosphoribosyl transferase domain; Protein of
                     unknown function (DUF3706)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412542.1"
                     /db_xref="GI:330837962"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="InterPro:IPR022537"
                     /db_xref="GeneID:10496306"
                     /translation="MKYMADAVLRVARRHRNEKRGYLLVNPLQGKHIPVAPHEALDLM
                     EALGAKVKAAAPATRLVIGFAETATAIGAVVAKSLADACLYVQTTREELPSGVRTIEF
                     LEEHSHAPEQRLAVDALEAQLAETDTVVFVDDEISTGRTLCNIVEQMKEELPALCEKR
                     LVAASVLNRLTASDRERLLACGVECVALVELAPEDYEARAAAFQTRGAADCRVPSRHY
                     PYRTLALGEHATPRTGVAIGDYTILWQGAGLVLAERIAWAKHESILVLGTEECMLPGL
                     MVGRVLEQKGWQSVFFHATTRSPIGISEEAGYPIEAGWQVKSFYGDERATYIYNLRPY
                     HHAVIVSDTAHEAHEAVESIARALRESGCTDIVYLMSRDE"
     misc_feature    116134..116538
                     /locus_tag="Selsp_0103"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(116200..116202,116206..116208,116404..116412,
                     116416..116430,116512..116514)
                     /locus_tag="Selsp_0103"
                     /note="active site"
                     /db_xref="CDD:206754"
     misc_feature    116602..117081
                     /locus_tag="Selsp_0103"
                     /note="TRSP domain C terminus to PRTase_2; Region: TRSP;
                     pfam12500"
                     /db_xref="CDD:257091"
     gene            117150..118202
                     /locus_tag="Selsp_0104"
                     /db_xref="GeneID:10496307"
     CDS             117150..118202
                     /locus_tag="Selsp_0104"
                     /note="KEGG: aoe:Clos_0704 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585556;
                     PFAM: Protein of unknown function (DUF2983)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412543.1"
                     /db_xref="GI:330837963"
                     /db_xref="InterPro:IPR011215"
                     /db_xref="GeneID:10496307"
                     /translation="MFSTYKKDDVTILLKDITGKLDPLPTAEREKLIQSGRHYSEMLP
                     LEYEPSEKYLKAYFDALSRYAEITAHAAASLAEKIYEEKGASAALVSLARAGTPIGIL
                     LKRYIKRRFGADVAHYTISIIRGRGIDKNAMAYILARHAPEALQFVDGWTGKGAIARE
                     LANDAAEFRGVSAGLAVLSDPAYVAEKCGTHEDFLIASSCLNSTVSGLLSRTVLRDDL
                     IGEADFHGAAFYEELREKDLTYDFIEAVERRFPEEAPPVREEGAAHRSGLAEVERIAG
                     DFGIRDINLVKPGIGEATRVLLRRLPWKLLVKSRTDEARLGHLYQLAKEKGVEIVEYP
                     LENYLACGLIRSLADN"
     misc_feature    117156..117899
                     /locus_tag="Selsp_0104"
                     /note="Phosphoribosyl transferase (PRTase); Region:
                     PRTase_1; pfam11202"
                     /db_xref="CDD:256350"
     misc_feature    117900..118193
                     /locus_tag="Selsp_0104"
                     /note="PELOTA RNA binding domain; Region: PELOTA_1;
                     pfam15608"
                     /db_xref="CDD:259739"
     gene            118204..118956
                     /locus_tag="Selsp_0105"
                     /db_xref="GeneID:10496308"
     CDS             118204..118956
                     /locus_tag="Selsp_0105"
                     /note="InterPro IPR013200;
                     KEGG: fri:FraEuI1c_0978 hypothetical protein;
                     PFAM: HAD superfamily hydrolase-like, type 3;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585557"
                     /codon_start=1
                     /transl_table=11
                     /product="Haloacid dehalogenase domain protein hydrolase
                     type 3"
                     /protein_id="YP_004412544.1"
                     /db_xref="GI:330837964"
                     /db_xref="GeneID:10496308"
                     /translation="MKDIVFASDLDNTLLYSRSHKREGDVCVEHIKGEAHGFMTRLAV
                     ERLREVSQKVQLIPVTTRSVEQYRRIEWPEGTAPEYAVTTNGAVLLKNGEADAAWREA
                     HDALIAPAREEIARCHALYLGDRAFIRCRIVDDAYLFVYCADGVDAQAQAEKCQRETS
                     LRVEPSGRKIYFFPPKLTKGAALRELRRRFSPRKVYAAGDTAIDAPLLAAADRAFAAK
                     TLAMEDAAHIRRHTGEGVFAEWLLAELLQEID"
     misc_feature    118216..118827
                     /locus_tag="Selsp_0105"
                     /note="HAD-superfamily hydrolase, subfamily IIB; Region:
                     HAD-SF-IIB; TIGR01484"
                     /db_xref="CDD:233434"
     gene            119026..119904
                     /locus_tag="Selsp_0106"
                     /db_xref="GeneID:10496309"
     CDS             119026..119904
                     /locus_tag="Selsp_0106"
                     /note="KEGG: ere:EUBREC_1097 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585558"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412545.1"
                     /db_xref="GI:330837965"
                     /db_xref="GeneID:10496309"
                     /translation="MAQGRQYQDTVFRAYMNDVDRLRDVAGALHGRTYASVERVRIVT
                     LDGTFLSQMKNDISFLLAGRHLVFMEHQSTLNQNMPLRCLYYLCEQLRQYIPAKSLYQ
                     NKQIPLPRPEFHVFYTGSKDTLEMEQMRLSDAYMEGEGDIHLELKVTFHNIAYGSEKM
                     LLRMSRPLHDYSFFLNCIKTNIAGGMERVRAIREAMRYCMEHDVMKEFLQEHESEVID
                     MVNFEWNQKDFEEAVREEGWEQGAAQGREEGREEEKSAFILGMLKEKLPLETIARVSK
                     MSVERIQELGRMHSLL"
     gene            119926..120459
                     /locus_tag="Selsp_0107"
                     /db_xref="GeneID:10496310"
     CDS             119926..120459
                     /locus_tag="Selsp_0107"
                     /note="COGs: COG1670 Acetyltransferase including
                     N-acetylase of ribosomal protein;
                     InterPro IPR000182;
                     KEGG: cst:CLOST_0135 gcn5-related N-acetyltransferase;
                     PFAM: GCN5-related N-acetyltransferase (GNAT) domain;
                     SPTR: Putative spermidine N1-acetyltransferase;
                     IMG reference gene:2504585559;
                     PFAM: Acetyltransferase (GNAT) family"
                     /codon_start=1
                     /transl_table=11
                     /product="GCN5-related N-acetyltransferase"
                     /protein_id="YP_004412546.1"
                     /db_xref="GI:330837966"
                     /db_xref="InterPro:IPR000182"
                     /db_xref="InterPro:IPR016181"
                     /db_xref="GeneID:10496310"
                     /translation="MQGIVKKGPRLQFRQAEEKDLDYILEVEFRPENGKFVIPWEREV
                     HSQTLNTEGAIHLVIERIDTLEPVGFLMIAGLNNPSKEIEWTRIILDKKGEGYGHETL
                     KLLKSWAFDDLKFHRAWLDCKDYNARALHVYESEGLVREGLIRETILTDGVYENLVIL
                     GILDREYFARKERGEEL"
     misc_feature    119953..120441
                     /locus_tag="Selsp_0107"
                     /note="Acetyltransferases, including N-acetylases of
                     ribosomal proteins [Translation, ribosomal structure and
                     biogenesis]; Region: RimL; COG1670"
                     /db_xref="CDD:224584"
     misc_feature    120121..120336
                     /locus_tag="Selsp_0107"
                     /note="Acetyltransferase (GNAT) family; Region:
                     Acetyltransf_1; pfam00583"
                     /db_xref="CDD:249979"
     gene            120456..121649
                     /locus_tag="Selsp_0108"
                     /db_xref="GeneID:10496311"
     CDS             120456..121649
                     /locus_tag="Selsp_0108"
                     /EC_number="5.4.2.7"
                     /note="COGs: COG1015 Phosphopentomutase;
                     InterPro IPR010045:IPR006124;
                     KEGG: cpy:Cphy_3719 phosphopentomutase;
                     PFAM: Metalloenzyme;
                     PRIAM: Phosphopentomutase;
                     SPTR: Phosphopentomutase;
                     TIGRFAM: Phosphopentomutase;
                     IMG reference gene:2504585560;
                     PFAM: Metalloenzyme superfamily;
                     TIGRFAM: phosphopentomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphopentomutase"
                     /protein_id="YP_004412547.1"
                     /db_xref="GI:330837967"
                     /db_xref="InterPro:IPR006124"
                     /db_xref="InterPro:IPR010045"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496311"
                     /translation="MKKIKRVFLIVLDSLGVGAAPDAADFGDGACNTLLSLVRSEGFS
                     APHLASLGLFSVDGIKDAAEAVALRVPAPRGAFARLRESSRGKDTTTGHWELAGVVGE
                     HPMPTYPAGFPPEIIAALEASIGRKLICNKPYSGTQVIHDYGREHIETGALIVYTSAD
                     SVLQLAAHENVVPREELYEACRKARVIMCGKHGVGRVIARPFIGEYPNYERTAGRHDF
                     SLEPPATVLDALKDAGFASIGVGKISDIFAGKGLTKSLGTNEDNADGMKKTRSLLGED
                     FTGLAFVNLVDFDMVFGHRRDTRGYARAVMEFDAWLGDFLTAMKEADVLMITADHGCD
                     PGAPGTDHTREYVPLLAYGVAVRAGCDLGTRPAFADVGATIAEIFGVELVTRGRSFWR
                     EIAAG"
     misc_feature    120468..121637
                     /locus_tag="Selsp_0108"
                     /note="phosphopentomutase; Provisional; Region: PRK05362"
                     /db_xref="CDD:235430"
     gene            121813..123198
                     /locus_tag="Selsp_0109"
                     /db_xref="GeneID:10496312"
     CDS             121813..123198
                     /locus_tag="Selsp_0109"
                     /note="InterPro IPR001119;
                     KEGG: afn:Acfer_1669 S-layer domain protein;
                     PFAM: S-layer homology domain;
                     SPTR: Porin; major outer membrane protein;
                     IMG reference gene:2504585561;
                     PFAM: S-layer homology domain"
                     /codon_start=1
                     /transl_table=11
                     /product="S-layer domain-containing protein"
                     /protein_id="YP_004412548.1"
                     /db_xref="GI:330837968"
                     /db_xref="InterPro:IPR001119"
                     /db_xref="GeneID:10496312"
                     /translation="MRFYKKRTALLALAFAALSATAFAADGADSFSDVPKDHWSYEAL
                     DYLAKNGVIEGYTDGTFQGNRTMSRYEMAAITARAMQASNLDIGARSVLEKLEKEYGS
                     ELAALRAQVEQNTEDIRKNREAIERFKVHGFVRTQYDYDKNTDADTLDRSANRFYMDL
                     RLDMKVNDIWTVKAQSETNRHYNNGHLRSENALGTDTWQQTWSGHDGNFQRIWVEAQQ
                     DGRWLNLGRAWRGLGFQNVLFGNESDGFQFGIPIKGTNLTASGFWMASTGAGNKESLY
                     GVGLWGAVGHNFDINVAYARSSLGKNESYTSGLIDHYEADPVTHRVFPVYRDNDRTNP
                     RSYGYVVSAATNVAKNVRVIGDYVQTDADEQNKSVALRLNYKGTKLDDVGSFGVYARY
                     VRYGANGWLAGDDEWGSTWNGTKGWIVGFKYVPWKNVEWETLFSRQKRDYGTSAEYNR
                     SLLRTQLDYHF"
     misc_feature    121900..122031
                     /locus_tag="Selsp_0109"
                     /note="S-layer homology domain; Region: SLH; pfam00395"
                     /db_xref="CDD:249828"
     gene            123555..123779
                     /locus_tag="Selsp_0110"
                     /db_xref="GeneID:10496313"
     CDS             123555..123779
                     /locus_tag="Selsp_0110"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585562"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412549.1"
                     /db_xref="GI:330837969"
                     /db_xref="GeneID:10496313"
                     /translation="MAVKKTGAATKLILKVQMGTDKKGLPTYGQRMVQNVNPALGDED
                     FLAIGKSLGGLQSHTLKDVMRQDAAALTEE"
     misc_feature    123567..123704
                     /locus_tag="Selsp_0110"
                     /note="Protein of unknown function (DUF1659); Region:
                     DUF1659; pfam07872"
                     /db_xref="CDD:254478"
     gene            123849..124061
                     /locus_tag="Selsp_0111"
                     /db_xref="GeneID:10496314"
     CDS             123849..124061
                     /locus_tag="Selsp_0111"
                     /note="InterPro IPR021321;
                     PFAM: Protein of unknown function DUF2922;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585563;
                     PFAM: Protein of unknown function (DUF2922)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412550.1"
                     /db_xref="GI:330837970"
                     /db_xref="InterPro:IPR021321"
                     /db_xref="GeneID:10496314"
                     /translation="MAKALKMVFKLSDTQTATVSLADPKAGLTKAEAEAVMTDMIAKN
                     ALVVKGVNPKAIKAVYIRSSEDQELA"
     misc_feature    123855..124031
                     /locus_tag="Selsp_0111"
                     /note="Protein of unknown function (DUF2922); Region:
                     DUF2922; pfam11148"
                     /db_xref="CDD:256317"
     gene            124212..125354
                     /locus_tag="Selsp_0112"
                     /db_xref="GeneID:10496315"
     CDS             124212..125354
                     /locus_tag="Selsp_0112"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585564"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412551.1"
                     /db_xref="GI:330837971"
                     /db_xref="GeneID:10496315"
                     /translation="MKIQGNGDGSIGMKKGLLQGERLVGNKGHESTIAASQKQKEYVG
                     EPGKSAVSPAYHVSVSKEGKGLAALHGAAAQNGSEAAMQDAAAKQSVEQLDMSGNAHL
                     KPLRAEDLDWATEYERASLAETMRGVESGIGAVLRGAAENPLAVGADIQMYLVRQLNA
                     YGHHQKALGHSLAGDPYLSSVLERLDALDPKGENPLVSEIRSLVSTTMSGKNIELFEK
                     DGHSDLVRRYCAYLGIHMGDAMKVKDKAGDYFNDKTAIYAFFQEMSRKAKCTEELLEA
                     MLGDRAGEKVEERERSSDLSQLIAERKSGLEDGMTVYKESLRKLHRADGDAGEGEDGK
                     LSERERAEEKKSLIPSVTGYDWQRISEKYLHENPELAAIFADNGMG"
     gene            125583..125969
                     /locus_tag="Selsp_0113"
                     /db_xref="GeneID:10496316"
     CDS             125583..125969
                     /locus_tag="Selsp_0113"
                     /note="COGs: COG2204 Response regulator containing
                     CheY-like receiver AAA-type ATPase and DNA-binding
                     domains;
                     InterPro IPR001789;
                     KEGG: amt:Amet_3255 two component, sigma54 specific, Fis
                     family transcriptional regulator;
                     PFAM: Signal transduction response regulator, receiver
                     domain;
                     SMART: Signal transduction response regulator, receiver
                     domain;
                     SPTR: Chemotaxis protein CheY;
                     IMG reference gene:2504585565;
                     PFAM: Response regulator receiver domain"
                     /codon_start=1
                     /transl_table=11
                     /product="response regulator receiver protein"
                     /protein_id="YP_004412552.1"
                     /db_xref="GI:330837972"
                     /db_xref="InterPro:IPR001789"
                     /db_xref="InterPro:IPR011006"
                     /db_xref="GeneID:10496316"
                     /translation="MARKCKILISDDSKLLRKQLREELEALDCEVIETENGKEAIAES
                     LGDRPDGVILDIVMPEVNGVEVLRVIKEIDDTIPVVMLSSAGTPEKLMETLKLGALDF
                     IQKPYTPEQIKNAITRIRKKAGLDEQ"
     misc_feature    125604..125939
                     /locus_tag="Selsp_0113"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(125613..125618,125745..125747,125769..125771,
                     125829..125831,125886..125888,125895..125900)
                     /locus_tag="Selsp_0113"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    125745..125747
                     /locus_tag="Selsp_0113"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(125754..125759,125763..125771)
                     /locus_tag="Selsp_0113"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    125895..125903
                     /locus_tag="Selsp_0113"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            125959..126816
                     /locus_tag="Selsp_0114"
                     /db_xref="GeneID:10496317"
     CDS             125959..126816
                     /locus_tag="Selsp_0114"
                     /note="KEGG: hmo:HM1_2628 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585566"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412553.1"
                     /db_xref="GI:330837973"
                     /db_xref="GeneID:10496317"
                     /translation="MSNDLLFPQFLLNRGVLDVTEVRIFLERMLAAKVDVPVQALFHG
                     VATAADLASLGALSGAEFRASAEREGVLTASQLYNLGEAIAGEGCRFAQALLDAGRLD
                     YKELERLLGDFKRAGEHPLSEAIQRAADGRLAEELPLYTEYVGVAMLAFKRFMKIACV
                     VVPQAESFAEGVPCRLVSQAITGGVSLVAGLEAPDAVFLALARRYSHEDFSELDDLAV
                     DSLAEFLNVLDGFFAVRLGERDLELDLEIPRTAHALNAKASPSKFLRLHLESPVGAFG
                     LLLATDEFL"
     misc_feature    126487..126744
                     /locus_tag="Selsp_0114"
                     /note="Chemotaxis phosphatase CheX; Region: CheX; cl15816"
                     /db_xref="CDD:265789"
     gene            126969..127060
                     /locus_tag="Selsp_R0004"
                     /db_xref="GeneID:10496318"
     tRNA            126969..127060
                     /locus_tag="Selsp_R0004"
                     /product="tRNA-Ser"
                     /note="IMG reference gene:2504585567"
                     /db_xref="GeneID:10496318"
     gene            127423..128529
                     /locus_tag="Selsp_0115"
                     /db_xref="GeneID:10496319"
     CDS             127423..128529
                     /locus_tag="Selsp_0115"
                     /EC_number="1.12.99.6"
                     /note="COGs: COG1740 Ni Fe-hydrogenase I small subunit;
                     InterPro IPR001821:IPR006311:IPR006137;
                     KEGG: vpr:Vpar_1188 hydrogenase (NiFe) small subunit HydA;
                     PFAM: NADH:ubiquinone oxidoreductase-like, 20kDa subunit;
                     PRIAM: Hydrogenase (acceptor);
                     SPTR: Quinone-reactive Ni/Fe-hydrogenase, small subunit;
                     TIGRFAM: [Ni-Fe]-hydrogenase, small subunit; Twin-arginine
                     translocation pathway, signal sequence;
                     IMG reference gene:2504585568;
                     PFAM: NADH ubiquinone oxidoreductase, 20 Kd subunit;
                     TIGRFAM: hydrogenase (NiFe) small subunit (hydA)"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase (NiFe) small subunit HydA"
                     /protein_id="YP_004412554.1"
                     /db_xref="GI:330837974"
                     /db_xref="InterPro:IPR001821"
                     /db_xref="InterPro:IPR006137"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:10496319"
                     /translation="MDKRESMWERYLRNGLSRRDFLKGCVALTSLMGLDTGMVSKVVE
                     AAESKPLPVVIWMHGHECTGCDESFIRSAAPMASDLVLNMIALEYSHVLSAASGEPFE
                     AHLEQTIEKYKGQYILAVEGAIATKDNGVYCMSGGHPFINTFQRVAKDAAAIIAYGTC
                     ATSGGIQAAAPNPTGSAGVSHYVGNKPVINVPGCPPIPEVMTGVVMHVALFGSVPDLD
                     MESRPKQFYGNRIHDTCYRRPFFDAGMFAERFDDAGSKAGWCLYKLGCRGPETYASCG
                     NLRWFQGMSYPIQSGAPCIGCTNANFWDDAPFSDRLPKYGPLGSIDKIGVGLAVGTAA
                     GVAVHGALSLAQRAKADAAIEKEEEKAKREQVHK"
     misc_feature    127435..128475
                     /locus_tag="Selsp_0115"
                     /note="Ni,Fe-hydrogenase I small subunit [Energy
                     production and conversion]; Region: HyaA; COG1740"
                     /db_xref="CDD:224654"
     misc_feature    127606..128046
                     /locus_tag="Selsp_0115"
                     /note="NADH ubiquinone oxidoreductase, 20 Kd subunit;
                     Region: Oxidored_q6; pfam01058"
                     /db_xref="CDD:250330"
     misc_feature    128101..128346
                     /locus_tag="Selsp_0115"
                     /note="NiFe/NiFeSe hydrogenase small subunit C-terminal;
                     Region: NiFe_hyd_SSU_C; pfam14720"
                     /db_xref="CDD:258857"
     gene            128526..130433
                     /locus_tag="Selsp_0116"
                     /db_xref="GeneID:10496320"
     CDS             128526..130433
                     /locus_tag="Selsp_0116"
                     /EC_number="1.12.2.1"
                     /note="COGs: COG0374 Ni Fe-hydrogenase I large subunit;
                     InterPro IPR001501;
                     KEGG: vpr:Vpar_1187 nickel-dependent hydrogenase large
                     subunit;
                     PFAM: Nickel-dependent hydrogenase, large subunit;
                     PRIAM: Cytochrome-c3 hydrogenase;
                     SPTR: Uptake hydrogenase large subunit;
                     IMG reference gene:2504585569;
                     PFAM: Nickel-dependent hydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="Cytochrome-c3 hydrogenase"
                     /protein_id="YP_004412555.1"
                     /db_xref="GI:330837975"
                     /db_xref="InterPro:IPR001501"
                     /db_xref="InterPro:IPR018194"
                     /db_xref="GeneID:10496320"
                     /translation="MKHVTVDPVTRIEGHLRVEVQVDEATGKVTDALSSGTAWRGLEL
                     VMNGRDPRDAWAYIQRICGVCTTAHALCSVRAVEDALGIRIPTNANYIRNIMAGCLTV
                     QDHLVHFYHLHALDWVSPVEALAADPVAAANLQREILKLRLPLAGPAGLNTEAYPKDF
                     PNATPEYFAAFKQKIEQIVKSGQLGIFAANWWDHPDYKILPPEVHLIAVVHYLEMLDK
                     HRELMTPHVVFGGKNPHAHYVVGGMPCAISLDDGNAPINTARLAIVDRAVNLTRTIVN
                     EYYLPDVLAIGSLYVKAGKVDGGGLAKHCVMAFGQFPDQSYTGTRNGDFMRQLLIRSN
                     GVVENFGAGLAAATFTEVKAEDLSDPVAFTEGVEHSWYEYEGAESDLHPWAGQTKPKY
                     TAPKVGTQTNWQELNEKGKYSWLKTPKWRGKLAEVGPLARYIIIYVKAKKGLLPDPTW
                     AEQLMLNQMDAVSKAIGLAPEVWLPTMVGRTAARALDAQLNAEIEKYYFDKLIANIKG
                     GDLAVATSDKWDPVTWPKEAKGVGLYDAPRGALSHWVVIKNGKIANYQCVVPTTWNAC
                     PRDDAAGHGAYEMAMMDTRVAVPDKPLEIVRVIRSFDPCMACSTHVYNANGDTLKIMT
                     TDPYAGLQVEE"
     misc_feature    128526..130376
                     /locus_tag="Selsp_0116"
                     /note="Ni,Fe-hydrogenase I large subunit [Energy
                     production and conversion]; Region: HyaB; COG0374"
                     /db_xref="CDD:223451"
     gene            130515..131231
                     /locus_tag="Selsp_0117"
                     /db_xref="GeneID:10496321"
     CDS             130515..131231
                     /locus_tag="Selsp_0117"
                     /note="COGs: COG1969 Ni Fe-hydrogenase I cytochrome b
                     subunit;
                     InterPro IPR000516:IPR005797;
                     KEGG: tal:Thal_1107 Ni/Fe-hydrogenase, b-type cytochrome
                     subunit;
                     PFAM: Cytochrome b/b6, N-terminal;
                     SPTR: Ni/Fe-hydrogenase, B-type cytochrome subunit;
                     TIGRFAM: Nickel-dependent hydrogenase b-type cytochrome
                     subunit;
                     IMG reference gene:2504585570;
                     PFAM: Cytochrome b(N-terminal)/b6/petB;
                     TIGRFAM: Ni/Fe-hydrogenase, b-type cytochrome subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="Ni/Fe-hydrogenase, b-type cytochrome subunit"
                     /protein_id="YP_004412556.1"
                     /db_xref="GI:330837976"
                     /db_xref="InterPro:IPR000516"
                     /db_xref="InterPro:IPR005797"
                     /db_xref="InterPro:IPR016174"
                     /db_xref="GeneID:10496321"
                     /translation="MREVKRRIYYVFSPWLRIFHWIMVVCISVLFATGLMITEPWLIY
                     SVEPTFSGMTTDNIRNIHFIAAFTFMAAFLLRIYGFYVNRGDRLFPRFWEGLFWRAIG
                     DVILHYIFVRYEHKSYLRNPIARMSYTLLYVLVAIEVVTGLGMYGANEPESVSFMLFG
                     WVITLLGNEFMVHLVHHYVAWFIILFAIGHLYMVIRAEFMEGESEVSSMFSGRKILTH
                     EPLDAYQLSHPEEEHKGRAS"
     misc_feature    130542..131150
                     /locus_tag="Selsp_0117"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cl00859"
                     /db_xref="CDD:260663"
     gene            131247..131489
                     /locus_tag="Selsp_0118"
                     /db_xref="GeneID:10496322"
     CDS             131247..131489
                     /locus_tag="Selsp_0118"
                     /note="SPTR: Conserved domain protein;
                     IMG reference gene:2504585571"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412557.1"
                     /db_xref="GI:330837977"
                     /db_xref="GeneID:10496322"
                     /translation="MCKECGCGASNGNTRLQFNVKGYTEESAKGAEKALLGLAGVLYV
                     HIHAHDGETTVDYDPAKTKLTEILGIFEERGLSAAL"
     gene            131591..131932
                     /locus_tag="Selsp_0119"
                     /db_xref="GeneID:10496323"
     CDS             131591..131932
                     /locus_tag="Selsp_0119"
                     /note="COGs: COG0375 Zn finger protein HypA/HybF (possibly
                     regulating hydrogenase expression);
                     HAMAP: Hydrogenase nickel incorporation protein HypA/HybF;
                     InterPro IPR000688;
                     KEGG: vpr:Vpar_1518 hydrogenase expression/synthesis HypA;
                     PFAM: Hydrogenase nickel incorporation protein HypA/HybF;
                     SPTR: Hydrogenase nickel insertion protein HypA;
                     TIGRFAM: Hydrogenase nickel incorporation protein
                     HypA/HybF;
                     IMG reference gene:2504585572;
                     PFAM: Hydrogenase expression/synthesis hypA family;
                     TIGRFAM: hydrogenase nickel insertion protein HypA"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase nickel incorporation protein hypA"
                     /protein_id="YP_004412558.1"
                     /db_xref="GI:330837978"
                     /db_xref="InterPro:IPR000688"
                     /db_xref="InterPro:IPR020538"
                     /db_xref="GeneID:10496323"
                     /translation="MHEMAIAEGILDIALKTMEENEAKRVARVKLLVGEMAGVECESL
                     LFCFEALTKGTAADGAALDIERVPLVGRCGSCGKEQHVERYSFLCPSCRNGALEIISG
                     RELKVESLEVD"
     misc_feature    131591..131929
                     /locus_tag="Selsp_0119"
                     /note="Hydrogenase expression/synthesis hypA family;
                     Region: HypA; pfam01155"
                     /db_xref="CDD:250405"
     gene            131937..132602
                     /locus_tag="Selsp_0120"
                     /db_xref="GeneID:10496324"
     CDS             131937..132602
                     /locus_tag="Selsp_0120"
                     /note="COGs: COG0378 Ni2+-binding GTPase involved in
                     regulation of expression and maturation of urease and
                     hydrogenase;
                     InterPro IPR004392:IPR003495;
                     KEGG: hmo:HM1_1483 hydrogenase accessory protein HypB;
                     PFAM: Cobalamin (vitamin B12) biosynthesis CobW-like;
                     SPTR: Hydrogenase accessory protein HypB;
                     TIGRFAM: Hydrogenase accessory protein HypB;
                     IMG reference gene:2504585573;
                     PFAM: CobW/HypB/UreG, nucleotide-binding domain;
                     TIGRFAM: hydrogenase accessory protein HypB"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase accessory protein HypB"
                     /protein_id="YP_004412559.1"
                     /db_xref="GI:330837979"
                     /db_xref="InterPro:IPR003495"
                     /db_xref="InterPro:IPR004392"
                     /db_xref="InterPro:IPR012202"
                     /db_xref="GeneID:10496324"
                     /translation="MEVKVMKNVLAMNDEAAAENAALFQRKGIFVLNLMGSPGAGKTT
                     LLERTLEALKDEMRLSVIEGDLFTSKDAERIDRLGVPVVQINTSGGCHLDAPMVKSAL
                     SSIDLDSLDMLIIENVGNLVCPAEFELGQDKKAVVLSITEGDDKPLKYPLMFKEADAA
                     LLNKVDLLPYTDFDLESATDDIRTLHPGIEVMAIACRTGEGLPAWLSWLRKNVREKKE
                     AVR"
     misc_feature    132003..132578
                     /locus_tag="Selsp_0120"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     gene            132599..133336
                     /locus_tag="Selsp_0121"
                     /db_xref="GeneID:10496325"
     CDS             132599..133336
                     /locus_tag="Selsp_0121"
                     /note="COGs: COG0680 Ni Fe-hydrogenase maturation factor;
                     InterPro IPR000671;
                     KEGG: aae:aq_667 HupD hydrogenase related function;
                     PFAM: Peptidase A31, hydrogen uptake protein;
                     SPTR: Ribulose bisphosphate carboxylase, small subunit;
                     TIGRFAM: Peptidase A31, hydrogen uptake protein;
                     IMG reference gene:2504585574;
                     PFAM: Hydrogenase maturation protease;
                     TIGRFAM: hydrogenase expression/formation protein;
                     hydrogenase maturation protease"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase maturation protease"
                     /protein_id="YP_004412560.1"
                     /db_xref="GI:330837980"
                     /db_xref="InterPro:IPR000671"
                     /db_xref="GeneID:10496325"
                     /translation="MSEAFLGVSPEEIERARKELEATPAVTVLGIGNVILQDEGFGVR
                     AAELLREKYDFPPAVQIIDGGTLGAELLGVITGTEHLLVLDSVNGGKEAGTLFHFENE
                     GISAHFQDKLSVHEVGIQDVLATLSVTGRAIPDVVVLGAQPYAVGAGVALSPQMEALL
                     PEIERRAIDVLSRWGVEVRAKDASREVAFTRVAEAKHEKAGASRGFVAEDEADAPLDV
                     PMKQAGEAMRTARQTLPHELLTKGGEG"
     misc_feature    132674..133111
                     /locus_tag="Selsp_0121"
                     /note="Endopeptidases belonging to membrane-bound
                     hydrogenases group. These hydrogenases transfer electrons
                     from H2 to a cytochrome that is bound to a
                     membrane-located complex coupling electron transfer to
                     transmembrane proton translocation. Endopeptidase HybD...;
                     Region: H2MP_MemB-H2up; cd06062"
                     /db_xref="CDD:99873"
     misc_feature    order(132695..132697,132737..132739,132785..132793)
                     /locus_tag="Selsp_0121"
                     /note="putative substrate-binding site; other site"
                     /db_xref="CDD:99873"
     misc_feature    order(132713..132715,132851..132853,132941..132943)
                     /locus_tag="Selsp_0121"
                     /note="nickel binding site [ion binding]; other site"
                     /db_xref="CDD:99873"
     gene            133336..133566
                     /locus_tag="Selsp_0122"
                     /db_xref="GeneID:10496326"
     CDS             133336..133566
                     /locus_tag="Selsp_0122"
                     /note="COGs: COG0298 Hydrogenase maturation factor;
                     InterPro IPR001109;
                     KEGG: deb:DehaBAV1_1241 hydrogenase assembly chaperone
                     HypC/HupF;
                     PFAM: Hydrogenase expression/formation protein, HupF/HypC;
                     SPTR: Hydrogenase assembly chaperone HypC/HupF;
                     TIGRFAM: Hydrogenase expression/formation protein,
                     HupF/HypC;
                     IMG reference gene:2504585575;
                     PFAM: HupF/HypC family;
                     TIGRFAM: hydrogenase assembly chaperone HypC/HupF"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase assembly chaperone hypC/hupF"
                     /protein_id="YP_004412561.1"
                     /db_xref="GI:330837981"
                     /db_xref="InterPro:IPR001109"
                     /db_xref="InterPro:IPR019812"
                     /db_xref="GeneID:10496326"
                     /translation="MCLAVPAKVLDIAGSVARVSVNGVEREASLMLLPEAKLGDYVLV
                     HAGFAMQIVEEKDAEETYALLAEMKGAPRTVM"
     misc_feature    133336..133533
                     /locus_tag="Selsp_0122"
                     /note="HupF/HypC family; Region: HupF_HypC; pfam01455"
                     /db_xref="CDD:250633"
     gene            133583..134689
                     /locus_tag="Selsp_0123"
                     /db_xref="GeneID:10496327"
     CDS             133583..134689
                     /locus_tag="Selsp_0123"
                     /note="COGs: COG0409 Hydrogenase maturation factor;
                     InterPro IPR002780;
                     KEGG: gme:Gmet_0117 hydrogenase formation HypD protein;
                     PFAM: Hydrogenase formation HypD protein;
                     SPTR: Hydrogenase expression/formation protein HypD;
                     TIGRFAM: Hydrogenase formation HypD protein;
                     IMG reference gene:2504585576;
                     PFAM: Hydrogenase formation hypA family;
                     TIGRFAM: hydrogenase expression/formation protein HypD"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression/formation protein HypD"
                     /protein_id="YP_004412562.1"
                     /db_xref="GI:330837982"
                     /db_xref="InterPro:IPR002780"
                     /db_xref="GeneID:10496327"
                     /translation="MKKLTPQEEKEAARALLADIERLAAGRHLRYMEVCGTHTVAIFR
                     AGLRQILPENIELVSGPGCPVCVTSDAYMDKAIACAKMEAVTVATFGDMLKVPGSRES
                     LADARAAGACLRVVYSPLDALAAARENPERTVVFLGVGFETTAPTEAAAVLSAKEEGL
                     KNFCVLSAQKLVPPAVKLLLADPDVHVDGFLLPGHACVVTGTRPYAFLADEAHKPGVV
                     AGFTPLAILRAVWRLVRQTAANEARIENEYGSVVREEGNPAALAVLARVYEETADEWR
                     GLGVIERSGLRMREEFAAFDAERRLPVEVERVEKKTACRCGEVLRGAVRPTDCTLFAK
                     ACVPTHAVGPCMVSVEGVCAAWYKYGRGRFHFGK"
     misc_feature    133583..134671
                     /locus_tag="Selsp_0123"
                     /note="hydrogenase isoenzymes formation protein HypD;
                     Provisional; Region: PRK15062"
                     /db_xref="CDD:237892"
     gene            134679..135680
                     /locus_tag="Selsp_0124"
                     /db_xref="GeneID:10496328"
     CDS             134679..135680
                     /locus_tag="Selsp_0124"
                     /note="COGs: COG0309 Hydrogenase maturation factor;
                     InterPro IPR011854:IPR000728:IPR010918;
                     KEGG: dly:Dehly_1413 hydrogenase expression/formation
                     protein HypE;
                     PFAM: AIR synthase-related protein; AIR synthase-related
                     protein, C-terminal;
                     SPTR: Hydrogenase expression/formation protein HypE;
                     TIGRFAM: Hydrogenase expression/formation protein HypE;
                     IMG reference gene:2504585577;
                     PFAM: AIR synthase related protein, N-terminal domain; AIR
                     synthase related protein, C-terminal domain;
                     TIGRFAM: hydrogenase expression/formation protein HypE"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrogenase expression/formation protein HypE"
                     /protein_id="YP_004412563.1"
                     /db_xref="GI:330837983"
                     /db_xref="InterPro:IPR000728"
                     /db_xref="InterPro:IPR010918"
                     /db_xref="InterPro:IPR011854"
                     /db_xref="InterPro:IPR016188"
                     /db_xref="GeneID:10496328"
                     /translation="MENEKITLAHGAGGSLSQALMESVILPAFGNEFLQKMHDGAALD
                     LGGKTAFTTDSFVVAPRFFPGGDIGKLAVCGTVNDLAMTGAVPRYISCALILEEGLPI
                     EELRRILHSMKEAAAEAKVAIVTGDTKVVGKGAADGIYINTAGIGEIERAMEPQNVRA
                     DMDVILSGTLGDHAATVMAERHGIEIPATLHSDCAPLGDLAALMRRTAPSIACMRDPT
                     RGGAAAVLNEIACAAQVGVILDEEALPVREEVEGIAAFLGFDPLELANEGKAIAFCAP
                     EETAALLAAMREHPYGRNACCIGRTTAEEPGIVALRTALGGLRIVDMPLGNLVPRIC"
     misc_feature    134712..135578
                     /locus_tag="Selsp_0124"
                     /note="HypE (Hydrogenase expression/formation protein).
                     HypE is involved in Ni-Fe hydrogenase biosynthesis.  HypE
                     dehydrates its own carbamoyl moiety in an ATP-dependent
                     process to yield the enzyme thiocyanate. The N-terminal
                     domain of HypE is related to the...; Region: HypE;
                     cd02197"
                     /db_xref="CDD:100033"
     misc_feature    order(134724..134732,134817..134834,134838..134843,
                     134913..134915,134949..134951,135057..135059,
                     135063..135065,135072..135074,135078..135080,
                     135096..135098,135102..135104,135321..135326,
                     135333..135335)
                     /locus_tag="Selsp_0124"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100033"
     misc_feature    134727..135677
                     /locus_tag="Selsp_0124"
                     /note="hydrogenase expression/formation protein HypE;
                     Region: hypE; TIGR02124"
                     /db_xref="CDD:233738"
     misc_feature    order(134838..134840,134913..134915,135330..135335)
                     /locus_tag="Selsp_0124"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:100033"
     gene            complement(135693..136190)
                     /locus_tag="Selsp_0125"
                     /db_xref="GeneID:10496329"
     CDS             complement(135693..136190)
                     /locus_tag="Selsp_0125"
                     /note="KEGG: vpr:Vpar_1007 hypothetical protein;
                     SPTR: Putative BioX protein;
                     IMG reference gene:2504585578"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412564.1"
                     /db_xref="GI:330837984"
                     /db_xref="InterPro:IPR020345"
                     /db_xref="GeneID:10496329"
                     /translation="MKKLAVSTSDVTEIALLAALITVTGAIKLPSLAPGLEFQLSAPL
                     AVAICAVFGFKRYILAGVLSSLVGLLLGTQNLFNVAIAMQFRLVVGLVFVLFGRHYWT
                     VALAGPLGTFTARITLSFVVGKGAWALVAAALPGMVFTLLAAPLLVKILDRIARLRRT
                     AGARV"
     gene            136377..138293
                     /locus_tag="Selsp_0126"
                     /db_xref="GeneID:10496330"
     CDS             136377..138293
                     /locus_tag="Selsp_0126"
                     /EC_number="2.3.1.47"
                     /EC_number="6.2.1.14"
                     /note="COGs: COG0156 7-keto-8-aminopelargonate synthetase;
                     InterPro IPR004839:IPR004723:IPR005499;
                     KEGG: ckp:ckrop_1506 pimeloyl-CoA
                     synthetase/8-amino-7-oxononanoate synthase;
                     PFAM: 6-carboxyhexanoate--CoA ligase; Aminotransferase,
                     class I/classII;
                     PRIAM: 6-carboxyhexanoate--CoA ligase.,
                     8-amino-7-oxononanoate synthase;
                     SPTR: Glycine C-acetyltransferase;
                     TIGRFAM: 8-amino-7-oxononanoate
                     synthase/2-amino-3-ketobutyrate coenzyme A ligase;
                     IMG reference gene:2504585579;
                     PFAM: 6-carboxyhexanoate--CoA ligase; Aminotransferase
                     class I and II;
                     TIGRFAM: 8-amino-7-oxononanoate synthase;
                     6-carboxyhexanoate--CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="8-amino-7-oxononanoate synthase"
                     /protein_id="YP_004412565.1"
                     /db_xref="GI:330837985"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004723"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005499"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496330"
                     /translation="MALYSLKMRAEKNAGKREHVSGAEKILSEEELPEHLAALLSRAL
                     HHAKGKADFVNFKVEAIAPEAVEHLPALPVSTVEVETPAEGRRVIIDALENLGLKNGE
                     AILAKFSETYGMRGAMLLDADTLERLEPDAERGLRATYMDAERAAKGASDCKNHFAEA
                     VVLATKVVHAPHIVAEICVSDDPDYVTGYVAAQSFGYRRITKLKEAGSPDGGRIFLYR
                     GSRDGVADTIRYLEKQCVLVRGVPDSPAGNVRPQGMEEMLAEELAAKKARHLCREMHE
                     IDSAQAAHVTVGGAEKLLLASNNYLGLVDHPRLKRAAQEAVERYGCGSGGSRLTTGTL
                     PLHTKLEEELAAFKGTEAALLFDTGYMANVGILSALGQKGAVFFSDELNHASIIDGCR
                     LSRAKTVVYRHSDMQDLEEKLAAHAQCPGVIVSDAVFSMDGDIANLPRILELARKYHV
                     WSMVDEAHSTGVIGATGRGICEHFYLREKPDVLMGTLSKALASEGGYVCGSRLLIDYL
                     KNTSRSFIFSTSQSPANLAAASAALQLLQEEPERVARLQENVRVFCAALAEHGVEARS
                     ETAIVPLIVGEESLAVKIAKDLERQGILVSAIRHPTVAKGAARLRVALAATHTEEELK
                     SAAARIASCMRGAC"
     misc_feature    136383..137099
                     /locus_tag="Selsp_0126"
                     /note="6-carboxyhexanoate--CoA ligase; Region: BioW;
                     cl00625"
                     /db_xref="CDD:260540"
     misc_feature    137205..138269
                     /locus_tag="Selsp_0126"
                     /note="8-amino-7-oxononanoate synthase; Region: bioF;
                     TIGR00858"
                     /db_xref="CDD:129937"
     misc_feature    137253..138266
                     /locus_tag="Selsp_0126"
                     /note="KBL_like; this family belongs to the pyridoxal
                     phosphate (PLP)-dependent aspartate aminotransferase
                     superfamily (fold I). The major groups in this CD
                     corresponds to serine palmitoyltransferase (SPT),
                     5-aminolevulinate synthase (ALAS); Region: KBL_like;
                     cd06454"
                     /db_xref="CDD:99747"
     misc_feature    order(137268..137270,137448..137456,137526..137528,
                     137652..137654,137664..137669,137739..137741,
                     137745..137750,137832..137834,137841..137843,
                     138207..138209)
                     /locus_tag="Selsp_0126"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:99747"
     misc_feature    order(137448..137456,137526..137528,137652..137654,
                     137664..137666,137739..137741,137745..137750,
                     137832..137834,137841..137843)
                     /locus_tag="Selsp_0126"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99747"
     misc_feature    137841..137843
                     /locus_tag="Selsp_0126"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99747"
     gene            138358..139347
                     /locus_tag="Selsp_0127"
                     /db_xref="GeneID:10496331"
     CDS             138358..139347
                     /locus_tag="Selsp_0127"
                     /note="COGs: COG0338 Site-specific DNA methylase;
                     InterPro IPR012327;
                     KEGG: lba:Lebu_2246 DNA adenine methylase;
                     PFAM: D12 class N6 adenine-specific DNA methyltransferase;
                     SPTR: DNA adenine methylase;
                     TIGRFAM: D12 class N6 adenine-specific DNA
                     methyltransferase;
                     IMG reference gene:2504585580;
                     PFAM: D12 class N6 adenine-specific DNA methyltransferase;
                     TIGRFAM: DNA adenine methylase (dam)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA adenine methylase"
                     /protein_id="YP_004412566.1"
                     /db_xref="GI:330837986"
                     /db_xref="InterPro:IPR002052"
                     /db_xref="InterPro:IPR012327"
                     /db_xref="InterPro:IPR023095"
                     /db_xref="GeneID:10496331"
                     /translation="MPHNVALVVATMYDLAYNTFMMKGATDDDGSAAAMNLKPFLKWA
                     GGKGQLIHEIARYYPFEDSRIKKYAEPFVGGGAILFDILSKYDLEAVYISDVNSELIN
                     TYCTIRDHADELIHLLLLMQNEFTALSAEERKICYTEKRARFNDLKMHENKADSKERA
                     ALMIFLNRTCFNGLFRVNKKGFFNVPMGAYKNPTICDEANLRAVAEKLRNVTIVCADY
                     RGSADFIDKHTFVYFDPPYRPLTETARFTAYTKDSFDDAAQIALAKFVDDMSTKGAKI
                     VASNSDPKNVNSEDNFFEDIYRAHKIHRVNAVRMINSNADARGKIQELLISNF"
     misc_feature    138469..139341
                     /locus_tag="Selsp_0127"
                     /note="D12 class N6 adenine-specific DNA
                     methyltransferase; Region: MethyltransfD12; cl17344"
                     /db_xref="CDD:266636"
     gene            139558..139959
                     /locus_tag="Selsp_0128"
                     /db_xref="GeneID:10496332"
     CDS             139558..139959
                     /locus_tag="Selsp_0128"
                     /note="SPTR: Putative uncharacterized protein;
                     manually curated;
                     IMG reference gene:2504585581"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412567.1"
                     /db_xref="GI:330837987"
                     /db_xref="GeneID:10496332"
                     /translation="MRKFAWMLSMTALLLFLASTVCFAEDEGRRFVDARGDTGYFVDV
                     TTISIDSNHEYTADVAIIKAKENRLFSYRMHFDFAARTYQILRSATMTYDTREVSQSV
                     KTPLPAAPYVPGSPIAAIVDYLYAWQRGFEK"
     gene            140694..142205
                     /locus_tag="Selsp_0129"
                     /db_xref="GeneID:10496333"
     CDS             140694..142205
                     /locus_tag="Selsp_0129"
                     /note="COGs: COG1757 Na+/H+ antiporter;
                     InterPro IPR018461;
                     KEGG: cpy:Cphy_1066 Na+/H+ antiporter NhaC;
                     PFAM: Na+/H+ antiporter NhaC-like;
                     SPTR: Na+/H+ antiporter family protein;
                     IMG reference gene:2504585582;
                     PFAM: Na+/H+ antiporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="Na+/H+ antiporter NhaC"
                     /protein_id="YP_004412568.1"
                     /db_xref="GI:330837988"
                     /db_xref="InterPro:IPR018461"
                     /db_xref="GeneID:10496333"
                     /translation="MAETAWAVLPPVITIVLALATKEVYMSLIIGIFSGAMLYANFNV
                     LEAILTMFAVMEAKVGANVNILVFLVILGILVAAITRSGATKAYGDWAVRTIQGRRSA
                     LAITALLGIVIFIDDYFNCLTVGTVMRPVTDKFKIARTKLAYIIDATAAPVCILAPIS
                     SWAAAVGSSLPEGSSIDGFGLFLQTIPINLYAWLTLIFMCFLVWSEKDFSEMGASIRK
                     NEREFYVPPEYADVKEEKIEGRGKIYDLLLPLAVLIAACIYGMLYTGGIHDGLSVAEA
                     FANCDSSKSLVLGSFIAFVFTGLLYLPRRVVSFNDFCTSFILGFKAMSPALFILCLAW
                     TLSGICSDKYLDLGGYVGQLVSANAGVITFLPVIFFLVGAGLAFATGTSWGTFGILIP
                     IAIAIVGTDSPVLALCVAAILSGAVAGDHASPISDTTILASAGAQCHHIDHVSTQIPY
                     VLVVVSVCVVGYIVDGLTMNGWLGLAVALAILAVVMAVVYWKVPVPLKDRSAD"
     misc_feature    140694..142163
                     /locus_tag="Selsp_0129"
                     /note="Na+/H+ antiporter [Energy production and
                     conversion]; Region: NhaC; COG1757"
                     /db_xref="CDD:224671"
     misc_feature    141150..142094
                     /locus_tag="Selsp_0129"
                     /note="Na+/H+ antiporter family; Region: Na_H_antiporter;
                     pfam03553"
                     /db_xref="CDD:252025"
     gene            142299..142961
                     /locus_tag="Selsp_0130"
                     /db_xref="GeneID:10496334"
     CDS             142299..142961
                     /locus_tag="Selsp_0130"
                     /note="InterPro IPR007197;
                     KEGG: fsu:Fisuc_1354 radical SAM domain protein;
                     PFAM: Radical SAM;
                     SPTR: Radical SAM domain protein;
                     IMG reference gene:2504585583;
                     PFAM: Radical SAM superfamily;
                     TIGRFAM: radical SAM protein, TatD family-associated"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM domain protein"
                     /protein_id="YP_004412569.1"
                     /db_xref="GI:330837989"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="GeneID:10496334"
                     /translation="MLVYMVDHGKYLLPEESLKRRPEEKRGLYVNITNECPCACTFCL
                     RTMKDMPEDMSLWLGGKEPTVEELKAALLAAPWDYVKEVVFCGFGEPTMRLADLIELL
                     RFVKEQHPALPTRVNTNGLSDLVYGRDTAADFAGGILDTVSISLNASNAERYLALTRS
                     EFGIESFEAMLAFAEKMKAYAGHVVLTIVEKVEGAEEIAKCRALCEARGLDLRVRTYE
                     GS"
     misc_feature    142386..>142895
                     /locus_tag="Selsp_0130"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    142386..142862
                     /locus_tag="Selsp_0130"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     misc_feature    order(142404..142406,142410..142412,142416..142418,
                     142422..142427,142554..142556,142563..142568,
                     142647..142655,142731..142733,142851..142853)
                     /locus_tag="Selsp_0130"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            144048..144896
                     /locus_tag="Selsp_0131"
                     /db_xref="GeneID:10496335"
     CDS             144048..144896
                     /locus_tag="Selsp_0131"
                     /EC_number="5.3.3.10"
                     /note="COGs: COG0179 2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1 7-dioic acid hydratase
                     (catechol pathway);
                     InterPro IPR002529;
                     KEGG: aac:Aaci_2886
                     5-carboxymethyl-2-hydroxymuconateDelta-isomerase;
                     PFAM: Fumarylacetoacetase, C-terminal-like;
                     PRIAM: 5-carboxymethyl-2-hydroxymuconate Delta-isomerase;
                     SPTR: Fumarylacetoacetate hydrolase family protein;
                     IMG reference gene:2504585584;
                     PFAM: Fumarylacetoacetate (FAA) hydrolase family"
                     /codon_start=1
                     /transl_table=11
                     /product="5-carboxymethyl-2-hydroxymuconateDelta-
                     isomerase"
                     /protein_id="YP_004412570.1"
                     /db_xref="GI:330837990"
                     /db_xref="InterPro:IPR002529"
                     /db_xref="InterPro:IPR011234"
                     /db_xref="GeneID:10496335"
                     /translation="MIVKLLNFYAEDGAVHIGASDGEKTVDVSAVGYSWGWQEIFADW
                     EKIRPQIESVLQHAKPLAHGLRFAPAVTAPGKILCVGLNYASHRAEVPFGAPKYPALF
                     SKFNNALNASGGEVLLPTGAKELDYEAELVVIVGKKVKDASEEEAAAAIFGYTAGNDF
                     TARDLQRRTSQWLLGKTPDGFAPLGPYIVPAAEIDVSHLAVRTFVNGEMRQDGRTSDM
                     IFSPAAIVRYISKCMTLDPGDVIFTGTPHGVIFGLPEKERRWLKAGDEVVVKIEGIGE
                     LRNRIA"
     misc_feature    144099..144890
                     /locus_tag="Selsp_0131"
                     /note="2-keto-4-pentenoate
                     hydratase/2-oxohepta-3-ene-1,7-dioic acid hydratase
                     (catechol pathway) [Secondary metabolites biosynthesis,
                     transport, and catabolism]; Region: MhpD; COG0179"
                     /db_xref="CDD:223257"
     misc_feature    144273..144893
                     /locus_tag="Selsp_0131"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            145085..145225
                     /locus_tag="Selsp_0132"
                     /db_xref="GeneID:10496336"
     CDS             145085..145225
                     /locus_tag="Selsp_0132"
                     /note="KEGG: chy:CHY_0146 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585585"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412571.1"
                     /db_xref="GI:330837991"
                     /db_xref="GeneID:10496336"
                     /translation="MNDLLAAFGSYGFPMAVTAFLLVRIEGKLGALNDSVRELSGIIA
                     KK"
     misc_feature    145109..145213
                     /locus_tag="Selsp_0132"
                     /note="YvrJ protein family; Region: YvrJ; pfam12841"
                     /db_xref="CDD:257341"
     gene            complement(145236..145694)
                     /locus_tag="Selsp_0133"
                     /db_xref="GeneID:10496337"
     CDS             complement(145236..145694)
                     /locus_tag="Selsp_0133"
                     /note="InterPro IPR020483;
                     KEGG: vpa:VPA0976 hypothetical protein;
                     PFAM: Uncharacterised protein family YgbA;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585586;
                     PFAM: Nitrous oxide-stimulated promoter"
                     /codon_start=1
                     /transl_table=11
                     /product="Uncharacterized protein family YgbA"
                     /protein_id="YP_004412572.1"
                     /db_xref="GI:330837992"
                     /db_xref="InterPro:IPR020483"
                     /db_xref="GeneID:10496337"
                     /translation="MSIFSRFLPKKKQPEIKNNIPKEKANIKKTFGVYCHKEHGTEGD
                     KLCPKCTALLATVLMKMNRCPYGITKPICDRCESPCFSKSQNIEFRKIMTANQKSMLL
                     RHPIMTIKHKLASMGVDYALKERAKKEQQKVEAKEKAAKRREEARSKKKK"
     misc_feature    complement(145353..145631)
                     /locus_tag="Selsp_0133"
                     /note="Nitrous oxide-stimulated promoter; Region: YgbA_NO;
                     cl08119"
                     /db_xref="CDD:263532"
     gene            145890..147167
                     /locus_tag="Selsp_0134"
                     /db_xref="GeneID:10496338"
     CDS             145890..147167
                     /locus_tag="Selsp_0134"
                     /note="COGs: COG4585 Signal transduction histidine kinase;
                     InterPro IPR003594:IPR011712:IPR008595;
                     KEGG: nth:Nther_2326 histidine kinase;
                     PFAM: Sensor DegS; Signal transduction histidine kinase,
                     subgroup 3, dimerisation and phosphoacceptor domain;
                     ATPase-like, ATP-binding domain;
                     SMART: ATPase-like, ATP-binding domain;
                     SPTR: Histidine kinase;
                     IMG reference gene:2504585587;
                     PFAM: Histidine kinase; Sensor protein DegS; Histidine
                     kinase-, DNA gyrase B-, and HSP90-like ATPase"
                     /codon_start=1
                     /transl_table=11
                     /product="DegS sensor signal transduction histidine
                     kinase"
                     /protein_id="YP_004412573.1"
                     /db_xref="GI:330837993"
                     /db_xref="InterPro:IPR003594"
                     /db_xref="InterPro:IPR008595"
                     /db_xref="InterPro:IPR011712"
                     /db_xref="GeneID:10496338"
                     /translation="MEQEKSGSEFPRTQIDKLSAKSLDNILKSTVSTIETNKTQIFGI
                     YEAARGEVESSRRTLEDLRELTRQTIEKVDELSAIEQREKKKLAETSSDFNNYSEERI
                     REHYESVKDIQIELSVAREKESQLRAQRDALELRLHGLKEILKTAEHLAICIGSVLSY
                     LSDQINGVVWQIEEAQKSKFIGAQIIKAQEEERLRVSRELHDGPAQDIANLIFQASII
                     ERMVDRDPEEAKRGLQELRQHIRGCLTDMRQIIFDMRPMSLDDLGLEPALRQLISKMR
                     ERGMLDASIAVEGEEQKLAKYAEVSIFRIVQESLNNVSRHAGVKKAEVRILYTASALA
                     ITVKDEGRGFDPDAEEDAVPSGEEQFDDDRDVNDPILRNAYGQYGLLGMRERAAIIGA
                     ELNIISEIGKGTCIHLRMPFRPNVLAPEKAAKK"
     misc_feature    145959..146435
                     /locus_tag="Selsp_0134"
                     /note="Sensor protein DegS; Region: DegS; pfam05384"
                     /db_xref="CDD:147523"
     misc_feature    <146346..147122
                     /locus_tag="Selsp_0134"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    146463..146666
                     /locus_tag="Selsp_0134"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    146793..147116
                     /locus_tag="Selsp_0134"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(146811..146813,146823..146825,146832..146834,
                     146898..146900,146904..146906,146910..146912,
                     146916..146921,147024..147026,147027..147029,
                     147075..147077,147081..147083,147096..147101,
                     147105..147107)
                     /locus_tag="Selsp_0134"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    146823..146825
                     /locus_tag="Selsp_0134"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(146910..146912,146916..146918,147024..147026)
                     /locus_tag="Selsp_0134"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            147164..148687
                     /locus_tag="Selsp_0135"
                     /db_xref="GeneID:10496339"
     CDS             147164..148687
                     /locus_tag="Selsp_0135"
                     /EC_number="4.1.1.19"
                     /note="COGs: COG1982 Arginine/lysine/ornithine
                     decarboxylase;
                     InterPro IPR000310:IPR008286;
                     KEGG: sth:STH3269 arginine/lysine/ornithine decarboxylase;
                     PFAM: Orn/Lys/Arg decarboxylase, major domain; Orn/Lys/Arg
                     decarboxylase, C-terminal;
                     PRIAM: Arginine decarboxylase;
                     SPTR: Lysine decarboxylase;
                     IMG reference gene:2504585588;
                     PFAM: Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Orn/Lys/Arg decarboxylase, major domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Arginine decarboxylase"
                     /protein_id="YP_004412574.1"
                     /db_xref="GI:330837994"
                     /db_xref="InterPro:IPR000310"
                     /db_xref="InterPro:IPR008286"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496339"
                     /translation="MTADERQRRAPLAAAMCAYGEEGALAFHTPGHKQGLGAHALLRE
                     LVTEAGLREEVSLMEELDDLHEPTGCIEEAQDLAAALYGADAAFFAVNGTTGAIHAMF
                     VAALSPGDTVLVPRNVHRSVFGGLVLADARPVYIEPVVDEALGIAHGLSTEAVREACR
                     LHPEAKALLLVSPTYYGVASDVRAIAEIVHEAGMALLVDEAHGAHLAFSDDLPESAIA
                     AGADLVAQSTHKLLGAMTQASLLLLREGRIEKERVQRAMSLLTSTSPNYLLLASLDIA
                     RLQMAEVGAAHLARAVGLARKLRREVNATPGLFSFGEERMGGAGAFALDPLKLTVTVT
                     GLGLTGAEAAHILRHEHKIEAELFDAQNVLFLLTYADTEESAGRLLAALRSLAQRRTA
                     QAATAAAAAIAVPDGGKAQVAVRLPAAPPVAIPPREAFYRRSVPCRLREAAGRIAAET
                     IAFYPPGIPVICTGEVFTAEVCRYIEAMAAAGLKVTGAADASLRTLRVVADDAEQEE"
     misc_feature    147182..148669
                     /locus_tag="Selsp_0135"
                     /note="Arginine/lysine/ornithine decarboxylases [Amino
                     acid transport and metabolism]; Region: LdcC; COG1982"
                     /db_xref="CDD:224893"
     misc_feature    147194..148072
                     /locus_tag="Selsp_0135"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    order(147443..147448,147455..147457,147674..147676,
                     147758..147760,147767..147769,147842..147844,
                     147851..147853)
                     /locus_tag="Selsp_0135"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    147851..147853
                     /locus_tag="Selsp_0135"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     misc_feature    <148472..148609
                     /locus_tag="Selsp_0135"
                     /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Region: OKR_DC_1_C; pfam03711"
                     /db_xref="CDD:112521"
     gene            148734..149573
                     /locus_tag="Selsp_0136"
                     /db_xref="GeneID:10496340"
     CDS             148734..149573
                     /locus_tag="Selsp_0136"
                     /EC_number="1.1.1.133"
                     /note="COGs: COG1091 dTDP-4-dehydrorhamnose reductase;
                     InterPro IPR005913;
                     KEGG: csh:Closa_0401 dTDP-4-dehydrorhamnose reductase;
                     PFAM: dTDP-4-dehydrorhamnose reductase;
                     PRIAM: dTDP-4-dehydrorhamnose reductase;
                     SPTR: dTDP-4-dehydrorhamnose reductase;
                     TIGRFAM: dTDP-4-dehydrorhamnose reductase;
                     IMG reference gene:2504585589;
                     PFAM: RmlD substrate binding domain;
                     TIGRFAM: dTDP-4-dehydrorhamnose reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="dTDP-4-dehydrorhamnose reductase"
                     /protein_id="YP_004412575.1"
                     /db_xref="GI:330837995"
                     /db_xref="InterPro:IPR005913"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496340"
                     /translation="MKVLVTGVSGQLGFDVMRELLARGIEAKGASRSDFSLTDFAAMR
                     RFVEAHRPTAIIHCAAYTAVDKAEDEPELCREVNAAATGELAHLAKEIGAKFLYISTD
                     YVFPGTGEDFYEPEDEKAPCNVYGESKLLGEEAAREALEELFIVRISWVFGENGKNFI
                     KTMLRLTETHEELSVVGDQIGSPTYTRDLARLLADMIVTEKYGVYHATNEGTCSWAEL
                     AAEALRCAGKKTRVKAIKTEEYPTKAKRPKNSRLSKKCLDDAGFSRLPDWRDAVARYV
                     ELI"
     misc_feature    148737..149552
                     /locus_tag="Selsp_0136"
                     /note="dTDP-6-deoxy-L-lyxo-4-hexulose reductase and
                     related proteins, extended (e) SDRs; Region:
                     dTDP_HR_like_SDR_e; cd05254"
                     /db_xref="CDD:187564"
     misc_feature    148740..149570
                     /locus_tag="Selsp_0136"
                     /note="RmlD substrate binding domain; Region:
                     RmlD_sub_bind; pfam04321"
                     /db_xref="CDD:252525"
     misc_feature    order(148752..148754,148758..148769,148824..148829,
                     148842..148847,148905..148913,148917..148919,
                     148962..148964,149028..149036,149106..149108,
                     149118..149120,149175..149186)
                     /locus_tag="Selsp_0136"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187564"
     misc_feature    order(148965..148967,149034..149036,149106..149108,
                     149118..149120)
                     /locus_tag="Selsp_0136"
                     /note="active site"
                     /db_xref="CDD:187564"
     misc_feature    order(149034..149036,149106..149108,149181..149183,
                     149220..149222,149256..149258,149274..149276)
                     /locus_tag="Selsp_0136"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187564"
     gene            149651..150583
                     /locus_tag="Selsp_0137"
                     /db_xref="GeneID:10496341"
     CDS             149651..150583
                     /locus_tag="Selsp_0137"
                     /EC_number="5.1.3.2"
                     /note="COGs: COG0451 Nucleoside-diphosphate-sugar
                     epimerase;
                     InterPro IPR001509;
                     KEGG: hmo:HM1_1189 nad-dependent epimerase/dehydratase;
                     PFAM: NAD-dependent epimerase/dehydratase;
                     PRIAM: UDP-glucose 4-epimerase;
                     SPTR: UDP-glucose 4-epimerase;
                     IMG reference gene:2504585590;
                     PFAM: NAD dependent epimerase/dehydratase family"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-glucose 4-epimerase"
                     /protein_id="YP_004412576.1"
                     /db_xref="GI:330837996"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496341"
                     /translation="MNILVTGGAGFIGSHLVRHLLAKGEKVTALDNLSTGLAENLPPE
                     AKLVEMDILDEDLPKVVAAGAFDAIVHLAAQTMVDTSIKNPLLDTRENLMGTVQVLEA
                     ARAANVKRVIFASTAAAYGDVKEDDLPVREAQPTEPMSFYGLSKLSVEKYLEMYRKIY
                     GMEYVVLRFANVYGERQGDGGEGGVISIFAKAVAEGRDITIYGDGEQTRDFVYAGDIA
                     EGILAALRTEEVNAAYNLSTQTETSLRELVSLLAEICGREIVPKYGAEREGDIYKSML
                     SNSRARRGLDWQPATTLAEGLRRTYEYFCGKCEG"
     misc_feature    149651..150571
                     /locus_tag="Selsp_0137"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    149654..150562
                     /locus_tag="Selsp_0137"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(149669..149671,149675..149680,149684..149686,
                     149741..149749,149864..149872,149990..149998,
                     150074..150076,150086..150088,150155..150166)
                     /locus_tag="Selsp_0137"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(149924..149926,149996..149998,150074..150076,
                     150086..150088)
                     /locus_tag="Selsp_0137"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(150698..151042)
                     /locus_tag="Selsp_0138"
                     /db_xref="GeneID:10496342"
     CDS             complement(150698..151042)
                     /locus_tag="Selsp_0138"
                     /note="InterPro IPR013096;
                     KEGG: dhd:Dhaf_0788 cupin 2 conserved barrel domain
                     protein;
                     PFAM: Cupin 2, conserved barrel;
                     SPTR: Putative mannose-6-phosphate isomerase;
                     IMG reference gene:2504585591;
                     PFAM: Cupin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin 2 conserved barrel domain protein"
                     /protein_id="YP_004412577.1"
                     /db_xref="GI:330837997"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:10496342"
                     /translation="MAILQGNIEVRKNAAGGKGEVSLEHLLSKEQMGDKCSTFARVTI
                     KPGSSLGYHQHKGNSETYFILQGKGVYNDNGTEVEVGPGTTTFCPDGEYHGLSNENGT
                     EDLVFMALIINS"
     misc_feature    complement(150710..150925)
                     /locus_tag="Selsp_0138"
                     /note="Cupin domain; Region: Cupin_2; pfam07883"
                     /db_xref="CDD:254486"
     gene            151147..151905
                     /locus_tag="Selsp_0139"
                     /db_xref="GeneID:10496343"
     CDS             151147..151905
                     /locus_tag="Selsp_0139"
                     /note="COGs: COG1434 conserved hypothetical protein;
                     InterPro IPR003848;
                     KEGG: ppm:PPSC2_c3685 protein of hypothetical function
                     duf218;
                     PFAM: Domain of unknown function DUF218;
                     SPTR: Putative membrane protein;
                     IMG reference gene:2504585592;
                     PFAM: DUF218 domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412578.1"
                     /db_xref="GI:330837998"
                     /db_xref="InterPro:IPR003848"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="GeneID:10496343"
                     /translation="MIQFLKFGASFFLPPGIFFLAFLFLAFFAWKRGERFAAKAIVLI
                     TAVFYLLSTYLVADVLMGALEDAYMPPAKPEGDVVIMLGGGAFSDAPDVDGEGALTAS
                     PSTRLLTAVRLAQKLDLPILVSGGQVFQESGKEALLAKRTLVSLGIPESRILVEGASQ
                     NTVQNAAYTAKILKEHGLVRPILVTSAFHMKRSVLNYEKLGIEVVPYPTDYMVSHHPI
                     FHVVKLAPSADALHTNAVVLQECLRTAVTYCLGK"
     misc_feature    151375..151794
                     /locus_tag="Selsp_0139"
                     /note="YdcF-like. YdcF-like is a large family of mainly
                     bacterial proteins, with a few members found in fungi,
                     plants, and archaea. Escherichia coli YdcF has been shown
                     to bind S-adenosyl-L-methionine (AdoMet), but a
                     biochemical function has not been...; Region: YdcF-like;
                     cd06259"
                     /db_xref="CDD:99750"
     misc_feature    order(151630..151632,151639..151641,151699..151701,
                     151711..151713,151720..151722)
                     /locus_tag="Selsp_0139"
                     /note="putative active site [active]"
                     /db_xref="CDD:99750"
     gene            151907..153244
                     /locus_tag="Selsp_0140"
                     /db_xref="GeneID:10496344"
     CDS             151907..153244
                     /locus_tag="Selsp_0140"
                     /note="COGs: COG0534 Na+-driven multidrug efflux pump;
                     InterPro IPR002528;
                     KEGG: gym:GYMC10_3705 MATE efflux family protein;
                     PFAM: Multi antimicrobial extrusion protein;
                     SPTR: MATE efflux family protein;
                     TIGRFAM: Multi antimicrobial extrusion protein;
                     IMG reference gene:2504585593;
                     PFAM: MatE;
                     TIGRFAM: putative efflux protein, MATE family"
                     /codon_start=1
                     /transl_table=11
                     /product="MATE efflux family protein"
                     /protein_id="YP_004412579.1"
                     /db_xref="GI:330837999"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="InterPro:IPR015522"
                     /db_xref="GeneID:10496344"
                     /translation="MAKDMTEGSPAKLLLFFTLPLIAGNIMQQLYAFIDTLLVGRFLG
                     IEALAAVGCTGSLMFLMLGFVIGLTSGLAICTGQRYGAKDAAGVRKSAAACAVLSFSI
                     AVLLSIVGFFFCRPLLEFMNTPSELLDNATAFFSIICGGAVFATAALMAANILRALGD
                     SKMPTVILGVGIAINIALEVLFLLAFGWGIPGAAYATVVSWALATGIFFVYIARRVPE
                     LHVRREDWRLSWSFLRTHLAIGLPMGFQATIIAFGAVILQVALNGLGPVAVAAYAAAQ
                     KVDTIAMMPMMSFGAAMAAYTAQNYGAGKFSRIRTGVQACCRMSVGFSLAAGAFVIAA
                     GPYLMELFVGAGEAEAIRLGQTYFLVNGLTYWSLSLLFIFRYTLQGLGQSIVPTVAGV
                     MELIMRATAGIVLVDALGFLGACLGNPMAWLGSCVPLAIAYFMTVRRLPKEVR"
     misc_feature    151928..153241
                     /locus_tag="Selsp_0140"
                     /note="Na+-driven multidrug efflux pump [Defense
                     mechanisms]; Region: NorM; COG0534"
                     /db_xref="CDD:223608"
     misc_feature    151940..153223
                     /locus_tag="Selsp_0140"
                     /note="Subfamily of the multidrug and toxic compound
                     extrusion (MATE)-like proteins similar to Bacillus
                     subtilis yoeA; Region: MATE_yoeA_like; cd13138"
                     /db_xref="CDD:240543"
     gene            complement(153329..153592)
                     /locus_tag="Selsp_0141"
                     /db_xref="GeneID:10496345"
     CDS             complement(153329..153592)
                     /locus_tag="Selsp_0141"
                     /note="COGs: COG4115 conserved hypothetical protein;
                     InterPro IPR009614;
                     KEGG: sab:SAB2287c hypothetical protein;
                     PFAM: Addiction module toxin, Txe/YoeB;
                     SPTR: Addiction module toxin, Txe/YoeB family;
                     TIGRFAM: Addiction module toxin, Txe/YoeB;
                     IMG reference gene:2504585594;
                     PFAM: Plasmid encoded toxin Txe;
                     TIGRFAM: toxin-antitoxin system, toxin component, Txe/YoeB
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="addiction module toxin, Txe/YoeB family"
                     /protein_id="YP_004412580.1"
                     /db_xref="GI:330838000"
                     /db_xref="InterPro:IPR009614"
                     /db_xref="GeneID:10496345"
                     /translation="MSRITFTEKGFQQYIAWQTMDKKMLKRINELLKSIDRDGAMNGI
                     GKPEKLKHRDGEYSRRIDDANRLVYEIDESGIIVKACKGHYEE"
     misc_feature    complement(153338..153577)
                     /locus_tag="Selsp_0141"
                     /note="Plasmid encoded toxin Txe; Region: Plasmid_Txe;
                     cl17389"
                     /db_xref="CDD:247943"
     gene            complement(153589..153855)
                     /locus_tag="Selsp_0142"
                     /db_xref="GeneID:10496346"
     CDS             complement(153589..153855)
                     /locus_tag="Selsp_0142"
                     /note="InterPro IPR006442;
                     KEGG: ere:EUBREC_0316 hypothetical protein;
                     PFAM: Prevent-host-death protein;
                     SPTR: Toxin-antitoxin system, antitoxin component, PHD
                     family;
                     IMG reference gene:2504585595;
                     PFAM: Phd_YefM"
                     /codon_start=1
                     /transl_table=11
                     /product="Prevent-host-death protein"
                     /protein_id="YP_004412581.1"
                     /db_xref="GI:330838001"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="GeneID:10496346"
                     /translation="MNITIAKQADIRANMKKYFDLAYDGETIIVPRKENRNIVIVSEQ
                     EYKRMEKARRNAEYLAMLEQSDRQLREGRVVVKTMEELEAMANS"
     misc_feature    complement(153694..153831)
                     /locus_tag="Selsp_0142"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; cl09153"
                     /db_xref="CDD:263731"
     gene            154434..155783
                     /locus_tag="Selsp_0143"
                     /db_xref="GeneID:10496347"
     CDS             154434..155783
                     /locus_tag="Selsp_0143"
                     /note="COGs: COG2271 Sugar phosphate permease;
                     InterPro IPR011701;
                     KEGG: bth:BT_4728 putative hexose phosphate transport
                     protein;
                     PFAM: Major facilitator superfamily MFS-1;
                     SPTR: Putative regulatory protein UhpC;
                     IMG reference gene:2504585596;
                     PFAM: Major Facilitator Superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="major facilitator superfamily MFS_1"
                     /protein_id="YP_004412582.1"
                     /db_xref="GI:330838002"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:10496347"
                     /translation="MLAFINKLFLTAPDAPPMQDAEKAKSIFYSLRWRVFASITIGYA
                     FYYIIRQSYSVIKKPLLASGAVDPTQVGIIGSIFFVTYGLGKFTNSFLADRMNNKRFF
                     AFGLFMSSVTMAAMGLVNSFVPLAVLWGINGWFQSYGAGPSIVSLNQWFSNRMRGTLY
                     GVWFTSHNLGSSFAYFAIAAIVSAYSWSMGFIAAGLISLVGTIFIYLGMSDRPETRGL
                     PNGAVLYGEKTQAQVDEEKTRSVGSMQWNAVVKNPAVWILGLSSLCVYIARYAVESWG
                     VVYLTSHKGYDIMGAAGVMAYMQVAGIFGALLCGWISDRFFHSKRNMPALIYGLLYTA
                     SIAGFVWAPQSFYMDLFCMTFYGFTMGALVCYMGGLMAVDIVPKRVTGAAMGMIGLLS
                     YAGAAIQEFVTGKLMTITTVGGEKIYDFGYATEFWVGAALLSTLLALLVWNAKPDEA"
     misc_feature    154470..155660
                     /locus_tag="Selsp_0143"
                     /note="regulatory protein UhpC; Provisional; Region:
                     PRK11663"
                     /db_xref="CDD:183266"
     misc_feature    154539..155675
                     /locus_tag="Selsp_0143"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(154581..154583,154590..154598,154602..154607,
                     154656..154658,154665..154670,154677..154679,
                     154689..154694,154698..154703,154839..154844,
                     154851..154856,154863..154868,154875..154877,
                     154911..154916,154923..154928,154944..154946,
                     155229..155231,155238..155243,155250..155255,
                     155262..155264,155304..155306,155316..155318,
                     155328..155330,155337..155339,155349..155351,
                     155502..155504,155511..155516,155523..155525,
                     155538..155543,155550..155552,155583..155588,
                     155595..155600,155607..155612,155619..155621)
                     /locus_tag="Selsp_0143"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(155856..157367)
                     /locus_tag="Selsp_0144"
                     /db_xref="GeneID:10496348"
     CDS             complement(155856..157367)
                     /locus_tag="Selsp_0144"
                     /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
                     InterPro IPR004089;
                     KEGG: tro:trd_A0295 methyl-accepting chemotaxis sensory
                     transducer;
                     PFAM: Chemotaxis methyl-accepting receptor, signalling;
                     SMART: Chemotaxis methyl-accepting receptor, signalling;
                     SPTR: Putative methyl-accepting chemotaxis protein;
                     IMG reference gene:2504585597;
                     PFAM: Methyl-accepting chemotaxis protein (MCP) signaling
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_004412583.1"
                     /db_xref="GI:330838003"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="GeneID:10496348"
                     /translation="MWHESLLMERWQFQCDGLHPSALPEGTHPRKSEEKGWCIMGFFQ
                     KEKAAAMPAAAQSQGAADDIRRLEQYLKTLASGKLETPPPQVRDASLQPLAAALQAFA
                     AQQEQQAHDITLMLNDSLASQIHASIMLNKLFFNLTDIASGVQEVMSVIRTLAESIND
                     IASMSTNIAEQTNSGQTTMNAAGATIMEMSAGNKVVGESIGLMVQRMETLTSSTANIH
                     TLVATVNGISEQTNLLALNASIEAARAGEHGRGFAVVAEEVRKLAVQSKESVEEIRAQ
                     LTSIQNEVKNLGGQFDSMDETFTKNSENIEATEQQAGAIRDTFTDISTAMEKLAPFAE
                     QQSASFEEMTASLSQAVDNMHTAKNESKECNTGLFHVLMESSAVRTNFLKNGLSLTSN
                     ELLDLARTDHLIWFARINQMLLGNLQLNSADVINHETCRLGHWYSGEGRTKYGGTPVF
                     ENLDAAHARFHQLCAEAIDAYNNHNEYKVRSLLPEIESVSEEVLGALDHLKTT"
     misc_feature    complement(156327..156935)
                     /locus_tag="Selsp_0144"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(156330..156332,156339..156344,
                     156351..156353,156360..156365,156369..156374,
                     156381..156386,156390..156395,156402..156404,
                     156411..156416,156423..156425,156432..156437,
                     156444..156449,156453..156458,156465..156467,
                     156474..156479,156486..156488,156495..156500,
                     156537..156542,156549..156554,156558..156563,
                     156570..156575,156582..156584,156591..156596,
                     156603..156605,156612..156614,156624..156626,
                     156645..156647,156654..156656,156666..156668,
                     156675..156680,156687..156689,156696..156698,
                     156705..156710,156717..156722,156729..156731,
                     156738..156743,156747..156749,156771..156776,
                     156780..156785,156792..156794,156801..156806,
                     156813..156818,156825..156827,156843..156848,
                     156855..156857,156864..156869,156873..156878,
                     156885..156887,156894..156899,156906..156911))
                     /locus_tag="Selsp_0144"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(156579..156680)
                     /locus_tag="Selsp_0144"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(155958..156173)
                     /locus_tag="Selsp_0144"
                     /note="Chemoreceptor zinc-binding domain; Region: CZB;
                     pfam13682"
                     /db_xref="CDD:257985"
     gene            157599..158192
                     /locus_tag="Selsp_0145"
                     /db_xref="GeneID:10496349"
     CDS             157599..158192
                     /locus_tag="Selsp_0145"
                     /note="COGs: COG0860 N-acetylmuramoyl-L-alanine amidase;
                     InterPro IPR002508;
                     KEGG: afn:Acfer_1125 cell wall hydrolase/autolysin;
                     PFAM: Cell wall hydrolase/autolysin, catalytic;
                     SMART: Cell wall hydrolase/autolysin, catalytic;
                     SPTR: N-acetylmuramoyl-L-alanine amidase CwlB;
                     IMG reference gene:2504585598;
                     PFAM: N-acetylmuramoyl-L-alanine amidase"
                     /codon_start=1
                     /transl_table=11
                     /product="cell wall hydrolase/autolysin"
                     /protein_id="YP_004412584.1"
                     /db_xref="GI:330838004"
                     /db_xref="InterPro:IPR002508"
                     /db_xref="GeneID:10496349"
                     /translation="MRVFLNPGHDPLYDSGAVNEELGLRECDVAADIGERVKLYLELV
                     GIEVFLMQSDNLAWESRHLERWNAAVTDEANKWCADIFISLHCNAADGEAHGTETLIY
                     ERGTRAERLARAIGWQITTSLGTADRGVKERPELIVLHATAMPAVLVEMAFIDYLPEA
                     KLLIEKADVFARAIARGVTDYETEMQAEESAASAISE"
     misc_feature    157599..158141
                     /locus_tag="Selsp_0145"
                     /note="N-acetylmuramoyl-L-alanine amidase [Cell envelope
                     biogenesis, outer membrane]; Region: AmiC; COG0860"
                     /db_xref="CDD:223929"
     misc_feature    157602..158135
                     /locus_tag="Selsp_0145"
                     /note="N-acetylmuramoyl-L-alanine amidase or MurNAc-LAA
                     (also known as peptidoglycan aminohydrolase, NAMLA
                     amidase, NAMLAA, Amidase 3, and peptidoglycan amidase; EC
                     3.5.1.28) is an autolysin that hydrolyzes the amide bond
                     between N-acetylmuramoyl and L-amino...; Region:
                     MurNAc-LAA; cd02696"
                     /db_xref="CDD:119407"
     misc_feature    order(157623..157625,157674..157676,157854..157856,
                     158046..158048)
                     /locus_tag="Selsp_0145"
                     /note="active site"
                     /db_xref="CDD:119407"
     misc_feature    order(157623..157625,157674..157676,157854..157856)
                     /locus_tag="Selsp_0145"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:119407"
     gene            158312..159121
                     /locus_tag="Selsp_0146"
                     /db_xref="GeneID:10496350"
     CDS             158312..159121
                     /locus_tag="Selsp_0146"
                     /note="InterPro IPR010106;
                     KEGG: afn:Acfer_1503 tetracycline resistance leader
                     peptide;
                     SPTR: Putative uncharacterized protein;
                     TIGRFAM: Conserved hypothetical protein CHP01784;
                     IMG reference gene:2504585599;
                     TIGRFAM: conserved hypothetical protein (putative
                     transposase or invertase)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412585.1"
                     /db_xref="GI:330838005"
                     /db_xref="GeneID:10496350"
                     /translation="MYRIKPWEELTIQDDYMFKLIMGVKRICLSLLQSILHVEIADIH
                     YLETEKSVDVRYQGKGIRMDVYVRDDANTVYNIEMQVRMPEGKSLFKRTRYYQAMIDA
                     DLLETGADYDDLNKTIIIFICPFDPFGKGRHIYTFRNFCAEDKTLELSDDAAKIFLNA
                     KGTLNDVDESIKAFLDYVNGIVCNDPLVRAIDEEIRRIKEENEERVSYMTFAMKMMEE
                     RKEGFKEGKAEGLASSIRNMMKNMGISLEKAMDVLQIPMDERAKYAALVKD"
     misc_feature    158348..159100
                     /locus_tag="Selsp_0146"
                     /note="conserved hypothetical protein (putative
                     transposase or invertase); Region: T_den_put_tspse;
                     TIGR01784"
                     /db_xref="CDD:130844"
     misc_feature    158354..158935
                     /locus_tag="Selsp_0146"
                     /note="PD-(D/E)XK nuclease family transposase; Region:
                     PDDEXK_2; pfam12784"
                     /db_xref="CDD:257294"
     gene            159462..159815
                     /locus_tag="Selsp_0147"
                     /db_xref="GeneID:10496351"
     CDS             159462..159815
                     /locus_tag="Selsp_0147"
                     /note="COGs: COG0838 NADH:ubiquinone oxidoreductase
                     subunit 3 (chain A);
                     InterPro IPR000440;
                     KEGG: cbe:Cbei_2996 NADH-ubiquinone/plastoquinone
                     oxidoreductase, chain 3;
                     PFAM: NADH:ubiquinone/plastoquinone oxidoreductase, chain
                     3;
                     SPTR: NADH-quinone oxidoreductase subunit;
                     IMG reference gene:2504585600;
                     PFAM: NADH-ubiquinone/plastoquinone oxidoreductase, chain
                     3"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-ubiquinone/plastoquinone oxidoreductase
                     chain 3"
                     /protein_id="YP_004412586.1"
                     /db_xref="GI:330838006"
                     /db_xref="InterPro:IPR000440"
                     /db_xref="GeneID:10496351"
                     /translation="MGEFGGLGLFLIVAIAFPFMVLAPARILQPRQPTPEKQKPYECG
                     VDTVGSSDVQYHVGYFRYALAFLLFDVETVFLYPWAVSFNRLGLFAFLEMFVFLGILA
                     LGLWYAWRKGDLAWK"
     misc_feature    159486..159809
                     /locus_tag="Selsp_0147"
                     /note="NADH-ubiquinone/plastoquinone oxidoreductase, chain
                     3; Region: Oxidored_q4; cl00535"
                     /db_xref="CDD:260484"
     gene            159806..160315
                     /locus_tag="Selsp_0148"
                     /db_xref="GeneID:10496352"
     CDS             159806..160315
                     /locus_tag="Selsp_0148"
                     /EC_number="1.6.99.5"
                     /EC_number="1.6.5.3"
                     /note="COGs: COG0377 NADH:ubiquinone oxidoreductase 20 kD
                     subunit and related Fe-S oxidoreductase;
                     InterPro IPR006137:IPR006138;
                     KEGG: hmo:HM1_2197 NADH dehydrogenase subunit B;
                     PFAM: NADH:ubiquinone oxidoreductase-like, 20kDa subunit;
                     PRIAM: NADH dehydrogenase (quinone);
                     SPTR: NADH-quinone oxidoreductase subunit B;
                     TIGRFAM: NADH-ubiquinone oxidoreductase, 20 Kd subunit;
                     IMG reference gene:2504585601;
                     PFAM: NADH ubiquinone oxidoreductase, 20 Kd subunit;
                     TIGRFAM: NADH-quinone oxidoreductase, B subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-quinone oxidoreductase, B subunit"
                     /protein_id="YP_004412587.1"
                     /db_xref="GI:330838007"
                     /db_xref="InterPro:IPR006137"
                     /db_xref="InterPro:IPR006138"
                     /db_xref="InterPro:IPR014406"
                     /db_xref="GeneID:10496352"
                     /translation="MEVVDIVPAALRENVIVTSVDAVFKWARSRSIWPLASGLACCSI
                     EMMATAASRFDLARFGYEVFRACPRQADLLIVAGTLTWKMTPPLIRLYEEMPEPKYVI
                     AMGNCNIHGGPFTDSYATVKCLDEVLPVDLYLPGCPPRPEALIDAMIKLRNKIQHPEL
                     AKRAGGEAR"
     misc_feature    159818..160294
                     /locus_tag="Selsp_0148"
                     /note="NADH dehydrogenase subunit B; Validated; Region:
                     PRK06411"
                     /db_xref="CDD:235797"
     gene            160312..160809
                     /locus_tag="Selsp_0149"
                     /db_xref="GeneID:10496353"
     CDS             160312..160809
                     /locus_tag="Selsp_0149"
                     /note="COGs: COG0852 NADH:ubiquinone oxidoreductase 27 kD
                     subunit;
                     InterPro IPR001268;
                     KEGG: mta:Moth_0979 NADH (or F420H2) dehydrogenase,
                     subunit C;
                     PFAM: NADH:ubiquinone oxidoreductase, 30kDa subunit;
                     SPTR: NADH-quinone oxidoreductase;
                     IMG reference gene:2504585602;
                     PFAM: Respiratory-chain NADH dehydrogenase, 30 Kd subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (ubiquinone) 30 kDa subunit"
                     /protein_id="YP_004412588.1"
                     /db_xref="GI:330838008"
                     /db_xref="InterPro:IPR001268"
                     /db_xref="InterPro:IPR020396"
                     /db_xref="GeneID:10496353"
                     /translation="MRTQYFSKERLAKLVEVFPKATFDAEAEEPAFIVTAADFPAVLR
                     ALKEKEGFDRLGNLTAVDWKDHIEMVYHLYNMEENVKLEVKAALDSAAPVIESATSLY
                     PGAEFEEREVYDLMGVEFLSHPDLRRILMPDNYPAHPLRKDFVAPVPKMEGGKLVWLK
                     KAPTS"
     misc_feature    160432..160737
                     /locus_tag="Selsp_0149"
                     /note="Respiratory-chain NADH dehydrogenase, 30 Kd
                     subunit; Region: Complex1_30kDa; pfam00329"
                     /db_xref="CDD:249774"
     gene            160782..161879
                     /locus_tag="Selsp_0150"
                     /db_xref="GeneID:10496354"
     CDS             160782..161879
                     /locus_tag="Selsp_0150"
                     /EC_number="1.6.99.5"
                     /note="COGs: COG0649 NADH:ubiquinone oxidoreductase 49 kD
                     subunit 7;
                     InterPro IPR001135;
                     KEGG: hmo:HM1_2199 proton-translocating NADH-ubiquinone
                     oxidoreductase, chain D;
                     PFAM: NADH-quinone oxidoreductase, subunit D;
                     PRIAM: NADH dehydrogenase (quinone);
                     SPTR: Proton-translocating NADH-quinone oxidoreductase, D
                     subunit;
                     IMG reference gene:2504585603;
                     PFAM: Respiratory-chain NADH dehydrogenase, 49 Kd subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (quinone)"
                     /protein_id="YP_004412589.1"
                     /db_xref="GI:330838009"
                     /db_xref="InterPro:IPR001135"
                     /db_xref="InterPro:IPR014029"
                     /db_xref="GeneID:10496354"
                     /translation="MAEKSTYILNMGPQHPSTHGVLQVELELSGERIERAKPILGYLH
                     RGIEKLMESRTYAQCLPYTDKLDYVSSMNNNLAWCTAVEKLAGIRVPLRAEYLRVIAA
                     ELNRIASHLVFIGTLLNDLGAATAFVYAFRDREKVLDLFDLICGARMSTSYIRLGGVA
                     FDATEEFIEKTQAFLDYVPEMLEEYDNLITGNEIFYARMKGVSPMTAEEAKALSLSGA
                     NLRATGVAYDIRRVEPYSVYDRLDFEVPVGTLGDDWDRYEVRLKEIGESAKIIRQALK
                     EMPEGSCRKVVSPNLRPPKGSVYHRVENTRGELGFYIVSDGTAKPYRVHIRRPSFVNL
                     QALDPLCRGTLVADSVVVYSTLDPLMGEVDC"
     misc_feature    160782..161876
                     /locus_tag="Selsp_0150"
                     /note="NADH dehydrogenase subunit D; Validated; Region:
                     PRK06075; cl17338"
                     /db_xref="CDD:247892"
     misc_feature    160788..161855
                     /locus_tag="Selsp_0150"
                     /note="Ni,Fe-hydrogenase III large subunit [Energy
                     production and conversion]; Region: HycE; COG3261"
                     /db_xref="CDD:225800"
     gene            161891..162928
                     /locus_tag="Selsp_0151"
                     /db_xref="GeneID:10496355"
     CDS             161891..162928
                     /locus_tag="Selsp_0151"
                     /EC_number="1.6.99.5"
                     /note="COGs: COG1005 NADH:ubiquinone oxidoreductase
                     subunit 1 (chain H);
                     InterPro IPR001694;
                     KEGG: mta:Moth_0981 respiratory-chain NADH dehydrogenase,
                     subunit 1;
                     PFAM: NADH:ubiquinone oxidoreductase, subunit 1/F420H2
                     oxidoreductase subunit H;
                     PRIAM: NADH dehydrogenase (quinone);
                     SPTR: NADH dehydrogenase I, H subunit;
                     IMG reference gene:2504585604;
                     PFAM: NADH dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH dehydrogenase (quinone)"
                     /protein_id="YP_004412590.1"
                     /db_xref="GI:330838010"
                     /db_xref="InterPro:IPR001694"
                     /db_xref="InterPro:IPR018086"
                     /db_xref="GeneID:10496355"
                     /translation="METGIVYSYINELRIFLTGALGDAFLAEVVMTFLGIAVLLMVVM
                     NAALVFTFGERKVCAFIQVRLGPNRVGPGGLLQPVADAMKLLSKEDIMPDGADRIVWS
                     LSPILVFVPAALLYAFYPFDAGVVFADVNIGLFLLLAISAQAVLPFFMGGFASNSKYG
                     LIGSMRAVAQLLTYELPLGFALMGVVMLAGSLDMSRIVEAQADCWYIFKQPLAFLIVF
                     ICMIAESNRPPFNLLEGESEIIAGPFTEYSGMRWALFFLAEFANLLSIAILVTTLFLG
                     GWQGPAFLPGIFWFFLKAFVMVVIFQWVGWTFPRFRIDHQIAFGWKLLLPVAMLNVLL
                     TGIGMMLWQMF"
     misc_feature    161975..162901
                     /locus_tag="Selsp_0151"
                     /note="NADH:ubiquinone oxidoreductase subunit H;
                     Provisional; Region: PRK06076"
                     /db_xref="CDD:235692"
     gene            162959..163378
                     /locus_tag="Selsp_0152"
                     /db_xref="GeneID:10496356"
     CDS             162959..163378
                     /locus_tag="Selsp_0152"
                     /note="COGs: COG1143 Formate hydrogenlyase subunit
                     6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I);
                     InterPro IPR001450;
                     KEGG: hmo:HM1_2201 proton-translocating NADH-ubiquinone
                     oxidoreductase, 23 kd, chain I;
                     PFAM: 4Fe-4S binding domain;
                     SPTR: NADH-quinone oxidoreductase, I subunit;
                     IMG reference gene:2504585605;
                     PFAM: 4Fe-4S binding domain;
                     TIGRFAM: NADH-quinone oxidoreductase, chain I"
                     /codon_start=1
                     /transl_table=11
                     /product="4Fe-4S ferredoxin iron-sulfur binding
                     domain-containing protein"
                     /protein_id="YP_004412591.1"
                     /db_xref="GI:330838011"
                     /db_xref="InterPro:IPR001450"
                     /db_xref="InterPro:IPR012285"
                     /db_xref="InterPro:IPR017896"
                     /db_xref="InterPro:IPR017900"
                     /db_xref="GeneID:10496356"
                     /translation="MWGKGLTKGLGVTWGHLWGKKETVSYPEEKIPMTERFRGGHLAM
                     EAEKCISCRLCATNCPNKALDLHIVTDEAKKRHMAEYWHDIGRCIYCGICVEVCPPKA
                     ISWDKNFAIASYFKEDMRYDAVAEEREKKKEGGEPHE"
     misc_feature    162983..163324
                     /locus_tag="Selsp_0152"
                     /note="NADH-quinone oxidoreductase, chain I; Region: NuoI;
                     TIGR01971"
                     /db_xref="CDD:233661"
     misc_feature    163100..163255
                     /locus_tag="Selsp_0152"
                     /note="4Fe-4S double cluster binding domain; Region:
                     Fer4_16; pfam13484"
                     /db_xref="CDD:257808"
     gene            163371..163874
                     /locus_tag="Selsp_0153"
                     /db_xref="GeneID:10496357"
     CDS             163371..163874
                     /locus_tag="Selsp_0153"
                     /note="COGs: COG0839 NADH:ubiquinone oxidoreductase
                     subunit 6 (chain J);
                     InterPro IPR001457;
                     KEGG: hmo:HM1_2202 proton-translocating NADH-ubiquinone
                     oxidoreductase, chain J;
                     PFAM: NADH:ubiquinone/plastoquinone oxidoreductase, chain
                     6;
                     SPTR: NADH dehydrogenase I, J subunit;
                     IMG reference gene:2504585606;
                     PFAM: NADH-ubiquinone/plastoquinone oxidoreductase chain
                     6"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-ubiquinone/plastoquinone oxidoreductase
                     chain 6"
                     /protein_id="YP_004412592.1"
                     /db_xref="GI:330838012"
                     /db_xref="InterPro:IPR001457"
                     /db_xref="GeneID:10496357"
                     /translation="MSDFLNTGAFYLLAAVTLAGALGVVLAKKLVHAALLLTVTFIGI
                     ACLYFQLGADFLGAAQLMIYAGGVAVLIVLGVMLTRHTPGEETSPDNARWFAAPVAAA
                     LFFAVVFSAVYVTPFAEVMEAPAGNSIEKLADLMLGEYVMTFELAAALLLAALVGAIV
                     LAKEEGQ"
     misc_feature    163395..163865
                     /locus_tag="Selsp_0153"
                     /note="NADH-ubiquinone/plastoquinone oxidoreductase chain
                     6; Region: Oxidored_q3; cl17265"
                     /db_xref="CDD:266596"
     gene            163871..164182
                     /locus_tag="Selsp_0154"
                     /db_xref="GeneID:10496358"
     CDS             163871..164182
                     /locus_tag="Selsp_0154"
                     /note="COGs: COG0713 NADH:ubiquinone oxidoreductase
                     subunit 11 or 4L (chain K);
                     InterPro IPR001133;
                     KEGG: chy:CHY_1418 proton-translocating NADH-quinone
                     oxidoreductase subunit K;
                     PFAM: NADH-ubiquinone oxidoreductase chain 4L/K;
                     SPTR: NADH-quinone oxidoreductase subunit K;
                     IMG reference gene:2504585607;
                     PFAM: NADH-ubiquinone/plastoquinone oxidoreductase chain
                     4L"
                     /codon_start=1
                     /transl_table=11
                     /product="NADH-ubiquinone oxidoreductase chain 4L"
                     /protein_id="YP_004412593.1"
                     /db_xref="GI:330838013"
                     /db_xref="InterPro:IPR001133"
                     /db_xref="GeneID:10496358"
                     /translation="MSVGLLHYLILAAILFSIGLFGLIQKRNLIVVLMSIELMLNAAN
                     LNLVAFNRFLPVDALEGQLLAIFSLMVGAAEIAVGLALAFRIYHDRHTISLDALQRMK
                     G"
     misc_feature    163874..164179
                     /locus_tag="Selsp_0154"
                     /note="NADH:ubiquinone oxidoreductase subunit K;
                     Validated; Region: PRK05715"
                     /db_xref="CDD:180218"
     gene            164194..166095
                     /locus_tag="Selsp_0155"
                     /db_xref="GeneID:10496359"
     CDS             164194..166095
                     /locus_tag="Selsp_0155"
                     /EC_number="1.6.99.5"
                     /note="COGs: COG1009 NADH:ubiquinone oxidoreductase
                     subunit 5 (chain L)/Multisubunit Na+/H+ antiporter MnhA
                     subunit;
                     InterPro IPR003945:IPR001516:IPR001750;
                     KEGG: hmo:HM1_2204 proton-translocating NADH-ubiquinone
                     oxidoreductase, chain L;
                     PFAM: NADH:ubiquinone/plastoquinone oxidoreductase;
                     NADH:ubiquinone oxidoreductase, chain 5/L, N-terminal;
                     PRIAM: NADH dehydrogenase (quinone);
                     SPTR: Proton-translocating NADH-quinone oxidoreductase, L
                     subunit;
                     TIGRFAM: NADH-plastoquinone oxidoreductase, chain 5;
                     IMG reference gene:2504585608;
                     PFAM: NADH-Ubiquinone oxidoreductase (complex I), chain 5
                     N-terminus; NADH-Ubiquinone/plastoquinone (complex I),
                     various chains;
                     TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
                     chain L"
                     /codon_start=1
                     /transl_table=11
                     /product="proton-translocating NADH-quinone
                     oxidoreductase, chain L"
                     /protein_id="YP_004412594.1"
                     /db_xref="GI:330838014"
                     /db_xref="InterPro:IPR001516"
                     /db_xref="InterPro:IPR001750"
                     /db_xref="InterPro:IPR003945"
                     /db_xref="InterPro:IPR018393"
                     /db_xref="GeneID:10496359"
                     /translation="MFSSFALHHAWLIPLLPGIAFVLAGFLRALGRLAAALVVTAIAA
                     SFALSGGVIAEVLSTPITVEAPYVAKTAWMTVGSLVLEMGVLVDPITAMMLFVVTTVS
                     LCVAIYSVGYMKDDPGMGRFFSFISLFVASMLGLVLASNFLQLYVFWEGVGLCSYLLI
                     GFYYQRVSAREAAKKAFITTRVGDFGLLLGILLLQIHFGTLDFLNLRMLVPLEVLTLG
                     TVFLTVAGFLIFIGPIGKSGQFPLHVWLPDAMEGPTPVSALIHAATMVVAGVYLVARS
                     YFIFAASPFLMDLIAWVGGFTAIFAASIALTQREIKRILAYSTVSQLGYMMLALGVGS
                     LTASMFHLMTHAFFKALLFLSAGAVMHALADEADIFRMGGLWKKMPWTFAVMTIGVLA
                     ISGLPPFAGFFSKDEILFAAAEVSTPLYVLATVTAFMTALYMARLLFVAFLGDCRTGT
                     AYHAHEAGWWMRLPLLILAVLAVVSGFLGHAWGFGSWVYFGHAHEGAIDPTVAGISTA
                     LTLLALAIAYLVYVKKVVSADAIAERLGIFYTLSYHKYYIDEIYAGLRKVFVDGCGRV
                     FYWIDIYIVDGLVNLLALFVRLLSGVLSFFETGQTQFYATVVIVGAVLLALLGVYCAG
                     GTAFVGGGF"
     misc_feature    164221..166047
                     /locus_tag="Selsp_0155"
                     /note="NADH:ubiquinone oxidoreductase subunit L; Reviewed;
                     Region: PRK06590"
                     /db_xref="CDD:235836"
     misc_feature    164410..164577
                     /locus_tag="Selsp_0155"
                     /note="NADH-Ubiquinone oxidoreductase (complex I), chain 5
                     N-terminus; Region: Oxidored_q1_N; pfam00662"
                     /db_xref="CDD:109709"
     misc_feature    164608..165429
                     /locus_tag="Selsp_0155"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     gene            166095..167621
                     /locus_tag="Selsp_0156"
                     /db_xref="GeneID:10496360"
     CDS             166095..167621
                     /locus_tag="Selsp_0156"
                     /EC_number="1.6.99.5"
                     /note="COGs: COG1008 NADH:ubiquinone oxidoreductase
                     subunit 4 (chain M);
                     InterPro IPR010227:IPR001750;
                     KEGG: hmo:HM1_2205 proton-translocating NADH-ubiquinone
                     oxidoreductase, chain M;
                     PFAM: NADH:ubiquinone/plastoquinone oxidoreductase;
                     PRIAM: NADH dehydrogenase (quinone);
                     SPTR: NADH dehydrogenase I, M subunit;
                     TIGRFAM: NADH-quinone oxidoreductase, chain M/4;
                     IMG reference gene:2504585609;
                     PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
                     chains;
                     TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
                     chain M"
                     /codon_start=1
                     /transl_table=11
                     /product="proton-translocating NADH-quinone
                     oxidoreductase, chain M"
                     /protein_id="YP_004412595.1"
                     /db_xref="GI:330838015"
                     /db_xref="InterPro:IPR001750"
                     /db_xref="InterPro:IPR003918"
                     /db_xref="InterPro:IPR010227"
                     /db_xref="GeneID:10496360"
                     /translation="MDFPVLSVILLTPLAAALLLCFLNRESRSAIRIVAAAAMAFSFA
                     LSVWAYFGYDLAAGGMQYTERVPWITDLGVSYALGVDGISLPLLLLTELIGVSAVFSS
                     WHVEERSKEFFILLLILIAGVTGTFVANDLFIFLLCYEVVVIPIYILVILFGSTKRVT
                     KEYAGMKLTIYLLLGSAFLLVGVVWLYLTAFPAGSRTFDMQMLALAAQGGHFSPGFQI
                     GAFLLLLIGFGSLLSMFPFHSWSPDGYAGAPTAVSMIHAGVLKKIGGYGLIRIGLLVL
                     PLGAKFWAPLIAFLAMCNVLYAAYIALVQKDLKYVVGYSSVSHMGYVLLGFAALNVVS
                     VSGAVANMVAHGVMSALFFAMIGFIYEKTHLRTVDDLKGLAYQMPRLSTGFMLAGMAS
                     LGLPGLIGFVPEFTIFVGVFAEFPILAVLAIAGIIFTALYVLRLLAKVLFGPADKKFD
                     AYRDMRGAELVPLVLLGVALVGFGVFPHLLLGLISTGTEPLQPMLDQLSRIGFFLGGD
                     "
     misc_feature    166095..167570
                     /locus_tag="Selsp_0156"
                     /note="NADH:ubiquinone oxidoreductase subunit M; Reviewed;
                     Region: PRK05846"
                     /db_xref="CDD:235622"
     misc_feature    166479..167327
                     /locus_tag="Selsp_0156"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     gene            167624..169045
                     /locus_tag="Selsp_0157"
                     /db_xref="GeneID:10496361"
     CDS             167624..169045
                     /locus_tag="Selsp_0157"
                     /EC_number="1.6.99.5"
                     /note="COGs: COG1007 NADH:ubiquinone oxidoreductase
                     subunit 2 (chain N);
                     InterPro IPR010096:IPR001750;
                     KEGG: hmo:HM1_2206 proton-translocating NADH-ubiquinone
                     oxidoreductase, chain N;
                     PFAM: NADH:ubiquinone/plastoquinone oxidoreductase;
                     PRIAM: NADH dehydrogenase (quinone);
                     SPTR: NADH-quinone oxidoreductase subunit N;
                     TIGRFAM: NAD(P)H-quinone oxidoreductase, subunit N/subunit
                     2;
                     IMG reference gene:2504585610;
                     PFAM: NADH-Ubiquinone/plastoquinone (complex I), various
                     chains;
                     TIGRFAM: proton-translocating NADH-quinone oxidoreductase,
                     chain N"
                     /codon_start=1
                     /transl_table=11
                     /product="proton-translocating NADH-quinone
                     oxidoreductase, chain N"
                     /protein_id="YP_004412596.1"
                     /db_xref="GI:330838016"
                     /db_xref="InterPro:IPR001750"
                     /db_xref="InterPro:IPR010096"
                     /db_xref="GeneID:10496361"
                     /translation="MDFSAIGMELGLLALALLFLAMGVLLPKKESRTSLAAISVVALL
                     ALFAYGFSFYRGGEAASFYAGLYVVDNYAVFFKQLFILSAALVVLFSSDYVERLLRSR
                     AEFYAILVFAVLGMCVMASANDFLTLYIGLELMTISFYVFVGLRQRDALSSEAAIKYL
                     VLGAAASAILFFGVSFIYGAAGSLRFAAVVSSPQLFTPLGIVGMALVFAGIFFKLSMI
                     PFHMWAPDVYEGAPAPVAALLAMGSKAAAFAVLLRLVLAVFPPLGGMWLSLLAILAAV
                     SMVGGNVMAIVQDDVKRMLAYSSIAQVGYMLVGVVAADAAGMKALLFYLALYAFANIG
                     AFAVLTAVEAQRGKPDMANVTGLARTAPVLAAVMTISLLSMAGIPPTAGFAGKLYLFT
                     AVVDQGGLWLAFVGFIMSMISVYYYLLVVKAMYLGEGPKEPVKISGALRACVLVSVAL
                     TLALGVYPEPLANLTNFVAATFF"
     misc_feature    167627..169033
                     /locus_tag="Selsp_0157"
                     /note="NADH:ubiquinone oxidoreductase subunit N;
                     Provisional; Region: PRK05777"
                     /db_xref="CDD:235603"
     misc_feature    167987..168805
                     /locus_tag="Selsp_0157"
                     /note="NADH-Ubiquinone/plastoquinone (complex I), various
                     chains; Region: Oxidored_q1; pfam00361"
                     /db_xref="CDD:201180"
     gene            169215..173030
                     /locus_tag="Selsp_0158"
                     /db_xref="GeneID:10496362"
     CDS             169215..173030
                     /locus_tag="Selsp_0158"
                     /note="KEGG: rrs:RoseRS_0279 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585611"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412597.1"
                     /db_xref="GI:330838017"
                     /db_xref="GeneID:10496362"
                     /translation="MEYTKIVTAEDLSRYANSYISRGVIPELIYLLIRQSISDGDDCR
                     IPYGDGINQSGLDGSVDCAQGFLQFIPIGRSYWEIGTGADFRKKANEDLNKRTEQVEE
                     SERRNTTFVFVTPRLSGDSKEENQRAWSTQHADKGWKEIRIIDGVRLANWLCEFPAIA
                     RWLARKIGIIPNESGITTPLEYWEENFSRGRSDNPIISPLVYTATREKACRAIKDIFT
                     GKEQCLFLHPESEGDVEDFVAAYIISTKHEEIRQYAHQCLFISDTSAWRSIAELRKPH
                     ILVAGSELDLDSARQDLRVLAENRQHRLIIPLYGSLSDGQSNVVKLQSPTQYQIEDIL
                     RKENFSDARSRELARIGNRRLSALRRYLLGGAVPRYAKWVGADDIARANLLGRWSEKN
                     VADVQVLGSVLGMEEGEALRRLRGMLYQADTPLAQMDGKWRIVPRVEAWNALGNRLAD
                     EDLDRFQKIALLVLGERDPKFDLPKEERYAANVLGKELTYSTRLRKGMAETLALLGSR
                     PQALSQCSRGKAESVAARVVHNLFCDADWERWAGLDSIMPLLAEAAPKAFLDAVEESL
                     SDLCTTPFREVFAQEGGDLFGGGNYISGLLWGLECLAWSPEYLARTVVVLAELASIDP
                     GGRYSNRPEQSLADIFLPWHIQTTASFEQREAAIKKILKEQPNVGWKLLLSLLPNNLG
                     STSGCYRPVWRNFIPSDWEDDVLVSEYWAQIHMLAELAAEMTHSDVERLMELMDRLSD
                     LPHETQEVVLKHLMSDHILQMPEPKRVIIWEKLDELVRRHRKFSDAQWALPKETITKI
                     EQIANNITPADPMLRYRYLFSESDHDLFDEKGKYEEQREHLDEKRRSALAKIMGDGGD
                     FAQCLEFARTTAMPYKVGQTMGAIASDRVEAEILPSQLTADDEVVKRVVAGFVWARFW
                     QRGIQWVDNLLQRNWEPPRCAEFLLLLPFQEEIWERVSSYLGESHEELYWKHVDVRTG
                     IWKWEAVFVIEKLIAYGRAGAAVNCLTYVLDDEEGFDSDIVTRALIAVLANPQEIKQL
                     ERYDTIELIKQLQSSTSVDIEALYQIEWNFLPWFDRLSEDIPLTLEERLASEPAFFAE
                     MIKYAFRSKNDSADSVERLDEKKQSLSEHAYTLLNRWSTCPGMQKDGSFNEEVFRAWI
                     TEVRRLTEESGHDEIAQVEIGKVLTHASADPSGLWIHKSVADVLNRRDSKIMRRDFMI
                     ALMNQRGVYSFSHGVQERELARGYREKAEAAEKAGFVRFATTMRELADRYDEDAERDE
                     NRDPLEEYS"
     gene            173104..175065
                     /locus_tag="Selsp_0159"
                     /db_xref="GeneID:10496363"
     CDS             173104..175065
                     /locus_tag="Selsp_0159"
                     /note="InterPro IPR018647;
                     KEGG: cbe:Cbei_2021 hypothetical protein;
                     PFAM: Protein of unknown function DUF2075;
                     SPTR: Putative uncharacterized protein;
                     manually curated;
                     IMG reference gene:2504585612;
                     PFAM: Uncharacterized conserved protein (DUF2075)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412598.1"
                     /db_xref="GI:330838018"
                     /db_xref="InterPro:IPR018647"
                     /db_xref="GeneID:10496363"
                     /translation="MARAYYSSSIQSFLDTEVEQILGQLLIHDVFKTEDFQKHAWREE
                     ILILKEQLIAFEDGGIIFEFTIPRMGHRLDVVIIIAGILFLLEFKVGDKEYRKATEDQ
                     VMDYALDLKYFHEASKTRILMPMIVATEAVEEICTPSLLEDGIGEVLHCNRHNIGSTI
                     HRSLSQMHASPLSMEFWLNARYAPTPTIIEAAQALYRNHSVHEISRNDAGAENLTETT
                     ATINQIIDDCKTNHRKAICFVTGVPGAGKTLAGLNIANERHRFDADEHAVFLSGNGPL
                     VEVLQEALARDRAKVKGVTKAEAKRETKAFIQAIHKFRDEALTSERPPIEKVAIFDEA
                     QRAWDAHALSAFMARKKGNPNFVQSEPEFLISIMDRHADWAVIVCLVGGGQEIHTGEA
                     GISEWLEALQHEYTFWDIYLSDQMTDSEYMGGNGGMKAILGDRNYTIAPSLHLGVSLR
                     SFRSEKLSGFVKALLDNDVVAAQRIYMELCTDYPIVLTRNLAQAKAWVKEKARGTERY
                     GLLASAEGKRLRGLGISVSAEMDHVGWFLNEKEHVNSSYYLEVPASEFEIQGLEIDYA
                     LLAWDADFRYVHGTFDYYRFRGTQWNHIRQEQRKKYLKNAYRVLLTRARQGLVIFVPE
                     GDADDATRKAEYYDGTYEYLRRIGIAEIH"
     misc_feature    173794..174174
                     /locus_tag="Selsp_0159"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     misc_feature    173803..174975
                     /locus_tag="Selsp_0159"
                     /note="Uncharacterized conserved protein (DUF2075);
                     Region: DUF2075; pfam09848"
                     /db_xref="CDD:255602"
     misc_feature    <174700..174966
                     /locus_tag="Selsp_0159"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3410"
                     /db_xref="CDD:225944"
     gene            complement(175927..176451)
                     /locus_tag="Selsp_0160"
                     /db_xref="GeneID:10496364"
     CDS             complement(175927..176451)
                     /locus_tag="Selsp_0160"
                     /note="KEGG: ere:EUBREC_2827 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585613"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412599.1"
                     /db_xref="GI:330838019"
                     /db_xref="GeneID:10496364"
                     /translation="MPDMWVLRLSDAFERCQGDIELAVKVLNINDKRNRPILEKSHAL
                     RSYSVFVAKVRESVKSGNALEVAISEATRYCIAHNYLEDYFRQKQEEEVFDMLNFAWN
                     QERALEVRAEEARAEGLSQGLSQGLSQGVLETTITAIRNVMQSMNFSVEKAMDVLQIP
                     ADERAKYAALVGQR"
     gene            complement(176637..178181)
                     /locus_tag="Selsp_0161"
                     /db_xref="GeneID:10496365"
     CDS             complement(176637..178181)
                     /locus_tag="Selsp_0161"
                     /note="COGs: COG3666 Transposase and inactivated
                     derivatives;
                     InterPro IPR002559:IPR008490;
                     KEGG: bpb:bpr_IV196 IS4 family transposase;
                     SPTR: ISCpe5, transposase;
                     IMG reference gene:2504585614;
                     PFAM: Transposase DDE domain; Transposase domain (DUF772)"
                     /codon_start=1
                     /transl_table=11
                     /product="IS4 family transposase"
                     /protein_id="YP_004412600.1"
                     /db_xref="GI:330838020"
                     /db_xref="InterPro:IPR002559"
                     /db_xref="InterPro:IPR008490"
                     /db_xref="GeneID:10496365"
                     /translation="MQIPKNDPVRLLRQCIGGMNLTALYRTYGRIDKKLASPRQLLAI
                     LIYSGMNHLFSSRRIETACRRDVNFLYLLEGKPAPDHATISRFRSKHLASCIKELFAQ
                     MDILLQTLGVISLEHIFIDGTKIESIANKYKFVWKKTVLKNQAKLLEKLLVFIEQAEQ
                     QLSISVRHGKDLRLRHLKKMRKQLKRLQKKQGLVFVHGSGRRKSVLQKALEKLDEFIA
                     RWKDYQKKLRIMGTRNSFAKTDHDATFMRMKEDAMKNGQLKPAYNIQCGVDAEFITWA
                     TVGSQPTDTATLIPFLEDFHAHVKERYAKVIADAGYESEENYVYLKANGQAAYIKPNN
                     YERAKTRAWKNDIGRFENMTYLGDEDAYLCANGRKLKVTGTKTVRNKTGYTSVKTCYT
                     AEDCNGCERKAECIRSKSKLPLEERPKSLEVAKTFPEERAASKARLTSDEGIWLRVNR
                     SIQAEDAFANIKADMGFRRFLSRGNANVLVETMLLAMAHNFGKLHQKIQRGCGGQHLF
                     PVDVAA"
     misc_feature    complement(177756..178175)
                     /locus_tag="Selsp_0161"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3666"
                     /db_xref="CDD:226192"
     misc_feature    complement(<177030..177467)
                     /locus_tag="Selsp_0161"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1;
                     pfam01609"
                     /db_xref="CDD:250742"
     misc_feature    complement(176697..177095)
                     /locus_tag="Selsp_0161"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            178464..178802
                     /locus_tag="Selsp_0162"
                     /pseudo
                     /db_xref="GeneID:10496366"
     gene            complement(179162..180103)
                     /locus_tag="Selsp_0163"
                     /db_xref="GeneID:10496367"
     CDS             complement(179162..180103)
                     /locus_tag="Selsp_0163"
                     /note="KEGG: csc:Csac_0013 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585616"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412601.1"
                     /db_xref="GI:330838021"
                     /db_xref="GeneID:10496367"
                     /translation="MANTSLFHELHSALFHSLVEVIKEIHAGAKLTRKDILRRLQPLD
                     PVDTSRHEEIIETMFSFSPNGEAELFLEKPVRLPPTRAELRWLKTMLEDESAAFLVAD
                     ELRGKLLSRLAEVRAYPQEVWRVLRGRGDDVRLVEEPLGEFWRALAEGRMVFCRNVDA
                     RGARHESKAAPCRLEYDAEENRCRAIVWLVDEGRAVKMNFSRIEEIRVLEEPVPRDTE
                     EKFRAFLAARRRSVTLRLAPKNNAVERAFCLFAPYDKEAAFDEESGVYTLTVFYYDFD
                     EQEMIGQILSLGSAARVLAPEKMRQAVIEILQDECSE"
     misc_feature    complement(179177..179686)
                     /locus_tag="Selsp_0163"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            complement(180078..181364)
                     /locus_tag="Selsp_0164"
                     /db_xref="GeneID:10496368"
     CDS             complement(180078..181364)
                     /locus_tag="Selsp_0164"
                     /note="KEGG: cbe:Cbei_3559 transcriptional regulator-like
                     protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585617"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412602.1"
                     /db_xref="GI:330838022"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:10496368"
                     /translation="MRTESKTKNRRESTAANRFIGDYDTVRPLLRYISYGCYHKSFLV
                     ERLGQSARAYEENMARLRFFLPEGSLKSSRQGRREVYRFEGDSYRITDDFLAYTYRIK
                     ALKNTTAFCLIGLLQILGAAKEALDVTTIFEYEMMSGKAIPEGLEDLSRRTVQRYLQD
                     LEEQGVVCKAEENGRFLYRLADDPLERLSSEDVASLCRAASFYRAMTQFSLPGCFLED
                     ALQHDGQEKETKPLAQFKHRATAHLLDDEVVFQCLTCLEERREMTFVYGRERRKLRVV
                     PLRLVSDMYAGRRYVLAARLPAKGGRRAQGSQMFRLDLMQKVRTGRVWTGALPKIAVK
                     EPELCIDFFPKGETAGAAVKGRILARFSEAVLEEADGRIGVRLKIADARSLLPWLRTF
                     WPLAHVSLPQSPHLAERLKEDLEEALENYGEHLTLS"
     misc_feature    complement(<180825..181028)
                     /locus_tag="Selsp_0164"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    complement(180111..180626)
                     /locus_tag="Selsp_0164"
                     /note="WYL domain; Region: WYL; pfam13280"
                     /db_xref="CDD:257623"
     gene            complement(181377..183257)
                     /locus_tag="Selsp_0165"
                     /db_xref="GeneID:10496369"
     CDS             complement(181377..183257)
                     /locus_tag="Selsp_0165"
                     /note="KEGG: vpr:Vpar_1822 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585618"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412603.1"
                     /db_xref="GI:330838023"
                     /db_xref="GeneID:10496369"
                     /translation="MRHHIMLLMLSDVKTDRKNPKRVSMVEYAGAIGDCGVTNESAVR
                     HLLLSKDGDRNISLDKMFLFATEKVQEPIEIEQPSPDVDAGVTHFGYFKKRLTDVLPC
                     IEESGFIEVVPYDAKMPISATRRFVLEMAERIMDYAQAKRAQGDTVVLHADLTGGPRH
                     AVMLMFAVMRLLQYNGIEIGKVLYSNMGLKIVEEVNDVYGIFDLIAGADEFAQFGSVS
                     AILRYFGYDKKILARPPHISERLHRLLLAMHGFAEEIKVCHYGAFAHAVEELFKALKE
                     FREGSEADGADINEGMIAQLRFRVEEEYREILGEKIDDVKLLRWCVNHGYLQQALTLF
                     TERVPAILTERKILQFTEDFAAKVQASMRETDKRSWVFYLFADYKDSKGVGQVDAFLE
                     NAKKAYRRIMQTIMADALDGKEAAFSGEEGWAAQLHRSVAKDPAVKSWPERAHESLVL
                     ENEEDVRQIYEKLLAWGRNPQDFQGKAPADSLWDSLADALCEKQLDMPEEADETAREA
                     LKKEWHEKFCAQRYGKTKLKALEKFVRGNMKASTADKIFSNVSLVPGTKELFSFRYCL
                     EQGGISCRIPHEDFYALLDIYYRLKEERNQSNHAREDSAPGGAKELRSLFEEALPLLE
                     RF"
     misc_feature    complement(182052..>182822)
                     /locus_tag="Selsp_0165"
                     /note="CRISPR/Cas system-associated protein Csx1; Region:
                     Csx1_III-U; cl17439"
                     /db_xref="CDD:266683"
     gene            complement(183310..183672)
                     /locus_tag="Selsp_0166"
                     /db_xref="GeneID:10496370"
     CDS             complement(183310..183672)
                     /locus_tag="Selsp_0166"
                     /note="KEGG: vpr:Vpar_1818 CRISPR-associated protein,
                     putative;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585619"
                     /codon_start=1
                     /transl_table=11
                     /product="CRISPR-associated protein, putative"
                     /protein_id="YP_004412604.1"
                     /db_xref="GI:330838024"
                     /db_xref="GeneID:10496370"
                     /translation="MFINHTNHASAKWPAAQKEAAHVWGEIVDLPFPDIGADWDEERV
                     AKLAEENAAKILAKKPRAVLCQGEFTYIYHLVNLLRAAGVTVLAAASRREAVEEQAED
                     GSVRKISRFVFTRFREYR"
     gene            complement(183683..185542)
                     /locus_tag="Selsp_0167"
                     /db_xref="GeneID:10496371"
     CDS             complement(183683..185542)
                     /locus_tag="Selsp_0167"
                     /note="KEGG: vpr:Vpar_1822 hypothetical protein;
                     SPTR: Putative 30S ribosomal protein S20;
                     IMG reference gene:2504585620;
                     PFAM: CRISPR-associated protein (cas_TM1812)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412605.1"
                     /db_xref="GI:330838025"
                     /db_xref="InterPro:IPR011742"
                     /db_xref="GeneID:10496371"
                     /translation="MTKNVHVMVAFVSQLTQKPSNVEYRSVDGKEIFSCMQTNEAAVC
                     QLQSLLQEEGGLAKIILIETDQARERVQRDTADWLALMEKYRSESMSAVELLKAQSVC
                     KYSELSQVFEDIEYSKMGIEDSMRSIAGIAERVRAFAERVREEEPEAEVVLHADMTGG
                     FRYAALMLLVVMQLSKYMGIRMGHVVYSDFVRGGESRVHLTDDIRRMFDLVTGADEFQ
                     KYGSVQALEEYFSRSSRHSEDFSALFAAMRRFSDAIRICRTSVIEDEMTDLAEKIRAF
                     RQAKPVSIEEEMFSHILGVIEGEYGSVIKNASGEKSDRRLDIIAWCVQKKFLQQAMTL
                     CTEWIPAILVEKKICYTEDEEVIEQCQERGDSGAGMRSWQQEFINSYGQVTESKEVKP
                     PTIPVPEGDFRNASFKEMTNLLRTILSSGVRTRVEDLPPEMKQGVQSFFAAYDEIASK
                     WQNYDLRQMGFRTRNTIIDRAITLLHPSPKKKFFHEEILRRLAGKSNEDIFTALGIDG
                     RKCEEACAGKEPPSKKRRTAKKQESPEEKWLRREACYRRMLSGHGKLLMYTQKTTEEA
                     VEFLRGFYFIRQGRNDTNHAAENAPTSRRNQGALENDRLEEEIAAYIEKLRKA"
     misc_feature    complement(184526..>185113)
                     /locus_tag="Selsp_0167"
                     /note="CRISPR/Cas system-associated protein Csx1; Region:
                     Csx1_III-U; cl17439"
                     /db_xref="CDD:266683"
     gene            complement(join(186256..186501,186572..187255))
                     /locus_tag="Selsp_0168"
                     /pseudo
                     /db_xref="GeneID:10496372"
     gene            187826..189454
                     /locus_tag="Selsp_0169"
                     /db_xref="GeneID:10496373"
     CDS             187826..189454
                     /locus_tag="Selsp_0169"
                     /note="KEGG: vpr:Vpar_1817 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585622"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412606.1"
                     /db_xref="GI:330838026"
                     /db_xref="GeneID:10496373"
                     /translation="MELKALLFDTRSIQKYIFSSSRLKTQIGASYLVDRVFDDVLLPV
                     ICEVCGAAELDDATWREVASPDWTSMPQKARVAYIGGGNAMILLRADAGEAAAEIVRR
                     FSKELLVRCPGLQTGAAIGTVDLASDGSWLSETANRTALVLKLKEQQNTAFPRTTIPY
                     TGLTLAADGADETATSYDTSRERYIAESEAAKLRVATPRHEGGELQPARAEKALLEKL
                     TSVLTDEEKSRFMENAVFPSELDKLGQKETENYIAVVHIDGNNMGKKFADLTTLSAYK
                     NKSQEIRTATIRAFAELVLSMKEDSFPFLAQRKDGEKRRYLPVRPLILGGDDMTFVCA
                     AKVAFDCTAFIMKSLLAKGVDTCAGVAILPTAYPFFRGYEIAEQLCDSAKGRMRKLAN
                     EREGLREEASCWLDFLRLHGEQAPTLDEIRRQEYRAALGSLHFGPYRIDGESHYAFAR
                     LRELAEGLSKSLPSGKLKDLRAVLQHGEHEAKKYLEQIRHDGYALPQPAGWEAYAAHL
                     WQEHGGRMRTPFVEAIELLEFLPPKSAHDGKEAS"
     misc_feature    <188537..188977
                     /locus_tag="Selsp_0169"
                     /note="CRISPR/Cas system-associated protein Cas10; Region:
                     Cas10_III; cd09680"
                     /db_xref="CDD:187811"
     gene            189454..190107
                     /locus_tag="Selsp_0170"
                     /db_xref="GeneID:10496374"
     CDS             189454..190107
                     /locus_tag="Selsp_0170"
                     /note="KEGG: vpr:Vpar_1816 protein of unknown function
                     DUF324;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585623"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412607.1"
                     /db_xref="GI:330838027"
                     /db_xref="GeneID:10496374"
                     /translation="MTRYTLRIEALSPLALTSGKADVTLDSAIVHDKYGIPFFPAKRL
                     RGLLYESAVEVTEMAELSGRGFLTRRTVAELFRHVEGQDSLVRLSLHDLHPEGYEELS
                     ADLAYLMARYEAALSPLDVLEEYTTVRFQTEIDKESGTARDNSLHNMQAALADDLVFC
                     GEITLTGGEARHAEALALACANLRTAGLKRNRGFGKIRCTLSGGEELLLAALGKDVG"
     misc_feature    189481..190038
                     /locus_tag="Selsp_0170"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     gene            190108..191694
                     /locus_tag="Selsp_0171"
                     /db_xref="GeneID:10496375"
     CDS             190108..191694
                     /locus_tag="Selsp_0171"
                     /note="KEGG: vpr:Vpar_1815 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585624"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412608.1"
                     /db_xref="GI:330838028"
                     /db_xref="GeneID:10496375"
                     /translation="MKEMRKISLTIEALSPLVLTAGSQGAILTESGDAISGSIVRGMI
                     AARFIEAQNLGRAAHESEAFRRLFAGALKFSAAYPSKGGESAMRLPLSLQKDKLSPAL
                     ADLSASDGTALKGYKPLKGCGIVRGAAIERVETKKNISLHMSRDEDGERLAGKSTEGG
                     IYSYESLLPGQAFCGEIVGEAADIQELLTSIDCEDGAFLSQIGKSRSTQYGLCRIALN
                     APAPLEPLAQSLLSSTLRLRLATPLLSDAAFSRNAREVLDEEILAPLKESAESDDFSL
                     GRIFAASASASNFVGVWNMRRPTQFGLDAGSIFELKKASPWTSRDAAALAAILAEGAG
                     SRTEEGFGRLALWTVDAPTLFESTQERPERRTVKSERARAIVRAVLRRRIAQSVRLAA
                     YKDASALTGRLAGMTHAFARLEAMLGPREDLEGAPARFRAKFAAEVGAKRTPLARHLE
                     GVKLGAAELRDILRGERPELSPYASLDLSAEVPQELAEDAGFSRPALKDDGEIFYDYW
                     LWFFRHARKRAVQQRKEAAD"
     misc_feature    190117..191145
                     /locus_tag="Selsp_0171"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein Csx10; Region: Csx10; cl17558"
                     /db_xref="CDD:248112"
     gene            191694..193061
                     /locus_tag="Selsp_0172"
                     /db_xref="GeneID:10496376"
     CDS             191694..193061
                     /locus_tag="Selsp_0172"
                     /note="COGs: COG1337 Uncharacterized protein predicted to
                     be involved in DNA repair (RAMP superfamily);
                     InterPro IPR005537;
                     KEGG: vpr:Vpar_1814 protein of unknown function DUF324;
                     PFAM: Protein of unknown function DUF324;
                     SPTR: CRISPR-associated RAMP protein;
                     IMG reference gene:2504585625;
                     PFAM: RAMP superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412609.1"
                     /db_xref="GI:330838029"
                     /db_xref="InterPro:IPR005537"
                     /db_xref="GeneID:10496376"
                     /translation="MAEASVSTNGQMACVTKKILLEGTLSLDSPLLIGTGLTARAVRQ
                     ETDMQVLKDKKGRPFIPGTSLAGVLRTLLEDEEAALLFGSAERGEKAGGAQSAIDVED
                     VLLEDAAIAVRDGVGIADFARTSIAGRKYNYEAVERGAKGRLRMTVTVRRAHAEKGLE
                     EAVQTLADRLAAGVRLGALTAKGFGKVSAADVRISTYDFSDFDDVRRWLFREDAKCIA
                     HGSKAAGKKRAGVFSVDAAFAIRRSLIVRENDVDEKAAERKVKSQQKKSGTDFLIPGT
                     SIKGALRHRALEILTILKKPAAALNGLMGCSTDARRQKSRFLVDEAYFRKGVKPQAHA
                     RNRLDCFTGGTVDSVLFTDEPVWQEKPGEATLRLHYEIENYAPWEAGLALYLLRDLWQ
                     GAIPLGGESSVGRGLLEGIAATVSFDDEVLEIGAAGAVEKAAAEKLEAFAKALRDMEE
                     EAKKA"
     misc_feature    191772..192248
                     /locus_tag="Selsp_0172"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     misc_feature    192468..192911
                     /locus_tag="Selsp_0172"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     gene            193058..193621
                     /locus_tag="Selsp_0173"
                     /db_xref="GeneID:10496377"
     CDS             193058..193621
                     /locus_tag="Selsp_0173"
                     /note="KEGG: vpr:Vpar_1813 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585626;
                     TIGRFAM: CRISPR-associated protein, TIGR03984 family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412610.1"
                     /db_xref="GI:330838030"
                     /db_xref="GeneID:10496377"
                     /translation="MKNTDFSAPLKIVGLSSEKTAGLCVDLSEQALEEALRTHMKEDA
                     LLIVWQFHRIVWGRWQAGAIHLADDGALDTSLIGEMRAFNETEELHLVKKRGKFRGRY
                     IFDKDGEGTEAVDSAAPLWGERTACAGGYVTLADAGRGLSLTVPAEEEGERFALVTRC
                     YIGYDPETQQAGYEDMRYKAVVPLEEG"
     misc_feature    193193..193603
                     /locus_tag="Selsp_0173"
                     /note="CRISPR-associated protein, TIGR03984 family;
                     Region: TIGR03984"
                     /db_xref="CDD:234429"
     gene            193624..195642
                     /locus_tag="Selsp_0174"
                     /db_xref="GeneID:10496378"
     CDS             193624..195642
                     /locus_tag="Selsp_0174"
                     /note="InterPro IPR005537;
                     KEGG: vpr:Vpar_1812 protein of unknown function DUF324;
                     PFAM: Protein of unknown function DUF324;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585627;
                     PFAM: RAMP superfamily;
                     TIGRFAM: CRISPR-associated protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412611.1"
                     /db_xref="GI:330838031"
                     /db_xref="InterPro:IPR005537"
                     /db_xref="GeneID:10496378"
                     /translation="MADDWREKLAKGFGRDVPEEKEEKKDWGAAYEKAESRRPRRGGE
                     RSGGYGGGRGNQGGGYGRQGGGYRGQGGYGGRGGYRGQGGGASPRPKTTEPASAPYNF
                     VSLPEAIVPAPLDQGLDWHKMEEDKRLTHYRDYVCADGAKSGRIELSLETLTPLFIGS
                     GSSGDTNEFFSPTGEPIVPGSTLRGFIKHMVRMVSGGAMRPGAEFTERHLYSRALADS
                     LASFRDYYKERMVENITVSKKTDDGRTIEVAKSVSKANAGFLIAVQGKYYVCPADKES
                     LKIPRGEEQNRAEIRWHHKEQSADVITGRSPQKKYIYFRISKADWSKERRLPVPESVL
                     KGYREDKSRGRFDLLANGLKRREAAGFTHDAEISFCAPCFYMAEDGVVQHFGHGRYYR
                     IPYEKSIADHVPAALQKDTIDFADAIFGCKALWAGRVIFEDAVLQGAADQLAPSRSHP
                     LMTPNPTSFQLYLEQTGKEPQHWDSDAPIRGYKLYWHQKASADSWRLDPERDKVVKGT
                     QEIRPIAAGAHFSGSIRFKNLRPEELGALLEVFSLGESGEDICFKIGQGKSLGLGSVR
                     LKARLLLEDTKEQFAGLFTDGAWRESLEESTGEECLAAFRQWREEHLGEGKESFEKSM
                     KELRCLLDWNKTSLPKWQKKTAMMRIGDKSDTRFKDRVILKRALDFAR"
     misc_feature    194077..>194202
                     /locus_tag="Selsp_0174"
                     /note="CRISPR/Cas system-associated RAMP superfamily
                     protein; Region: RAMP_I_III; cd09726"
                     /db_xref="CDD:187857"
     gene            complement(195868..195942)
                     /locus_tag="Selsp_R0005"
                     /db_xref="GeneID:10496379"
     tRNA            complement(195868..195942)
                     /locus_tag="Selsp_R0005"
                     /product="tRNA-Glu"
                     /note="IMG reference gene:2504585628"
                     /db_xref="GeneID:10496379"
     gene            complement(195964..197424)
                     /locus_tag="Selsp_0175"
                     /db_xref="GeneID:10496380"
     CDS             complement(195964..197424)
                     /locus_tag="Selsp_0175"
                     /EC_number="6.1.1.17"
                     /note="COGs: COG0008 Glutamyl- and glutaminyl-tRNA
                     synthetase;
                     InterPro IPR004527:IPR020058;
                     KEGG: clo:HMPREF0868_0766 glutamate--tRNA ligase;
                     PFAM: Glutamyl/glutaminyl-tRNA synthetase, class Ic,
                     catalytic domain;
                     PRIAM: Glutamate--tRNA ligase;
                     SPTR: Glutamate--tRNA ligase;
                     TIGRFAM: Glutamyl-tRNA synthetase, class Ic,
                     bacterial/mitochondrial;
                     IMG reference gene:2504585629;
                     PFAM: tRNA synthetases class I (E and Q), catalytic
                     domain;
                     TIGRFAM: glutamyl-tRNA synthetase, bacterial family"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA synthetase"
                     /protein_id="YP_004412612.1"
                     /db_xref="GI:330838032"
                     /db_xref="InterPro:IPR000924"
                     /db_xref="InterPro:IPR001412"
                     /db_xref="InterPro:IPR008925"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR020058"
                     /db_xref="InterPro:IPR020061"
                     /db_xref="InterPro:IPR020751"
                     /db_xref="GeneID:10496380"
                     /translation="MSNRIRTRFAPSPTGYMHIGNLRTALYGYLFAKSQGGDFILRIE
                     DTDQERFVEGAREVINESLAAAHIIADESPEKGGAFGPYVQSERKAIYKEYAEKLVAS
                     GHAYRCFCSAKVHAHESESEKFGGYDRHCRDLAPEEIERRLAAGTPYVIRQKMPLTGS
                     TTYRDLILGSITIENSELEDQILLKSDGMPTYNFANVVDDHLMEITHVIRGNEYITST
                     PKHVLLYEFFGWQLPEFIHLPPVMGKSEDGTVSKLSKRHGAASFGQLLDEGYLAEAVT
                     NYVALLGWSPKDTNQEIFTMEELIGAFSLDGISKSPAIFDYKKLDWMNGEYFKSMDPA
                     AFAKLARPFTGDLPTELAEKWDYAAEVLRPRLSRLGEIKEQIHFLIEMPDYDLDCYTN
                     KRNKTNPEKARALLPEALPMLDSLEPWTPDTINAALDAFAEQRGEKKGAVMWPLRIAV
                     SGQKVTPGGLTEVLFLLGKKNSLDRLKKSLAKLQDM"
     misc_feature    complement(195985..197424)
                     /locus_tag="Selsp_0175"
                     /note="glutamyl-tRNA synthetase; Reviewed; Region: gltX;
                     PRK01406"
                     /db_xref="CDD:234953"
     misc_feature    complement(196435..197412)
                     /locus_tag="Selsp_0175"
                     /note="catalytic core domain of discriminating
                     glutamyl-tRNA synthetase; Region: GluRS_core; cd00808"
                     /db_xref="CDD:173905"
     misc_feature    complement(order(196666..196671,196705..196710,
                     196783..196788,196792..196797,196837..196839,
                     196849..196851,197293..197295,197353..197358,
                     197362..197367,197389..197397,197401..197403))
                     /locus_tag="Selsp_0175"
                     /note="active site"
                     /db_xref="CDD:173905"
     misc_feature    complement(197362..197373)
                     /locus_tag="Selsp_0175"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173905"
     misc_feature    complement(196657..196671)
                     /locus_tag="Selsp_0175"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173905"
     gene            197630..198346
                     /locus_tag="Selsp_0176"
                     /db_xref="GeneID:10496381"
     CDS             197630..198346
                     /locus_tag="Selsp_0176"
                     /note="COGs: COG2968 conserved hypothetical protein;
                     InterPro IPR007497;
                     KEGG: gau:GAU_0029 hypothetical protein;
                     PFAM: Protein of unknown function DUF541;
                     SPTR: Putativeouter membrane protein;
                     IMG reference gene:2504585630;
                     PFAM: Protein of unknown function (DUF541)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412613.1"
                     /db_xref="GI:330838033"
                     /db_xref="InterPro:IPR007497"
                     /db_xref="GeneID:10496381"
                     /translation="MNKMKSFLAAIAAGLFLCAPQAAEAAAPQTSEPPVLMVDGTGRA
                     EAAPDCATISVGVVTQAADAKTAQEENAKKAQAVQRALVAAGIPEANIQTRGYYFQPL
                     YEREARENEITGYRAENNVTVRVDNLADVSRVIDLALKNGANSISSLDFGVKNADKVR
                     KIALTAAVNDARKKADELAAALGRRVVGLKAVSENTYPFAERSAGAKMLMAADAAPTP
                     IAPGMLEMSAEVHIEYYLSE"
     misc_feature    197630..198340
                     /locus_tag="Selsp_0176"
                     /note="Protein of unknown function (DUF541); Region:
                     SIMPL; cl01077"
                     /db_xref="CDD:260779"
     gene            198709..200454
                     /locus_tag="Selsp_0177"
                     /db_xref="GeneID:10496382"
     CDS             198709..200454
                     /locus_tag="Selsp_0177"
                     /note="KEGG: afn:Acfer_1670 S-layer domain protein;
                     SPTR: Putative translation initiation factor IF-2;
                     IMG reference gene:2504585631"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412614.1"
                     /db_xref="GI:330838034"
                     /db_xref="GeneID:10496382"
                     /translation="MMEMEKKSLFWGHACRASIFCAAIFGILPTAASAAEAVPDWVYE
                     AVGQLDAQGYVDLAGKMPQECSREELVRIVAQGLHEVDRIQQGTLADEYGRLSSLAVR
                     DEVHVKLYREQERLAKRALADAEAAAKQAEERLVRESLRGTNRLEIMQPLQEKASKAR
                     LRLQFAARDYALATMRREKRELALAKVSERRQEVFSRMTPREGAVQADAAAGAPASPV
                     AVAVPAAPDSFPAGEGDAYSYGEPLVEPGVMDEAMRLRAAFAEDLALMGYADEENAEQ
                     QLYSSVLLPEKPEPRLKVDAEVRADASRSGGIERGDSRARLRLRVFPDYNIDGNWHAA
                     GMIEYEKYLNGGTDDGKLRLDRYYLTGRSGVFDTTVGVFSADFAEGNIYDSKFRGLRL
                     SMGSPVRYTLHYGKIERVHEVAALSASYDTPFYGVDAGMYRFDKINGAARNIYMGNFR
                     APLGDFDFGAMLLHGTDHRAGNGTGYVLTLAKKGDGWRPGSMSYWLKYYRQPSATYVS
                     HTMNGMADYMSYDATGDGPRRGGFRGWGAGLSYTLQKDLMFGLEYYDLFDLDTARRSR
                     TVWASLTGYFKNYED"
     misc_feature    <199972..200424
                     /locus_tag="Selsp_0177"
                     /note="Putative MetA-pathway of phenol degradation;
                     Region: Phenol_MetA_deg; cl01768"
                     /db_xref="CDD:261060"
     gene            200490..201791
                     /locus_tag="Selsp_0178"
                     /db_xref="GeneID:10496383"
     CDS             200490..201791
                     /locus_tag="Selsp_0178"
                     /EC_number="1.1.1.22"
                     /note="COGs: COG0677 UDP-N-acetyl-D-mannosaminuronate
                     dehydrogenase;
                     InterPro IPR017476:IPR014027:IPR001732:IPR014026;
                     KEGG: cth:Cthe_2340 UDP-glucose/GDP-mannose dehydrogenase;
                     PFAM: UDP-glucose/GDP-mannose dehydrogenase, N-terminal;
                     UDP-glucose/GDP-mannose dehydrogenase, C-terminal;
                     UDP-glucose/GDP-mannose dehydrogenase, dimerisation;
                     PRIAM: UDP-glucose 6-dehydrogenase;
                     SPTR: UDP-glucose/GDP-mannose dehydrogenase family
                     protein;
                     TIGRFAM: Nucleotide sugar dehydrogenase;
                     IMG reference gene:2504585632;
                     PFAM: UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; UDP-glucose/GDP-mannose dehydrogenase
                     family, central domain; UDP-glucose/GDP-mannose
                     dehydrogenase family, UDP binding domain;
                     TIGRFAM: nucleotide sugar dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotide sugar dehydrogenase"
                     /protein_id="YP_004412615.1"
                     /db_xref="GI:330838035"
                     /db_xref="InterPro:IPR001732"
                     /db_xref="InterPro:IPR008927"
                     /db_xref="InterPro:IPR014026"
                     /db_xref="InterPro:IPR014027"
                     /db_xref="InterPro:IPR014028"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR017476"
                     /db_xref="GeneID:10496383"
                     /translation="MLELLHDGRAKIAVVGLGYVGLPLAVAFSRHFSVIGYDSDEEKI
                     ADCRAGKDPMGELAAEEGAAERIDFTADAARLRMASFIVVAVPTPIKGDKTPNLKPLK
                     KATRVIGRHLQPGSIVVYESTVYPGVTEDICCTILERESGMRRGEFKIGYSPERINPG
                     DKVHRLENIVKIVSGMDEETLETIAGVYGTVVETLHRAPSIRVAEAAKVAENAQRDIN
                     IAFMNELALVFHRMDIDTSAVADAMDTKWNALGFRPGLVGGHCIGVDPYYFIYQAQNL
                     GYYSPLISTGRRINDDMSGFVAHAVVRELVRAKIDLAKARVHLFGMAFKENCPDTRNS
                     RAADVYRILQEYDLTLAAVDPEVDAAAFRVEYGFSLESLHDVQEADALVFLVAHEAFA
                     RLSWEELRAMCRADGPHLLVDVKGMYSREEAEREGFCYWRL"
     misc_feature    200490..201770
                     /locus_tag="Selsp_0178"
                     /note="UDP-N-acetyl-D-mannosaminuronate dehydrogenase
                     [Cell envelope biogenesis, outer membrane]; Region: WecC;
                     COG0677"
                     /db_xref="CDD:223749"
     misc_feature    200517..201044
                     /locus_tag="Selsp_0178"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family, NAD
                     binding domain; Region: UDPG_MGDP_dh_N; pfam03721"
                     /db_xref="CDD:252123"
     misc_feature    201090..201368
                     /locus_tag="Selsp_0178"
                     /note="UDP-glucose/GDP-mannose dehydrogenase family,
                     central domain; Region: UDPG_MGDP_dh; pfam00984"
                     /db_xref="CDD:250272"
     misc_feature    201444..201743
                     /locus_tag="Selsp_0178"
                     /note="UDP binding domain; Region: UDPG_MGDP_dh_C;
                     smart00984"
                     /db_xref="CDD:214954"
     gene            201839..202771
                     /locus_tag="Selsp_0179"
                     /db_xref="GeneID:10496384"
     CDS             201839..202771
                     /locus_tag="Selsp_0179"
                     /note="COGs: COG0726 xylanase/chitin deacetylase;
                     InterPro IPR002509;
                     KEGG: cpy:Cphy_2213 polysaccharide deacetylase;
                     PFAM: Polysaccharide deacetylase;
                     SPTR: Polysaccharide deacetylase;
                     IMG reference gene:2504585633;
                     PFAM: Polysaccharide deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="YP_004412616.1"
                     /db_xref="GI:330838036"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="GeneID:10496384"
                     /translation="MSLKKMGLLAIAGILIVAGALIVFRDHVIGTKNAQAELADLGSL
                     YEATEEIAAAKEQFQKGMEPAEIVTKDEKPHVAIVIDGLPDRTTTARLLDVLKKHGAS
                     AVFFVEGQNAANQPETIELIREAGQEIGNYTFVGIAAAQELPQERLLAEICRTQRVVE
                     VLAATKPKFFRAPRTVYDEELLRALRAAGVECAVKESAHYAPGWLKDEAGAAAYAATV
                     PAGSIIAIDIAVPVEAPAQDVAIEDARPAVDKQPTVEDKPAEERKAAPVDAADELDWL
                     LTALESTGKTPGNIHDFRKIRYVPAAPSAAVQGK"
     misc_feature    <202028..>202405
                     /locus_tag="Selsp_0179"
                     /note="Predicted xylanase/chitin deacetylase [Carbohydrate
                     transport and metabolism]; Region: CDA1; COG0726"
                     /db_xref="CDD:223798"
     misc_feature    202058..>202405
                     /locus_tag="Selsp_0179"
                     /note="Catalytic NodB homology domain of rhizobial
                     NodB-like proteins; Region: CE4_NodB_like_6s_7s; cd10917"
                     /db_xref="CDD:213022"
     misc_feature    order(202073..202084,202232..202249,202349..202351,
                     202355..202360)
                     /locus_tag="Selsp_0179"
                     /note="NodB motif; other site"
                     /db_xref="CDD:213022"
     misc_feature    order(202079..202084,202232..202234,202244..202246,
                     202355..202363)
                     /locus_tag="Selsp_0179"
                     /note="active site"
                     /db_xref="CDD:213022"
     misc_feature    order(202082..202084,202232..202234,202244..202246)
                     /locus_tag="Selsp_0179"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213022"
     gene            202780..204708
                     /locus_tag="Selsp_0180"
                     /db_xref="GeneID:10496385"
     CDS             202780..204708
                     /locus_tag="Selsp_0180"
                     /EC_number="2.4.1.212"
                     /note="COGs: COG1215 Glycosyltransferase probably involved
                     in cell wall biogenesis;
                     InterPro IPR009875:IPR001173;
                     KEGG: cpy:Cphy_2212 glycosyl transferase family protein;
                     PFAM: Glycosyl transferase, family 2; Type IV pilus
                     assembly PilZ;
                     PRIAM: Hyaluronan synthase;
                     SPTR: Chitin synthase;
                     IMG reference gene:2504585634;
                     PFAM: Glycosyl transferase family 2; PilZ domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Hyaluronan synthase"
                     /protein_id="YP_004412617.1"
                     /db_xref="GI:330838037"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR009875"
                     /db_xref="GeneID:10496385"
                     /translation="MANEGYASADGAGKDMDAAERGARVNRATGAAQEDEVLYTVKED
                     RRLLSHVPDATGHRSNRSRRGASAAMESDDYVLYEQDAKNGQRYLVDYPVKIEGAAGT
                     LAARAVDISTTGILVRLEKDACGADLSGEVKLTFEIEPGTMPEGYEMKVKKLPATVVR
                     SFGQEEKLYGIEFKKSLAQYAAARRQGYMFTLAIFFLAVITLIIVLMRAESVIYFKFN
                     RWLYLYSIIAATFLLTRYLFAMFYRPVPIDPDYTPGVTIIIPCFDEEEWIQRTIHSCI
                     NQDYPVDKLEVIVVDDCSNDRSAERVQEMIAELKAADTSDNAYSVADRIRFLQQPQNL
                     GKRDAMARGAREAKHELLVFVDSDSFLDPFAIRNIVQPFRDEEMGGVSGRTDVANTYT
                     NALTKMQAVRYSIAFRVMKAAEGYFDAATCLSGPLSCYRKDLVLKYMDAWLNQRFLGQ
                     KATFGDDRSMTNFILRHNRTTYQDSAVCMTIVPRSYSVFLRQQMRWKRSWLRESLIAS
                     RFMWKKEPFMSLGFYMGVLVPIAAPVVVIYNLLYVPIMHRVFPVSFVVGMLMMALLMS
                     MAQLLIRRSTTWIYAMWFCIYYEAVLLWQMPVAWVTFWKTTWGTRMTLADIAALNKKK
                     NKEKDGRVILDKAAERAA"
     misc_feature    203035..203298
                     /locus_tag="Selsp_0180"
                     /note="PilZ domain; Region: PilZ; pfam07238"
                     /db_xref="CDD:254119"
     misc_feature    203536..204267
                     /locus_tag="Selsp_0180"
                     /note="Glycosyltransferase like family 2; Region:
                     Glyco_tranf_2_3; pfam13641"
                     /db_xref="CDD:257951"
     misc_feature    203548..204090
                     /locus_tag="Selsp_0180"
                     /note="CESA_like is  the cellulose synthase superfamily;
                     Region: CESA_like; cd06423"
                     /db_xref="CDD:133045"
     misc_feature    203830..204408
                     /locus_tag="Selsp_0180"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    203845..203853
                     /locus_tag="Selsp_0180"
                     /note="DXD motif; other site"
                     /db_xref="CDD:133045"
     gene            204705..207326
                     /locus_tag="Selsp_0181"
                     /db_xref="GeneID:10496386"
     CDS             204705..207326
                     /locus_tag="Selsp_0181"
                     /note="KEGG: cpy:Cphy_2211 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585635"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412618.1"
                     /db_xref="GI:330838038"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="GeneID:10496386"
                     /translation="MKKKRVFVRLGQGLSRVKEAQAEAKKVVARQEAPTAQGALPIQD
                     AAPPLESAPSPGQGIPPHEQGASLYMQPLYMPYMQPPVADGGAQFASSLPNMSNVRGM
                     PSVQGVPFLMCVPDIQGRPQWVPVMPFAAPPQVQPPIQPAPPQAPPSMQPAPRQEPPP
                     AAQSAQQPSTVQSSMQPTQTPSTAQPPIQPVPPQAQEQPPAAQSAPKAQQQTQQPPVP
                     PQQPQAQQPAQQQPPATQQQPKAQNERPKAQPALADAAFTRRKNRRKKVRTAMEFICI
                     AAALFVLLELFFTLKTYDPAAAAAAGAQDKGFIALSYFGVDRNGDTSTLIGKEELRRH
                     LAELKSQGYVTISQQDVLDYYREGKNLPERSLFLMFEDGRRDTAIFAQEIMEDLNFKA
                     TMMTYPEKFAKKDTKFLSPKDLHEMESSTFWEMGSNGYRLAYINVFDRYDDFLGELDP
                     LRFDMVRGCLGRRYNHYLMDYIRDKDGVPTESERQMERRVAYDYARLRDIYGEELGYV
                     PKAHVLMHANTGRFGNNPRVSAVNEREIRDSFPMNFNREGFVLNKRTSSLYDLTRMQP
                     QPYWPINHLLMRINYDTDGALSFVEGREEGRRAWELKEGALEAREETLILTTLPEGKA
                     LARLADVENLRDLRLEAELEGNAFGSQQIFLRSSADLSDAVCVTLVNDQLVVTEIAGG
                     AKRELYREKLPVILGEKILSVEEARKEAKIAENEAFARYAPSPAAANEYMGRANAVRE
                     TYAAAVEDGAAPYEGRESFHRRGKCRLVIHLSGDRLSVEVDGHTGPEDLAVSRTERGA
                     VFLGASWQGEAWSQRNLADDVYDGVFKKVRVLTETGRESKEERVLYTSEYKGWEKAKH
                     RAGEIWDAVLRWFLEYV"
     misc_feature    205689..>205994
                     /locus_tag="Selsp_0181"
                     /note="Catalytic NodB homology domain of the carbohydrate
                     esterase 4 superfamily; Region: CE4_SF; cl15692"
                     /db_xref="CDD:265761"
     gene            207399..208421
                     /locus_tag="Selsp_0182"
                     /db_xref="GeneID:10496387"
     CDS             207399..208421
                     /locus_tag="Selsp_0182"
                     /note="COGs: COG3858 glycosyl hydrolase;
                     KEGG: gym:GYMC10_2039 hypothetical protein;
                     SPTR: Putative lipoprotein;
                     IMG reference gene:2504585636;
                     PFAM: Glycosyl hydrolases family 18"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412619.1"
                     /db_xref="GI:330838039"
                     /db_xref="InterPro:IPR001223"
                     /db_xref="InterPro:IPR013781"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:10496387"
                     /translation="MRWWMLGLFLAAGLSLGGCAQAEPLQSAPHAPVELSSWHVRWDA
                     AAGDADYRAMRGKLSKVVIFAACYDEKDELYVPQEVQALVNAYSIRKVERYLSFTNDI
                     LGKKHVEKDRELLRRLLATDEGIEKEARLMAETAEKFGMEGVELDYENFRKDEEIMTR
                     YRAFLQKLAEATKERGLKLRVVLEPAMAFEGLPAEAEYVVMFYNLHGKHSGPGPKADR
                     DFIEKTLKKMEALPGRKAAAFATGGCLWQDYGFLGSKKGEARFLTEKEAAALAKKHGR
                     TPERDAESAALHFTFSADGHDGEVWYADAETLNAWITLAAENGVEAVSLWRLGGSETL
                     ADVRCE"
     misc_feature    207546..208385
                     /locus_tag="Selsp_0182"
                     /note="The GH18 (glycosyl hydrolase, family 18) type II
                     chitinases hydrolyze chitin, an abundant polymer of
                     beta-1,4-linked N-acetylglucosamine (GlcNAc) which is a
                     major component of the cell wall of fungi and the
                     exoskeleton of arthropods.  Chitinases have...; Region:
                     GH18_chitinase-like; cl10447"
                     /db_xref="CDD:263970"
     misc_feature    order(207591..207593,207831..207833,207837..207839,
                     207843..207845,208005..208010,208122..208124,
                     208374..208376)
                     /locus_tag="Selsp_0182"
                     /note="active site"
                     /db_xref="CDD:119349"
     gene            208435..210384
                     /locus_tag="Selsp_0183"
                     /db_xref="GeneID:10496388"
     CDS             208435..210384
                     /locus_tag="Selsp_0183"
                     /note="COGs: COG0726 xylanase/chitin deacetylase;
                     InterPro IPR002509;
                     KEGG: cpy:Cphy_2213 polysaccharide deacetylase;
                     PFAM: Polysaccharide deacetylase;
                     SPTR: Putative polysaccharide deacetylase;
                     IMG reference gene:2504585637;
                     PFAM: Polysaccharide deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="YP_004412620.1"
                     /db_xref="GI:330838040"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="GeneID:10496388"
                     /translation="MGTVMRDGKIKKRSGKKGALCALAFVVAALCSTASAAAPAAERA
                     DAAAAFEASRLAALAGTEASARQEEAGKALELPDEAEEVQGLRGQTMQESTAESAYAA
                     LRRKNRGHIAEKQRFICSTKPAVIFTFGGLSKEAPLLEILEEMKAEGMRGTFFVTERE
                     LSRNRKNIELIRAYGQELGIGLRPEEGAGFDDYCAQIERIREGLRAYGQETNVVRQMS
                     GTDEPAIGEAVSAMGCILVGQGFNAVQSKHKDAQSPAEVMPDLFGRWTTSFNRGEIIY
                     MRTDYYTHSSLAVELLRTLKREKVDNIAYTTHALPEERERERAASGYACTSVLDVLGD
                     TSALYTYPVDLATLPEEIRPYIRKEKLTGSAFSQEFYKRYVGAPEVGETDRMLGFSRM
                     EMRRADRTGIVKTAPARTVFFTFDDWGSDDSINHLLAVLNKHRVHGTFFIITKNIHNN
                     PNLVRAIVANGNEVGSHTDTHTPMCVQDKGGRNKAIMDEETYELDVRSSYEKLALTMG
                     DMRLPSGRYALTRILRPPTLAVSRTGVASILHNGFDYVVNGSGSTEDYNAVSLESLVG
                     ILHRLTHEDDGSVKRGAILVMHMSATAMRTAPALDMLLTANDLLPDDHPGKFKVALLG
                     DYLTADYDQRMKQIPPAKEKTISPF"
     misc_feature    208801..209322
                     /locus_tag="Selsp_0183"
                     /note="Catalytic NodB homology domain of rhizobial
                     NodB-like proteins; Region: CE4_NodB_like_6s_7s; cd10917"
                     /db_xref="CDD:213022"
     misc_feature    order(208816..208827,209077..209079,209083..209088,
                     209149..209151,209176..209181,209260..209262,
                     209266..209268)
                     /locus_tag="Selsp_0183"
                     /note="NodB motif; other site"
                     /db_xref="CDD:213022"
     misc_feature    order(208822..208827,209083..209091,209149..209151,
                     209260..209262,209266..209268)
                     /locus_tag="Selsp_0183"
                     /note="active site"
                     /db_xref="CDD:213022"
     misc_feature    order(208822..208824,209077..209079,209176..209178,
                     209266..209268)
                     /locus_tag="Selsp_0183"
                     /note="catalytic site [active]"
                     /db_xref="CDD:213022"
     misc_feature    <209635..210237
                     /locus_tag="Selsp_0183"
                     /note="Predicted xylanase/chitin deacetylase [Carbohydrate
                     transport and metabolism]; Region: CDA1; COG0726"
                     /db_xref="CDD:223798"
     misc_feature    209659..210252
                     /locus_tag="Selsp_0183"
                     /note="Catalytic NodB homology domain of rhizobial
                     NodB-like proteins; Region: CE4_NodB_like_6s_7s; cd10917"
                     /db_xref="CDD:213022"
     misc_feature    order(209674..209685,209833..209850,210004..210006,
                     210010..210015,210079..210081,210097..210102,
                     210190..210192,210196..210198)
                     /locus_tag="Selsp_0183"
                     /note="NodB motif; other site"
                     /db_xref="CDD:213022"
     misc_feature    order(209680..209685,209833..209835,209845..209847,
                     210010..210018,210079..210081,210190..210192,
                     210196..210198)
                     /locus_tag="Selsp_0183"
                     /note="active site"
                     /db_xref="CDD:213022"
     misc_feature    order(209680..209682,210004..210006,210097..210099,
                     210196..210198)
                     /locus_tag="Selsp_0183"
                     /note="catalytic site [active]"
                     /db_xref="CDD:213022"
     misc_feature    order(209683..209685,209833..209835,209845..209847)
                     /locus_tag="Selsp_0183"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:213022"
     gene            complement(210538..211407)
                     /locus_tag="Selsp_0184"
                     /db_xref="GeneID:10496389"
     CDS             complement(210538..211407)
                     /locus_tag="Selsp_0184"
                     /note="COGs: COG1180 Pyruvate-formate lyase-activating
                     enzyme;
                     InterPro IPR007197;
                     KEGG: afn:Acfer_0102 radical SAM domain protein;
                     PFAM: Radical SAM;
                     SPTR: Glutamate 5-kinase;
                     IMG reference gene:2504585638;
                     PFAM: Radical SAM superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM domain protein"
                     /protein_id="YP_004412621.1"
                     /db_xref="GI:330838041"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR016431"
                     /db_xref="GeneID:10496389"
                     /translation="MSADSRTAKTEGADERIVCSLCPHHCRLADDETGFCRARMNEGG
                     TIRCRSYGRLTSVALDPIEKKPLYHFHPGSFILSVGSFGCNLRCPFCQNYTISMTDGQ
                     SETQDVTPAELAALAHDLSRRPHGNIGVAFTYNEPLLSYEFIMDVAPLLHEAGLFVVL
                     VTNGTIAPAPLEALLPHVDAMNIDLKGWQPDFYRRLGGDLAAVKHTIARAVKSCHVEV
                     TTLIIPGQNDSASDMEEEALWLASLRPDLPLHISRYFPRWKEYAPATPVETIERLAAI
                     AGKHLRFVHKGNC"
     misc_feature    complement(210541..211293)
                     /locus_tag="Selsp_0184"
                     /note="Pyruvate-formate lyase-activating enzyme
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: PflA; COG1180"
                     /db_xref="CDD:224101"
     misc_feature    complement(210580..211161)
                     /locus_tag="Selsp_0184"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(210646..210651,210745..210747,
                     210862..210864,210919..210927,211000..211005,
                     211009..211011,211132..211140,211144..211146,
                     211150..211152,211156..211158))
                     /locus_tag="Selsp_0184"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(211404..212789)
                     /locus_tag="Selsp_0185"
                     /db_xref="GeneID:10496390"
     CDS             complement(211404..212789)
                     /locus_tag="Selsp_0185"
                     /note="COGs: COG2078 conserved hypothetical protein;
                     InterPro IPR004183:IPR002733;
                     KEGG: elm:ELI_2034 3,4-dihydroxyphenylacetate
                     2,3-dioxygenase, AMMECR1 domain protein;
                     PFAM: AMMECR1; Extradiol ring-cleavage dioxygenase, class
                     III enzyme, subunit B;
                     SPTR: 3,4-dihydroxyphenylacetate 2,3-dioxygenase, AMMECR1
                     domain protein;
                     TIGRFAM: AMMECR1;
                     IMG reference gene:2504585639;
                     PFAM: AMMECR1; Catalytic LigB subunit of aromatic
                     ring-opening dioxygenase;
                     TIGRFAM: uncharacterized protein, PH0010 family"
                     /codon_start=1
                     /transl_table=11
                     /product="AMMECR1 domain protein"
                     /protein_id="YP_004412622.1"
                     /db_xref="GI:330838042"
                     /db_xref="InterPro:IPR002733"
                     /db_xref="InterPro:IPR004183"
                     /db_xref="GeneID:10496390"
                     /translation="MAILAAYAVPHPPIILPEIGKGEERKIQLTINAYERAMKEAASF
                     EPDTVVVASPHAVMYADYFHISPGDEGAGSFAQFGAPEVEVRAEYDTAFAKTLATVAS
                     EAGLDAGPLGGRNAALDHGTMIPLRFLQPHTENFRLVRVGLSGLTPLDHYRFGMCIAR
                     TAEELDRKTVFIASGDLSHKLTPDGPYGFAAEGPRFDKACMKYLEEGTFLKLLQMDPA
                     LAKKAAECGLRSFWIMAGALDCQALKIKKLSYQGPFGVGYGLLSFVVKREDLKRNFGM
                     RYEIAQRRALDDIKAAEDAYVKLARESVEKFVVTGQYAAIPDDLPEEMQARAGVFVSL
                     KKDGELRGCIGTFQPAQKDIAEEILYNAVSAALHDPRFSPLKEDELPDIVYSVDVLTE
                     PELIHDAAKDLDPKRYGVIVEARGRKGLLLPDLEGVDTVEDQIKIARKKGGIALDDDV
                     RIWRFEVERHH"
     misc_feature    complement(211407..212789)
                     /locus_tag="Selsp_0185"
                     /note="hypothetical protein; Provisional; Region:
                     PRK03881"
                     /db_xref="CDD:235170"
     misc_feature    complement(212001..212768)
                     /locus_tag="Selsp_0185"
                     /note="The N-terminal domain, an extradiol dioxygenase
                     class III subunit B-like domain, of unknown proteins
                     containing a C-terminal AMMECR1 domain; Region:
                     ED_3B_N_AMMECR1; cd07951"
                     /db_xref="CDD:153388"
     misc_feature    complement(211407..211904)
                     /locus_tag="Selsp_0185"
                     /note="AMMECR1; Region: AMMECR1; pfam01871"
                     /db_xref="CDD:250929"
     gene            213145..214398
                     /locus_tag="Selsp_0186"
                     /db_xref="GeneID:10496391"
     CDS             213145..214398
                     /locus_tag="Selsp_0186"
                     /note="KEGG: afn:Acfer_0837 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585640"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412623.1"
                     /db_xref="GI:330838043"
                     /db_xref="GeneID:10496391"
                     /translation="MLERVRAIQCHNCGGAMYSEQKAAAYVCTFCGTEVSWTDAPVFW
                     ASPIAFRHKPVQIVDGAMKLGAVEVMWEVDAHDKGCLSQHYRQKSVEEKLALWDKTAT
                     AAFAGVCRLTFRCPFCGGDFSGDSTQHFFTCGYCNNTFGDEELLRPGAYRREFIMGVG
                     AKNVPGRAIPFVVTPLQAQNAVRKLAWRFPQEFSGQDIERRIRADMTAVYIPFSLADL
                     RVKMCVRGKRRSFEAYEEIINWACPDTTLYDIRLLDRLDPWDFGAVIPFDPAFAEGIF
                     RIAAVANNVSRVETIENILAERLVSDIKSTFDLTTASLTLWGHDFRKHERAYFLLPVY
                     VLDRRAEDGEGARQVRIAVNGQTGKAAALFYRYGQEERYVADAPSRLQPMSTEHTVRT
                     SPVAVKRVGSPFLYRVTTLAEATEG"
     gene            214705..216096
                     /locus_tag="Selsp_0187"
                     /db_xref="GeneID:10496392"
     CDS             214705..216096
                     /locus_tag="Selsp_0187"
                     /EC_number="4.3.1.1"
                     /note="COGs: COG1027 Aspartate ammonia-lyase;
                     InterPro IPR022761:IPR018951;
                     KEGG: vpr:Vpar_1504 fumarate lyase;
                     PFAM: Lyase 1, N-terminal; Fumarase C, C-terminal;
                     PRIAM: Aspartate ammonia-lyase;
                     SPTR: Aspartate ammonia-lyase;
                     IMG reference gene:2504585641;
                     PFAM: Fumarase C C-terminus; Lyase;
                     TIGRFAM: aspartate ammonia-lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="Aspartate ammonia-lyase"
                     /protein_id="YP_004412624.1"
                     /db_xref="GI:330838044"
                     /db_xref="InterPro:IPR000362"
                     /db_xref="InterPro:IPR003031"
                     /db_xref="InterPro:IPR008948"
                     /db_xref="InterPro:IPR018951"
                     /db_xref="InterPro:IPR020557"
                     /db_xref="InterPro:IPR022761"
                     /db_xref="GeneID:10496392"
                     /translation="MRKEHDFLGELEVPDEAYYGVQTLRAIENFSITGSRLDVDFIQA
                     LAKVKKAAAQANMETGRLDKRIGNALVEAAEEIIDGKFIDQFPVDPIQGGAGTSINMN
                     MNEVLSNRALEILGEPKGSYDIISPNNHANMAQSTNDAFPTAIKVCLTHKGHKLTAAL
                     DYLATELEKKAEEYKDILKMARTHLQDAVPITLGQEMGSYASAVRRSIKRVGWSMDSI
                     RLINMGGTAVGTGLNAEPAYIKAVARKLREITGENFETSTNIIDATNNTDGFVDVSSA
                     LKNTALVLIKMANDFRLMASGPRCGLNELNLPKRQPGSSIMPGKVNPVIAEVLDQACY
                     QVIGNDLAVSFGVENGQFELNVMEPIMAYNLFNSMNYLTNAVRTFVDKLLIGLEPNRE
                     QCQQWVDRSVGVVTALLPHIGYEQSAILAKEAYTTGRPIREVILEKQLLTKELLDHIM
                     SPEQMTHPGITHE"
     misc_feature    214705..216093
                     /locus_tag="Selsp_0187"
                     /note="aspartate ammonia-lyase; Provisional; Region: aspA;
                     PRK12273"
                     /db_xref="CDD:237031"
     misc_feature    214708..216057
                     /locus_tag="Selsp_0187"
                     /note="Aspartase; Region: Aspartase; cd01357"
                     /db_xref="CDD:176462"
     misc_feature    order(214984..214995,215110..215118,215251..215256,
                     215662..215664,215668..215670,215683..215685)
                     /locus_tag="Selsp_0187"
                     /note="active sites [active]"
                     /db_xref="CDD:176462"
     misc_feature    order(215248..215259,215269..215271,215287..215292,
                     215308..215310,215320..215322,215332..215334,
                     215386..215388,215476..215481,215488..215490,
                     215497..215502,215506..215508,215515..215520,
                     215527..215529,215536..215541,215548..215553,
                     215557..215562,215569..215574,215722..215724,
                     215746..215748,215755..215763,215920..215922)
                     /locus_tag="Selsp_0187"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176462"
     gene            216176..216556
                     /locus_tag="Selsp_0188"
                     /db_xref="GeneID:10496393"
     CDS             216176..216556
                     /locus_tag="Selsp_0188"
                     /note="SPTR: Putative 8-amino-7-oxononanoate synthase;
                     IMG reference gene:2504585642"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412625.1"
                     /db_xref="GI:330838045"
                     /db_xref="GeneID:10496393"
                     /translation="MKRIFLAVVFALFAQVLWMPQTFAQDIWATSYDGKDIYVVTETL
                     EKERIPTGNATSYRGMVKFVHGDALQNTAQYLYKASEDGVFLSIDGGAFFRLGGDFDG
                     VPERYAHYMAVYDTMWKTLRNNRN"
     gene            216796..217095
                     /locus_tag="Selsp_0189"
                     /db_xref="GeneID:10496394"
     CDS             216796..217095
                     /locus_tag="Selsp_0189"
                     /note="InterPro IPR001387;
                     KEGG: vei:Veis_4125 XRE family transcriptional regulator;
                     PFAM: Helix-turn-helix type 3;
                     SPTR: Toxin-antitoxin system, antitoxin component, Xre
                     family;
                     IMG reference gene:2504585643;
                     PFAM: Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004412626.1"
                     /db_xref="GI:330838046"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="GeneID:10496394"
                     /translation="MEPMMSDAASEILEGLQEALLDAQGSIVEGLKKSVVYRIEPQAV
                     RKRLAMSQQEFSRAFGIPLATLQNWEQGRRQLDATAVSYLRTIARFPKEAMAAQM"
     misc_feature    216796..217083
                     /locus_tag="Selsp_0189"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG2944"
                     /db_xref="CDD:225495"
     misc_feature    216919..217065
                     /locus_tag="Selsp_0189"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(216919..216921,216931..216933,217006..217008)
                     /locus_tag="Selsp_0189"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(216928..216930,217003..217005)
                     /locus_tag="Selsp_0189"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(216949..216954,216985..216987,216994..216996,
                     217006..217011)
                     /locus_tag="Selsp_0189"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(217220..218218)
                     /locus_tag="Selsp_0190"
                     /db_xref="GeneID:10496395"
     CDS             complement(217220..218218)
                     /locus_tag="Selsp_0190"
                     /note="COGs: COG1313 Uncharacterized Fe-S protein PflX
                     homolog of pyruvate formate lyase activating protein;
                     InterPro IPR007197;
                     KEGG: cno:NT01CX_1001 uncharacterized Fe-S protein;
                     PFAM: Radical SAM;
                     SPTR: Radical SAM domain protein;
                     IMG reference gene:2504585644;
                     PFAM: Radical SAM superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="Radical SAM domain protein"
                     /protein_id="YP_004412627.1"
                     /db_xref="GI:330838047"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR016431"
                     /db_xref="GeneID:10496395"
                     /translation="MMAAEREKKSVADAPKSRAAKSRTAKIIEKTLAPLAACRLCPRG
                     CGANRLHDAHGFCGAGRYARVGLVSLHAWEEPCLAGEKGAGTVFFSGCNMRCAFCQNY
                     EISRENFGIAVTEERLADIFLEQEERGATTLDLVTPTHFAPQIAAALHLAKAQGLSIP
                     VVYNSSAYETVDTIKSLAGLVDIFLPDLKYMAEEAALRYSTAPDYFKTASAAIRCMRE
                     IAGRPIFDDTNRMQRGVLVRHLVLPGQRKESMKILDWLWQNFSDTIYISLMNQYTPIG
                     DLSKLPELNRRLTTFEYESVVDHARSLGIENCYIQQGGTVSTSFVPKFDGRGVEKY"
     misc_feature    complement(217451..217963)
                     /locus_tag="Selsp_0190"
                     /note="Radical SAM superfamily; Region: Radical_SAM;
                     pfam04055"
                     /db_xref="CDD:252342"
     misc_feature    complement(217391..217960)
                     /locus_tag="Selsp_0190"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(217403..217405,217409..217411,
                     217499..217501,217664..217666,217727..217735,
                     217817..217822,217826..217828,217919..217927,
                     217931..217933,217937..217939,217943..217945))
                     /locus_tag="Selsp_0190"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(218215..220224)
                     /locus_tag="Selsp_0191"
                     /db_xref="GeneID:10496396"
     CDS             complement(218215..220224)
                     /locus_tag="Selsp_0191"
                     /note="COGs: COG1368 Phosphoglycerol transferase and
                     related protein alkaline phosphatase superfamily;
                     InterPro IPR000917;
                     KEGG: vpr:Vpar_0015 sulfatase;
                     PFAM: Sulfatase;
                     SPTR: Putative arylsulfatase;
                     IMG reference gene:2504585645;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004412628.1"
                     /db_xref="GI:330838048"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496396"
                     /translation="MQNTSLRLPSWQAFSSVAAKGLKVFLFYLAVLSFCRAFFIFWMH
                     DYMAAATGSADIALALWRGMRLSFQTAGLLALFSLVPAAIARLLHTPLENLAWRVTSA
                     LSLTVLSILYAASFPYYRQYHTGFHQLIFNTVNEDVYALFISLVQEFYLPVRLAGALL
                     LAFLLYRALCLLLACDFSALAERLLPWRSLRRALFLLILALVALLSAFGGSLRWQDAV
                     NWENAGVTNDAFLNEAILDNFQALYRAYVLNSRFLACNGLDFTVEEIERLAALHAGRP
                     ADTRDLDVYLTREAEGAQIEKPRHIFLIISESYANWPLLEKYASLHIADPTKELLGAA
                     DTVYCDTFLPNGSSTVSAVTGVVTGFADANLYLTTMPESFAAPYPTAIAPTFARLGYH
                     TDFWYAGPATWERIEPFCRAQGFEQFYSRGDFSSDEGSVWGVDDEVLYGEVLSRIDPE
                     QPGLHVLLNVSNHSPYTVDLAAKGFPAEAVRAALPKEAQGDDALLKELGHYWYATQEL
                     AAFLRAAKEKFPEALFVIVGDHADRYNIEKTPSLYERYAIPFILTGHGVKKGLLDSEA
                     AGSQIDIAPTLIELIAPRGFRYEAVGRSLTRGNRQGVNYGFWITHSAIGRTDTVPLVA
                     EPIKDRPAALDEEAMQDYINAVRALSWWRPKYGPMLDEAKLEGRE"
     misc_feature    complement(218314..220182)
                     /locus_tag="Selsp_0191"
                     /note="Phosphoglycerol transferase and related proteins,
                     alkaline phosphatase superfamily [Cell envelope
                     biogenesis, outer membrane]; Region: MdoB; COG1368"
                     /db_xref="CDD:224287"
     misc_feature    complement(218485..219330)
                     /locus_tag="Selsp_0191"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            complement(220247..221023)
                     /locus_tag="Selsp_0192"
                     /db_xref="GeneID:10496397"
     CDS             complement(220247..221023)
                     /locus_tag="Selsp_0192"
                     /note="COGs: COG1349 Transcriptional regulators of sugar
                     metabolism;
                     InterPro IPR001034:IPR014036;
                     KEGG: cbe:Cbei_0466 DeoR family transcriptional regulator;
                     PFAM: HTH transcriptional regulator, DeoR; HTH
                     transcriptional regulator, DeoR N-terminal;
                     SMART: HTH transcriptional regulator, DeoR N-terminal;
                     SPTR: Transcriptional regulator, DeoR family;
                     IMG reference gene:2504585646;
                     PFAM: Bacterial regulatory proteins, deoR family;
                     DeoR-like helix-turn-helix domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, DeoR family"
                     /protein_id="YP_004412629.1"
                     /db_xref="GI:330838049"
                     /db_xref="InterPro:IPR001034"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR014036"
                     /db_xref="GeneID:10496397"
                     /translation="MFLVERHDAILDILARDGKVRVKDLSDRFHVTEDCIRKDLGALE
                     KQGRLKRTYGGAVIRRENPHTIEVSKHRNIDVEAKRRIARAAMHLIHEHDMVFLDIST
                     SNLAIAELLVHDERELTVVTNMIDILSILAQNPKIRVVFVGGVINKSRDGFWGGMTLD
                     LISRLKPDIAFVGAVGVDVKENSVSTYDIEDGINKAAIIRVSKRAYVVAEARKLSSDG
                     NYNYVTLDTLSGLITDSRPAADICQTAEDYGVDIILPQID"
     misc_feature    complement(220256..221023)
                     /locus_tag="Selsp_0192"
                     /note="Transcriptional regulators of sugar metabolism
                     [Transcription / Carbohydrate transport and metabolism];
                     Region: GlpR; COG1349"
                     /db_xref="CDD:224268"
     misc_feature    complement(220853..221008)
                     /locus_tag="Selsp_0192"
                     /note="helix_turn_helix, Deoxyribose operon repressor;
                     Region: HTH_DEOR; smart00420"
                     /db_xref="CDD:197714"
     misc_feature    complement(220319..220804)
                     /locus_tag="Selsp_0192"
                     /note="DeoR C terminal sensor domain; Region: DeoRC;
                     pfam00455"
                     /db_xref="CDD:249873"
     gene            221255..221791
                     /locus_tag="Selsp_0193"
                     /db_xref="GeneID:10496398"
     CDS             221255..221791
                     /locus_tag="Selsp_0193"
                     /note="COGs: COG1268 conserved hypothetical protein;
                     InterPro IPR003784;
                     KEGG: afn:Acfer_0056 BioY protein;
                     PFAM: BioY protein;
                     SPTR: BioY family protein;
                     IMG reference gene:2504585647;
                     PFAM: BioY family"
                     /codon_start=1
                     /transl_table=11
                     /product="BioY protein"
                     /protein_id="YP_004412630.1"
                     /db_xref="GI:330838050"
                     /db_xref="InterPro:IPR003784"
                     /db_xref="GeneID:10496398"
                     /translation="MKVREIVLCALFIALVAVGAFIRIPVGTDVYTLQFLFTLLAGVL
                     LGARLGAVAVGVYVLMGLVGIPVFASGGGPSYVLQPTFGYLVGFICQAYLTGALVRGG
                     EPTFGRVLGACLAGMAVVYLFGISYFYIASNYIVDAPITLWLALWYCGILQVVPDFLL
                     CLAAAFIGIRCRKAGLWL"
     misc_feature    221255..221764
                     /locus_tag="Selsp_0193"
                     /note="Protein of unknown function (DUF3816); Region:
                     DUF3816; cl17272"
                     /db_xref="CDD:266601"
     gene            221834..222517
                     /locus_tag="Selsp_0194"
                     /db_xref="GeneID:10496399"
     CDS             221834..222517
                     /locus_tag="Selsp_0194"
                     /EC_number="6.3.3.3"
                     /note="COGs: COG0132 Dethiobiotin synthetase;
                     InterPro IPR002586:IPR004472;
                     KEGG: afn:Acfer_0057 dethiobiotin synthase;
                     PFAM: Cobyrinic acid a,c-diamide synthase;
                     PRIAM: Dethiobiotin synthase;
                     SPTR: Dethiobiotin synthetase;
                     TIGRFAM: Dethiobiotin synthase;
                     IMG reference gene:2504585648;
                     PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain;
                     TIGRFAM: dethiobiotin synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="dethiobiotin synthase"
                     /protein_id="YP_004412631.1"
                     /db_xref="GI:330838051"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR004472"
                     /db_xref="GeneID:10496399"
                     /translation="MGKALFITGTGTDIGKTYVTGLIVKRLKEAGVRTGYYKAALSGA
                     ETSADGSLLPGDALHVARTAALAEDEAIVSYIYRDAVSPHLAARIENRPIDFGKVERD
                     FRAAKERFDYLTVEGSGGIICPLRWDEHEHVVLDDLAVRLGLSALVVADAGLGTINAA
                     VLTAEHLKMRAIPLKGFIFNNWQAGDVMQEDNKKMVEEMTGAPVVACVAKGAEELPLA
                     AAALAALYD"
     misc_feature    221840..222457
                     /locus_tag="Selsp_0194"
                     /note="AAA domain; Region: AAA_26; pfam13500"
                     /db_xref="CDD:257820"
     misc_feature    221843..222457
                     /locus_tag="Selsp_0194"
                     /note="dithiobiotin synthetase; Reviewed; Region: bioD;
                     PRK00090"
                     /db_xref="CDD:234625"
     gene            222548..223894
                     /locus_tag="Selsp_0195"
                     /db_xref="GeneID:10496400"
     CDS             222548..223894
                     /locus_tag="Selsp_0195"
                     /EC_number="2.6.1.62"
                     /note="COGs: COG0161
                     Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase;
                     InterPro IPR005814:IPR005815;
                     KEGG: afn:Acfer_0058
                     adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase;
                     PFAM: Aminotransferase class-III;
                     PRIAM: Adenosylmethionine--8-amino-7-oxononanoate
                     transaminase;
                     SPTR: Adenosylmethionine-8-amino-7-oxononanoate
                     transaminase;
                     TIGRFAM: Adenosylmethionine--8-amino-7-oxononanoate
                     aminotransferase;
                     IMG reference gene:2504585649;
                     PFAM: Aminotransferase class-III;
                     TIGRFAM: adenosylmethionine-8-amino-7-oxononanoate
                     transaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase"
                     /protein_id="YP_004412632.1"
                     /db_xref="GI:330838052"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR005815"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496400"
                     /translation="MPTIEERDLRHIWHPCAQMKDYEELLPMVIDHAKGAWLYDVHGK
                     AYLDIVSSWWANLLGHANEKINARIKAQLDRLEHVIFANFSHRPAIELAERLAALVPA
                     GLTKFHFNDNGSSAVEAALKMAFQYCQQTGRTKKTRFLCLSEGYHGETIGALSVGSMD
                     LFAEMYKPMMMDNIHVEAPDCYRCPFQKTRETCSCECFSYAEKAFSEHAEECAAMIVE
                     PLLQGSAGMRIYPELYLKKLRALCDEHDVLLIADEIATGFGRTGRLFATERAGITSDI
                     MCLSKGLTGGYMPMSITVVKEKIYDAFYADWSEGKAFMHSHTYAGNPLGCAAALAVLD
                     ILDEENVLEKAEETALWLTARMEEVFGAHRNVGEIRHIGLIHAAELVEDKREKRPFDA
                     SRRLGYAIYRAALRSGLLLRPLGDVLYFNPPLNIEKEELDTAICRMKQAMDEVLEA"
     misc_feature    222548..223891
                     /locus_tag="Selsp_0195"
                     /note="Adenosylmethionine-8-amino-7-oxononanoate
                     aminotransferase [Coenzyme metabolism]; Region: BioA;
                     COG0161"
                     /db_xref="CDD:223239"
     misc_feature    222557..223885
                     /locus_tag="Selsp_0195"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    order(222881..222889,222983..222988,222992..222994,
                     223199..223201,223301..223303,223307..223312,
                     223388..223390)
                     /locus_tag="Selsp_0195"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    order(222884..222889,222983..222988,223199..223201,
                     223301..223303,223310..223312,223388..223390)
                     /locus_tag="Selsp_0195"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    223388..223390
                     /locus_tag="Selsp_0195"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            224051..224464
                     /locus_tag="Selsp_0196"
                     /db_xref="GeneID:10496401"
     CDS             224051..224464
                     /locus_tag="Selsp_0196"
                     /note="COGs: COG2893 Phosphotransferase system
                     mannose/fructose-specific component IIA;
                     InterPro IPR013789:IPR004701;
                     KEGG: ppy:PPE_01463 phosphotransferase system,
                     mannose/fructose-specific component IIA;
                     PFAM: Phosphotransferase system, fructose subfamily IIA
                     component;
                     SPTR: PTS system mannose-specific EIIAB component;
                     TIGRFAM: Phosphotransferase system, fructose subfamily IIA
                     component, subgroup;
                     IMG reference gene:2504585650;
                     PFAM: PTS system fructose IIA component;
                     TIGRFAM: PTS system, mannose/fructose/sorbose family, IIA
                     component"
                     /codon_start=1
                     /transl_table=11
                     /product="PTS system, mannose/fructose/sorbose family, IIA
                     subunit"
                     /protein_id="YP_004412633.1"
                     /db_xref="GI:330838053"
                     /db_xref="InterPro:IPR004701"
                     /db_xref="GeneID:10496401"
                     /translation="MFAIIVGTHGRLAEELLSSVEMIFGEVQNTAAVTFLPGEGPADI
                     TAKYEAVLEKLDTSGGVLFLVDIFGGTPYNAACRIVINNEQYGIVTGVSMPMLVDMAN
                     TQAMDEGTDIRTLMEKAASVGQKGIRLFHASAVNS"
     misc_feature    224057..224383
                     /locus_tag="Selsp_0196"
                     /note="PTS_IIA, PTS system, mannose/sorbose specific IIA
                     subunit. The bacterial phosphoenolpyruvate: sugar
                     phosphotransferase system (PTS) is a multi-protein system
                     involved in the regulation of a variety of metabolic and
                     transcriptional processes. This family...; Region:
                     PTS_IIA_man; cd00006"
                     /db_xref="CDD:237978"
     misc_feature    order(224075..224077,224117..224122,224153..224155,
                     224261..224263,224354..224356)
                     /locus_tag="Selsp_0196"
                     /note="active pocket/dimerization site"
                     /db_xref="CDD:237978"
     misc_feature    order(224075..224077,224246..224248,224261..224263)
                     /locus_tag="Selsp_0196"
                     /note="active site"
                     /db_xref="CDD:237978"
     misc_feature    224075..224077
                     /locus_tag="Selsp_0196"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:237978"
     gene            224494..225453
                     /locus_tag="Selsp_0197"
                     /db_xref="GeneID:10496402"
     CDS             224494..225453
                     /locus_tag="Selsp_0197"
                     /EC_number="2.7.1.11"
                     /note="COGs: COG0205 6-phosphofructokinase;
                     InterPro IPR012828:IPR000023;
                     KEGG: hmo:HM1_0078 6-phosphofructokinase;
                     PFAM: Phosphofructokinase domain;
                     PRIAM: 6-phosphofructokinase;
                     SPTR: 6-phosphofructokinase;
                     TIGRFAM: 6-phosphofructokinase;
                     IMG reference gene:2504585651;
                     PFAM: Phosphofructokinase;
                     TIGRFAM: 6-phosphofructokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="6-phosphofructokinase"
                     /protein_id="YP_004412634.1"
                     /db_xref="GI:330838054"
                     /db_xref="InterPro:IPR000023"
                     /db_xref="InterPro:IPR012003"
                     /db_xref="InterPro:IPR012828"
                     /db_xref="InterPro:IPR022953"
                     /db_xref="GeneID:10496402"
                     /translation="MISTIGVVTSGGDSPGMNAAARAVVRTAISEGVRIFGVYGGYTG
                     LLDGDIKELSTRSVSDLIQRGGTFLGTGRSKRFHTEEGRKAAMEKLKEHGIEGLVVIG
                     GDGSLTGAAHLSRHGMPIVGLPATIENDVWGTDYTIGADTAANTVLEAINKLRDTASA
                     HRRIILIEVMGKKSGWLAMMAGVAGGAEYVLVPEVKYDLDEICTEIMDAYEAGKKYSI
                     IVVAQGAGSAVEMGKFIGETTKIDTRVSVLGYIQRGGAPTVEDRMKASLLGERAALAL
                     MSGASDIVFGFDMGKVVSINLHDAVTNRKTLDPEIVRLARVLA"
     misc_feature    224506..225447
                     /locus_tag="Selsp_0197"
                     /note="6-phosphofructokinase; Provisional; Region:
                     PRK03202"
                     /db_xref="CDD:235111"
     misc_feature    order(224527..224529,224617..224619,224710..224712,
                     224803..224811,224815..224820,224869..224871,
                     224875..224877,224881..224883,225001..225009,
                     225160..225162,225241..225243,225250..225252)
                     /locus_tag="Selsp_0197"
                     /note="active site"
                     /db_xref="CDD:238216"
     misc_feature    order(224527..224529,224617..224619,224710..224712,
                     224803..224811,224815..224820)
                     /locus_tag="Selsp_0197"
                     /note="ADP/pyrophosphate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238216"
     misc_feature    order(224557..224559,224569..224571,224656..224658,
                     224671..224673,224680..224682,224899..224901,
                     224935..224937,224947..224949,224956..224958,
                     225040..225045,225049..225051,225133..225135,
                     225277..225282,225292..225294,225313..225315,
                     225358..225360,225442..225444)
                     /locus_tag="Selsp_0197"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238216"
     misc_feature    order(224557..224559,224569..224571,224656..224661,
                     224668..224673,224956..224958,225049..225051,
                     225055..225057,225127..225129,225133..225141)
                     /locus_tag="Selsp_0197"
                     /note="allosteric effector site; other site"
                     /db_xref="CDD:238216"
     misc_feature    order(224869..224871,224875..224877,224881..224883,
                     224980..224982,225001..225009,225160..225162,
                     225223..225225,225241..225243,225250..225252)
                     /locus_tag="Selsp_0197"
                     /note="fructose-1,6-bisphosphate binding site; other site"
                     /db_xref="CDD:238216"
     gene            225474..226454
                     /locus_tag="Selsp_0198"
                     /db_xref="GeneID:10496403"
     CDS             225474..226454
                     /locus_tag="Selsp_0198"
                     /EC_number="1.4.1.16"
                     /note="InterPro IPR000846:IPR010190;
                     KEGG: bpb:bpr_I0298 diaminopimelate dehydrogenase;
                     PFAM: Dihydrodipicolinate reductase, N-terminal;
                     PRIAM: Diaminopimelate dehydrogenase;
                     SPTR: Diaminopimelate dehydrogenase;
                     TIGRFAM: Diaminopimelate dehydrogenase;
                     IMG reference gene:2504585652;
                     PFAM: Dihydrodipicolinate reductase, N-terminus;
                     TIGRFAM: diaminopimelate dehydrogenase"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate dehydrogenase"
                     /protein_id="YP_004412635.1"
                     /db_xref="GI:330838055"
                     /db_xref="InterPro:IPR000846"
                     /db_xref="InterPro:IPR010190"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496403"
                     /translation="MKIAILGYGNLGRGVECAVRENSDMELVAVFTRRDPKDVKIRTE
                     GVPVVRVEDIEAWKDKVDVLILCGGSATDLPGQTPQYAKFFHVVDSFDTHAKIPAHFA
                     AVDAAAKATNHVAVISVGWDPGLFSLARVYANAVLPNGKEYTFWGRGVSQGHSDAIRR
                     IAGVKDAKQYTIPVVKALAAVRRGDNPELTTREKHTRECFVVLEEGADAAKVEKEIKE
                     MPNYFADYDTTVHFITEEELKASHSGLAHGGFVIRTGATGLHGEHKHAIEYSLKLDSN
                     PEFTTSVLLAYARAAYRLAQEGVAGCKTVLDIAPAYLSPLSAEELRAKLL"
     misc_feature    225474..226451
                     /locus_tag="Selsp_0198"
                     /note="diaminopimelate dehydrogenase; Region: DAP-DH;
                     TIGR01921"
                     /db_xref="CDD:233638"
     misc_feature    225474..>225668
                     /locus_tag="Selsp_0198"
                     /note="Dihydrodipicolinate reductase, N-terminus; Region:
                     DapB_N; pfam01113"
                     /db_xref="CDD:250369"
     gene            complement(226501..227379)
                     /locus_tag="Selsp_0199"
                     /db_xref="GeneID:10496404"
     CDS             complement(226501..227379)
                     /locus_tag="Selsp_0199"
                     /note="COGs: COG2962 permease;
                     InterPro IPR000620:IPR004626;
                     KEGG: vpr:Vpar_1764 RarD protein, DMT superfamily
                     transporter;
                     PFAM: Drug/metabolite transporter;
                     SPTR: Protein RarD;
                     TIGRFAM: RarD protein;
                     IMG reference gene:2504585653;
                     PFAM: EamA-like transporter family;
                     TIGRFAM: rarD protein"
                     /codon_start=1
                     /transl_table=11
                     /product="RarD protein, DMT superfamily transporter"
                     /protein_id="YP_004412636.1"
                     /db_xref="GI:330838056"
                     /db_xref="InterPro:IPR000620"
                     /db_xref="InterPro:IPR004626"
                     /db_xref="GeneID:10496404"
                     /translation="MEQKKRGMIAALSTYIIWGFLPLYWNLLTAASAAEILAHRISWS
                     FVFMLLVLAVSKRWQNFCQDCSALRQNRRRALLLFGASILITINWLTYIWAVNNGHVI
                     DTSLGYYSTPLMNVALGVVLFKERLTPSARVSVLLAFCGVLLMTVQIGKLPWVALVLA
                     LTFGLYGALKKKLALHPFSSITLETLLVLPVFLPYAIYLAGEPTSQFSLATPREMLLL
                     IGSGAATATPLILFSYGANLLPLNVLGFFQYLSPTIALLLGVFFFHEPFGAAQLSACA
                     CIWTALLIFTLSERVR"
     misc_feature    complement(226516..227367)
                     /locus_tag="Selsp_0199"
                     /note="Predicted permeases [General function prediction
                     only]; Region: RarD; COG2962"
                     /db_xref="CDD:225510"
     misc_feature    complement(226936..227262)
                     /locus_tag="Selsp_0199"
                     /note="Multidrug resistance efflux transporter; Region:
                     EmrE; cl19304"
                     /db_xref="CDD:267657"
     gene            complement(227420..228061)
                     /locus_tag="Selsp_0200"
                     /db_xref="GeneID:10496405"
     CDS             complement(227420..228061)
                     /locus_tag="Selsp_0200"
                     /note="COGs: COG3859 membrane protein;
                     InterPro IPR012651;
                     KEGG: ckr:CKR_1784 hypothetical protein;
                     PFAM: Thiamine transporter YuaJ;
                     SPTR: Putative proton-coupled thiamine transporter YuaJ;
                     TIGRFAM: Thiamine transporter YuaJ;
                     IMG reference gene:2504585654;
                     PFAM: Thiamine transporter protein (Thia_YuaJ);
                     TIGRFAM: putative proton-coupled thiamine transporter
                     YuaJ"
                     /codon_start=1
                     /transl_table=11
                     /product="proton-coupled thiamine transporter YuaJ"
                     /protein_id="YP_004412637.1"
                     /db_xref="GI:330838057"
                     /db_xref="InterPro:IPR012651"
                     /db_xref="GeneID:10496405"
                     /translation="MDTLLQNISAILEHPASLIALIAVLFAILSHLYFRRVRLTTPMI
                     VTIALMLAMTVILHQFRLYHMPQGGSVTLGAMVPLLFVSYRYGVGTGCLAGFLYGIFN
                     MMQDPYLLHPVQVLFDYPLPYMALSLAALFPAHRMASTALAFLARFFCHIVSGVVFFA
                     SYAPAGTSPLVYSLTFNATYLVPECLICFALLKVLPVERLMAAMDRQTAPHAH"
     misc_feature    complement(227462..227932)
                     /locus_tag="Selsp_0200"
                     /note="Thiamine transporter protein (Thia_YuaJ); Region:
                     Thia_YuaJ; pfam09515"
                     /db_xref="CDD:255406"
     gene            228322..230154
                     /locus_tag="Selsp_0201"
                     /db_xref="GeneID:10496406"
     CDS             228322..230154
                     /locus_tag="Selsp_0201"
                     /note="COGs: COG1835 acyltransferase;
                     InterPro IPR002656;
                     KEGG: efa:EF0783 acyltransferase, putative;
                     PFAM: Acyltransferase 3;
                     SPTR: Acyltransferase 3;
                     IMG reference gene:2504585655;
                     PFAM: Acyltransferase family"
                     /codon_start=1
                     /transl_table=11
                     /product="acyltransferase 3"
                     /protein_id="YP_004412638.1"
                     /db_xref="GI:330838058"
                     /db_xref="InterPro:IPR002656"
                     /db_xref="InterPro:IPR013830"
                     /db_xref="InterPro:IPR013831"
                     /db_xref="GeneID:10496406"
                     /translation="MADYVGGRPTTRIQGLDALRTLAIVGVTLFHIFPDVVKGGYLGV
                     SLFFVLTGYLLAYTTERERLAGEFSLGRYFLKRLLRMYPALVVVILVTLGVYSFVLPE
                     TVVDMREEVLSVVLGYNNWWQIAANADYFTRIANASPFTHLWFMGIELQYAFVLWPLL
                     FLLYTLVSHCMGKGAGMAVIAVLGLGTALLMPLSYSMGADVTRLYYGTDTRVFALLLG
                     AAMGLWRAGTSAAKKNPLWREIAEFVSFELLFVAVLFACVFFDGANPLLYRGGMFSVT
                     LLFCLLLAITADRGMTIGKFLDMRVFRWIGTRSYGIFLWQYPVIFLFQQKGWEAMPYF
                     AAWEIAVILLLAMWTEALTKSIGRRELPAFGNRLVYVQGACFLAFTLCGVFLMGFGCK
                     GLAAPAGYKAEARAQLNARLEKNAAELARQKEEAEKAAAAKAAEDKAARMKAVDLSGV
                     ACIGDSVMLSAAGDLQKALPGCAVDAEVSRYVGGGIEAAQSLAAQGRLGSIVVVSLGT
                     NGPLAAGERYIEQTQGLLKLLGSSRRIFWVNVYAPHLSWQDPNNEYIRKMAAENKNVT
                     VIDWYGLVSKHPEWLSGDGVHPNDAGTEQYAKLVHDAVAEALAK"
     misc_feature    228355..229413
                     /locus_tag="Selsp_0201"
                     /note="Predicted acyltransferases [Lipid metabolism];
                     Region: COG1835"
                     /db_xref="CDD:224748"
     misc_feature    229666..230133
                     /locus_tag="Selsp_0201"
                     /note="yrhL-like subfamily of SGNH-hydrolases, a diverse
                     family of lipases and esterases. The tertiary fold of the
                     enzyme is substantially different from that of the
                     alpha/beta hydrolase family and unique among all known
                     hydrolases; its active site closely...; Region:
                     SGNH_hydrolase_yrhL_like; cd01840"
                     /db_xref="CDD:238878"
     misc_feature    order(229687..229689,229759..229761,229846..229848,
                     230071..230073,230080..230082)
                     /locus_tag="Selsp_0201"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238878"
     misc_feature    order(229687..229689,230071..230073,230080..230082)
                     /locus_tag="Selsp_0201"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238878"
     misc_feature    order(229687..229689,229759..229761,229846..229848)
                     /locus_tag="Selsp_0201"
                     /note="oxyanion hole [active]"
                     /db_xref="CDD:238878"
     gene            230206..230448
                     /locus_tag="Selsp_0202"
                     /db_xref="GeneID:10496407"
     CDS             230206..230448
                     /locus_tag="Selsp_0202"
                     /note="KEGG: ttm:Tthe_1877 YcfA family protein;
                     SPTR: Toxin-antitoxin system, toxin component, HicA
                     family;
                     IMG reference gene:2504585656"
                     /codon_start=1
                     /transl_table=11
                     /product="YcfA family protein"
                     /protein_id="YP_004412639.1"
                     /db_xref="GI:330838059"
                     /db_xref="GeneID:10496407"
                     /translation="MSKWEKLIARIRNNPKAVSFEEVAKVLESIGYEKRQPRSGSSHW
                     TFRKKGCLPLTIPKKEPYVKEAYVRQVILALDDADA"
     misc_feature    230263..230421
                     /locus_tag="Selsp_0202"
                     /note="YcfA-like protein; Region: YcfA; pfam07927"
                     /db_xref="CDD:254521"
     gene            230441..230872
                     /locus_tag="Selsp_0203"
                     /db_xref="GeneID:10496408"
     CDS             230441..230872
                     /locus_tag="Selsp_0203"
                     /note="COGs: COG1598 conserved hypothetical protein;
                     InterPro IPR005357:IPR008651;
                     KEGG: pth:PTH_2782 hypothetical protein;
                     SPTR: Toxin-antitoxin system, antitoxin component, HicB
                     family;
                     IMG reference gene:2504585657;
                     PFAM: HicB family; Uncharacterised protein family
                     (UPF0150)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412640.1"
                     /db_xref="GI:330838060"
                     /db_xref="InterPro:IPR005357"
                     /db_xref="InterPro:IPR008651"
                     /db_xref="InterPro:IPR013321"
                     /db_xref="GeneID:10496408"
                     /translation="MREMMLMLMLMLDLLSVCEGDDMKRDIAYYMALPYREIIEADAA
                     GGYVGYVAELKGCITQAETKAELLELLEDAKRCWLEAALEEGLTIPKPQSEENFSGKF
                     NLRLPKSLHRELALSAKAEGVSLNQLAVCLIASGLKTSAVR"
     misc_feature    230543..230716
                     /locus_tag="Selsp_0203"
                     /note="Predicted nuclease of the RNAse H fold, HicB family
                     [General    function prediction only]; Region: COG1598"
                     /db_xref="CDD:224514"
     misc_feature    230693..230830
                     /locus_tag="Selsp_0203"
                     /note="HicB family; Region: HicB; pfam05534"
                     /db_xref="CDD:114265"
     gene            231151..231780
                     /locus_tag="Selsp_0204"
                     /db_xref="GeneID:10496409"
     CDS             231151..231780
                     /locus_tag="Selsp_0204"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585658"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412641.1"
                     /db_xref="GI:330838061"
                     /db_xref="GeneID:10496409"
                     /translation="MVSFCEVFWMNKILCVLLMALSVCVTCAASPAETGMQNGAKIAV
                     VQYLNSSEENQGYVDETVAEKYTNYFSAAGYMVVPNAETQSALSTTGYTTEDEELPDK
                     DQMKAVAEATGADYVVAMEIAELHASRHESFFQVKVTVKTKLAYKVYAAKADKLYAFK
                     TTSSDDNKTVFGGVGFKSPIVNALTDAMEKGNAKIQSFVAENSGVDLAQ"
     gene            231725..232351
                     /locus_tag="Selsp_0205"
                     /db_xref="GeneID:10496410"
     CDS             231725..232351
                     /locus_tag="Selsp_0205"
                     /note="KEGG: sus:Acid_6029 PEGA domain-containing protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585659"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412642.1"
                     /db_xref="GI:330838062"
                     /db_xref="GeneID:10496410"
                     /translation="MQRFSRLWQKTAALTLRSEAWGHLLCLAGLVASLMLLAHLAEAS
                     APEGVEEGHAYIPAGTELSLRLEREVSSKDVSEGDFVPVVVLGDLRLNGVVVIRSKAD
                     VRAVVAKNRPAGVYGRSGLLVIEMKSVQTENGITVPLRGTEEKKVAHHDNALTQGVVG
                     GLFIKGAQAVYKKGSFFTAVVDTDVDLGVSKEDLAQVMCEQGKVAAAP"
     gene            232448..232816
                     /locus_tag="Selsp_0206"
                     /db_xref="GeneID:10496411"
     CDS             232448..232816
                     /locus_tag="Selsp_0206"
                     /note="InterPro IPR010652;
                     KEGG: pam:PANA_2553 hypothetical protein;
                     PFAM: Protein of unknown function DUF1232;
                     SPTR: Putative membrane protein;
                     IMG reference gene:2504585660;
                     PFAM: Protein of unknown function (DUF1232)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412643.1"
                     /db_xref="GI:330838063"
                     /db_xref="InterPro:IPR010652"
                     /db_xref="GeneID:10496411"
                     /translation="MWKIFSFLKMFREDLLIMMVALKDSRTPTAIKAAFLAGLLYCIS
                     PIDIIPDAVPVLGMVDDAAVLPAAVFGLIRFLPPHVRADAQVKAERLGRRLPYIVALA
                     SIALIAWIALIVWGIVAIFR"
     misc_feature    <232478..>232654
                     /locus_tag="Selsp_0206"
                     /note="Protein of unknown function (DUF1232); Region:
                     DUF1232; cl01318"
                     /db_xref="CDD:260882"
     gene            232972..233847
                     /locus_tag="Selsp_0207"
                     /db_xref="GeneID:10496412"
     CDS             232972..233847
                     /locus_tag="Selsp_0207"
                     /note="COGs: COG3152 membrane protein;
                     InterPro IPR008523;
                     KEGG: pfs:PFLU5551 hypothetical protein;
                     PFAM: Protein of unknown function DUF805;
                     SPTR: Putative cell division protein FtsK;
                     IMG reference gene:2504585661;
                     PFAM: Protein of unknown function (DUF805)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412644.1"
                     /db_xref="GI:330838064"
                     /db_xref="InterPro:IPR008523"
                     /db_xref="GeneID:10496412"
                     /translation="MALKKCMGCGIPLGGDAKSCPQCGMAQSEECKCAHCGTDLQAGM
                     RFCPECGQAVSEGTTQQTPQAQAPGVPPAAAVQSSSMNVDKPQNAPQNFASPSPQNFA
                     PPQGAGAQPVSAPPMQTPPAQTSPTGGQPMPHPGNTPPFGARGGAFGGGTGAAGAAGS
                     LGEWKEKLLSFEGRLNRKPYILRGLAVSLISSVIVQIVSFILGFIIAKIAESSPELGM
                     VLFIFLYAVIFVLCLPATVIGISLGIRRCHDNDWSGWLVLLSFVPLVNIVFGLLLLFK
                     QGTPGPNRFGPDPLQ"
     misc_feature    232987..233124
                     /locus_tag="Selsp_0207"
                     /note="Double zinc ribbon; Region: DZR; pfam12773"
                     /db_xref="CDD:257289"
     misc_feature    233065..233133
                     /locus_tag="Selsp_0207"
                     /note="zinc-ribbon domain; Region: zf-ribbon_3; pfam13248"
                     /db_xref="CDD:257604"
     misc_feature    233470..233841
                     /locus_tag="Selsp_0207"
                     /note="Protein of unknown function (DUF805); Region:
                     DUF805; pfam05656"
                     /db_xref="CDD:253305"
     gene            233863..234348
                     /locus_tag="Selsp_0208"
                     /db_xref="GeneID:10496413"
     CDS             233863..234348
                     /locus_tag="Selsp_0208"
                     /note="KEGG: afn:Acfer_0870 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585662"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412645.1"
                     /db_xref="GI:330838065"
                     /db_xref="GeneID:10496413"
                     /translation="MKRCVMLSLIAALLFAANLCSAARLPDADYALGGIQFGSDADYV
                     KSVYGDPDWVEYYAGTPGSGDIPLWIYHYGDSFIVGIETKRSTVSSMMTSADNGIATP
                     RGIHVGSTLTEIQRAYGTLPQAHKANQGYCYSYGWGLISLDFYVDGKGKVYKIWTGYS
                     D"
     misc_feature    233974..>234228
                     /locus_tag="Selsp_0208"
                     /note="CAP-associated N-terminal; Region: CAP_assoc_N;
                     pfam14504"
                     /db_xref="CDD:258644"
     gene            234939..236481
                     /locus_tag="Selsp_R0006"
                     /db_xref="GeneID:10496414"
     rRNA            234939..236481
                     /locus_tag="Selsp_R0006"
                     /product="16S ribosomal RNA"
                     /note="IMG reference gene:2504585663"
                     /db_xref="GeneID:10496414"
     gene            236811..239887
                     /locus_tag="Selsp_R0007"
                     /db_xref="GeneID:10496415"
     rRNA            236811..239887
                     /locus_tag="Selsp_R0007"
                     /product="23S ribosomal RNA"
                     /note="IMG reference gene:2504585664"
                     /db_xref="GeneID:10496415"
     gene            240062..240178
                     /locus_tag="Selsp_R0008"
                     /db_xref="GeneID:10496416"
     rRNA            240062..240178
                     /locus_tag="Selsp_R0008"
                     /product="5S ribosomal RNA"
                     /note="IMG reference gene:2504585665"
                     /db_xref="GeneID:10496416"
     gene            240360..240821
                     /locus_tag="Selsp_0209"
                     /db_xref="GeneID:10496417"
     CDS             240360..240821
                     /locus_tag="Selsp_0209"
                     /note="COGs: COG1943 Transposase and inactivated
                     derivatives;
                     InterPro IPR002686;
                     KEGG: cce:Ccel_3266 transposase IS200-family protein;
                     PFAM: Transposase IS200-like;
                     SPTR: Transposase, IS200 family;
                     IMG reference gene:2504585666;
                     PFAM: Transposase IS200 like"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase IS200-family protein"
                     /protein_id="YP_004412646.1"
                     /db_xref="GI:330838066"
                     /db_xref="InterPro:IPR002686"
                     /db_xref="GeneID:10496417"
                     /translation="MAQKANSLSHTKWLCKYHIVFTPKYRRKIIYNQYKASIRDILRQ
                     LCAYKGVEILEGHLMPDHVHMLVSIPPKLSVSQFMGYLKGKSALMIFDKHANLKYKFG
                     NRHFWAEGYYVSTVGLNEATIRKYIQEQERHDVAMDKLSVKEYEDPFKGSK"
     misc_feature    240393..240749
                     /locus_tag="Selsp_0209"
                     /note="Transposase IS200 like; Region: Y1_Tnp; pfam01797"
                     /db_xref="CDD:250874"
     gene            complement(240969..241415)
                     /locus_tag="Selsp_0210"
                     /db_xref="GeneID:10496418"
     CDS             complement(240969..241415)
                     /locus_tag="Selsp_0210"
                     /note="KEGG: lmc:Lm4b_00645 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585667"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412647.1"
                     /db_xref="GI:330838067"
                     /db_xref="GeneID:10496418"
                     /translation="MPKSTEELKDDLRQASGLEGFLVDNQKDFRQYTLAEYLNQLLEE
                     KHLSKLDVVRASSLERIYAYHIFAGRKKNPSRNKVLSLALAMKLTPEETQYLLYYAGA
                     EHLYVRNPRDSILWYALDHRLSVIDTNIMLQKMSEQPLLNVETEMP"
     gene            241486..242835
                     /locus_tag="Selsp_0211"
                     /db_xref="GeneID:10496419"
     CDS             241486..242835
                     /locus_tag="Selsp_0211"
                     /note="COGs: COG0515 Serine/threonine protein kinase;
                     InterPro IPR002290:IPR020635:IPR017442;
                     KEGG: lmh:LMHCC_2012 protein kinase domain protein;
                     PFAM: Serine/threonine-protein kinase-like domain;
                     SMART: Serine/threonine-protein kinase domain;
                     Tyrosine-protein kinase, catalytic domain;
                     SPTR: Protein kinase domain protein;
                     IMG reference gene:2504585668;
                     PFAM: Protein kinase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="serine/threonine protein kinase"
                     /protein_id="YP_004412648.1"
                     /db_xref="GI:330838068"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="InterPro:IPR017442"
                     /db_xref="InterPro:IPR020636"
                     /db_xref="GeneID:10496419"
                     /translation="MDANITAYFEEIFQKIDLLKSSDKGEVWLASERSGRSTSTNRVA
                     PSACALGTFSQRLVILKRIALTGLPYRMLKGKDYPLIPRVLHCIEDGDETVVVEEYVQ
                     GESLLDRIGRKAYLSEREAESVLLQLCEGLAQIHAQGIIHRDIKPSNLILQSGCIIRL
                     IDFDAARTVKEHSGEDTMHLGTRGYAPPEQFGYGQTDARSDIYSIGITMRKALPEEYG
                     GYLVKIFAKCTEIDPDRRYRNLQELRRALIFRRFWAGRGKAALWTLAIVSAVVFCILQ
                     RFDGTEPLPNAPASKSEVDSPAVRLPSAAEESAAAPTPETSDEGVSRQSLVPSDSESE
                     QEVAVPTPSSSIELTAHDSYTPPTASQEERKSIKSADAFLAEFKDDPEKLAYWQIRNE
                     VFSSGNTSDEERLEAMKRGELGLRTDAFIKNLPPMNEAERNRAIDEFVADQKRLLDL"
     misc_feature    241696..>242112
                     /locus_tag="Selsp_0211"
                     /note="Serine/Threonine protein kinases, catalytic domain;
                     Region: S_TKc; smart00220"
                     /db_xref="CDD:214567"
     misc_feature    <241720..242196
                     /locus_tag="Selsp_0211"
                     /note="Catalytic domain of Protein Kinases; Region: PKc;
                     cd00180"
                     /db_xref="CDD:173623"
     misc_feature    order(241729..241731,241777..241788,241798..241800,
                     241804..241806,241915..241917,241921..241923,
                     241927..241932,241936..241938,241969..241971,
                     241978..241980,242026..242037)
                     /locus_tag="Selsp_0211"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    order(241729..241731,241777..241788,241798..241800,
                     241915..241917,241921..241923,241927..241932,
                     241936..241938,241969..241971)
                     /locus_tag="Selsp_0211"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    order(241798..241800,241804..241806,241915..241917,
                     241921..241923,241927..241929,241978..241980,
                     242026..242037)
                     /locus_tag="Selsp_0211"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    order(241966..241986,242026..242037)
                     /locus_tag="Selsp_0211"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     gene            243070..243339
                     /locus_tag="Selsp_0212"
                     /db_xref="GeneID:10496420"
     CDS             243070..243339
                     /locus_tag="Selsp_0212"
                     /note="SPTR: TcdA-E operon negative regulator;
                     IMG reference gene:2504585669"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412649.1"
                     /db_xref="GI:330838069"
                     /db_xref="GeneID:10496420"
                     /translation="MSDFCWLLARLAFLAMFIGMVKPKFVIFWGDKAARTRKKVFVVY
                     LSVIVLGSLLAIVTHSDGLAGGLAWFLGADIDDAQNMLRAKGLAD"
     gene            243358..243825
                     /locus_tag="Selsp_0213"
                     /db_xref="GeneID:10496421"
     CDS             243358..243825
                     /locus_tag="Selsp_0213"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585670"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412650.1"
                     /db_xref="GI:330838070"
                     /db_xref="GeneID:10496421"
                     /translation="MQDNGSNAEHHEWEFSTDRLAYGLFQVNVQTHVKVNGNRIAIDT
                     CRRALFFKWGKQSDSFDVMDVQKVTLQKKVAKLNIVLIVLGLLMVLTGNWWGLLTVLP
                     AVLFMHDKYLLIQHKNGGFRIYDAERIGANRAANEFFDYIQARNPQAMAIIRG"
     gene            243910..245046
                     /locus_tag="Selsp_0214"
                     /db_xref="GeneID:10496422"
     CDS             243910..245046
                     /locus_tag="Selsp_0214"
                     /note="KEGG: afn:Acfer_0433 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585671"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412651.1"
                     /db_xref="GI:330838071"
                     /db_xref="GeneID:10496422"
                     /translation="MSHGKKIIVACMAVLLAFVPLAKVAHADALDALAVAVEGAVGAL
                     QEDDQKITDEIIETMTKDPAQKSVLQEHITKTEPVAKKLTEAEGTIFLVSSWLHKVPL
                     SGGMLTTGFLECVEWYWERQFSSEDDPEIVKRYETLRSHFLDAEAEYIGLLADMSDSE
                     SKEIGLMKSVNGIQIMSRMGSAESAMKRVRMAAFDENPEEKGKKGASAKEKMQEKPQK
                     GAAADPREKAKQELESLGYSVSGQIKETSYGNSSVGFLARETGTGKLVVCDRKNHRVA
                     VVEPITDFSVLTHKQAGHEVFEARFYVANDARDNDRNAGYWDGATHVFNVYGLFDRDG
                     VGNVVPGKLYTASGRKPSHYHSVLYEQKNVDLMNLVMTEAKSLR"
     gene            245337..246179
                     /locus_tag="Selsp_0215"
                     /db_xref="GeneID:10496423"
     CDS             245337..246179
                     /locus_tag="Selsp_0215"
                     /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
                     InterPro IPR004089;
                     KEGG: ctc:CTC01487 methyl-accepting chemotaxis-like
                     protein;
                     PFAM: Chemotaxis methyl-accepting receptor, signalling;
                     SMART: Chemotaxis methyl-accepting receptor, signalling;
                     SPTR: Putative methyl-accepting chemotaxis protein;
                     IMG reference gene:2504585672;
                     PFAM: Methyl-accepting chemotaxis protein (MCP) signaling
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_004412652.1"
                     /db_xref="GI:330838072"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR015866"
                     /db_xref="GeneID:10496423"
                     /translation="MVYPDTIKTDQDVLDAFIAVAPYLDHVVRQDIAVGVTDKETTLA
                     LIPNAKLEFSPPVGTPISPNTRHVIDTGRDYVGLIDEKLYGRGVRSMITPIHGVSGDI
                     IGTLVTAMDVAQDIKLAHAVDEVTKSTETVYHAVEQVAESASELAKSGQEAVQQAADL
                     KERNAETIKVIEFINNIAQQTNLLGLNAAIEAARAGEQGRGFAVVAEEVRKLAEQSRE
                     ATEKIQATLAEMNKAVEAISKTIETTGAISQEQAASTEEITANLSRVTNAAEELGAFV
                     VRTD"
     misc_feature    245736..246152
                     /locus_tag="Selsp_0215"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    order(245739..245741,245748..245753,245760..245765,
                     245772..245774,245781..245786,245790..245795,
                     245805..245807,245811..245816,245823..245825,
                     245832..245837,245844..245849,245856..245858,
                     245865..245867,245874..245879,245886..245888,
                     245898..245900,245907..245909,245928..245930,
                     245940..245942,245949..245951,245958..245963,
                     245970..245972,245979..245984,245991..245996,
                     246000..246005,246012..246017,246054..246059,
                     246066..246068,246075..246080,246087..246089,
                     246096..246101,246105..246110,246117..246122,
                     246129..246131,246138..246143,246150..246152)
                     /locus_tag="Selsp_0215"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    245874..245975
                     /locus_tag="Selsp_0215"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            246422..247336
                     /locus_tag="Selsp_0216"
                     /db_xref="GeneID:10496424"
     CDS             246422..247336
                     /locus_tag="Selsp_0216"
                     /note="COGs: COG2199 FOG: GGDEF domain;
                     InterPro IPR000160;
                     KEGG: cbt:CLH_2034 diguanylate cyclase/phosphodiesterase
                     with PAS/PAC sensor;
                     PFAM: Diguanylate cyclase, predicted;
                     SPTR: Putative sensory box protein/GGDEF domain protein;
                     IMG reference gene:2504585673;
                     PFAM: GGDEF domain"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase"
                     /protein_id="YP_004412653.1"
                     /db_xref="GI:330838073"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="GeneID:10496424"
                     /translation="MERYKTPVAGYENQCVELLLEKLGVVTFDYDIEHDVLLLAKARD
                     GMTEKRFEGFCRTLCTENRGMIHPDSVEQLVALFRGQTTGVREVLLDMAEVPQGRYSW
                     YEVAVKLLRDETGRVQRTIGILWDIESSMGKMEQSFAHFRSERDSVTGILNGAGLEKA
                     VQTYLAGHGRDESNALMAISFGNICQLAEQRGKHWTDQLLVRICKAVGSFFRAGDVIA
                     HLGDGQFAVFVKDMERTEVMDMKARAIRTLFGGENTQFGGYGLECRIAVSYYPEDGTS
                     FHELLQTAEKRQSLDRGDKAAAKLLTLA"
     misc_feature    246854..247279
                     /locus_tag="Selsp_0216"
                     /note="Class III nucleotidyl cyclases; Region:
                     Nucleotidyl_cyc_III; cl11967"
                     /db_xref="CDD:264492"
     misc_feature    247088..247090
                     /locus_tag="Selsp_0216"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     gene            247493..248119
                     /locus_tag="Selsp_0217"
                     /db_xref="GeneID:10496425"
     CDS             247493..248119
                     /locus_tag="Selsp_0217"
                     /note="COGs: COG0586 membrane-associated protein;
                     InterPro IPR015414;
                     KEGG: mta:Moth_0719 hypothetical protein;
                     PFAM: SNARE associated Golgi protein;
                     SPTR: DedA family protein;
                     IMG reference gene:2504585674;
                     PFAM: SNARE associated Golgi protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SNARE associated Golgi protein-like protein"
                     /protein_id="YP_004412654.1"
                     /db_xref="GI:330838074"
                     /db_xref="InterPro:IPR015414"
                     /db_xref="GeneID:10496425"
                     /translation="MEQFTQTFLEFIDAWGYVAVAVLMALENACIPIPSELILGFSGY
                     LIFADRMGFVGAMIAGMVGGMAGSIFAYLVGRYGGRSFVDKYGKYFFVKKSHVDIAQR
                     WFDKYGVKAVFFSRMLPVVRTFISLPAGFAHVDMKKFLLYTFLGSLPWTALILGIGMA
                     LGESWQIMLKVGHEVSIAFVIVSCIIVAGLYWRYRRSRQQKAKEALIK"
     misc_feature    247505..248101
                     /locus_tag="Selsp_0217"
                     /note="Uncharacterized membrane-associated protein
                     [Function unknown]; Region: DedA; COG0586"
                     /db_xref="CDD:223659"
     gene            complement(248232..249194)
                     /locus_tag="Selsp_0218"
                     /db_xref="GeneID:10496426"
     CDS             complement(248232..249194)
                     /locus_tag="Selsp_0218"
                     /note="COGs: COG0679 permease;
                     InterPro IPR004776;
                     KEGG: sat:SYN_03357 hypothetical protein;
                     PFAM: Auxin efflux carrier;
                     SPTR: Transporter, auxin efflux carrier family;
                     IMG reference gene:2504585675;
                     PFAM: Membrane transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Auxin Efflux Carrier"
                     /protein_id="YP_004412655.1"
                     /db_xref="GI:330838075"
                     /db_xref="InterPro:IPR004776"
                     /db_xref="GeneID:10496426"
                     /translation="MDEKLFRILYVFSDLAAPLLAGYIAYQRGRISDALCNAIIRFNI
                     IVMATLLAVLSFWVMPLSRSLLWLPLFSALFMLVPGTIAYLTFARRHKDALSRGAYYM
                     SAMLTNIGTIAGLSAFILYDETGFAYVQIVSSFQVGLLVLVCFPLAAMFRAQGAKEGA
                     RVHLSLRELFLTPNQVPVLGLIAGLALNVFGVERPAVLGTAFQALVHIGAWTALFPVG
                     CLVDFSRARPYIKKTADLIPLRFLLTPLIFFGLCRLLFADSVLIGSVLLIAAAPTAIN
                     AVLTARLYKLNVDLTVASFLVTTVIYLLLFYPLFFLYVTHGGSF"
     misc_feature    complement(248292..249140)
                     /locus_tag="Selsp_0218"
                     /note="Membrane transport protein; Region: Mem_trans;
                     cl09117"
                     /db_xref="CDD:263725"
     gene            249319..250296
                     /locus_tag="Selsp_0219"
                     /db_xref="GeneID:10496427"
     CDS             249319..250296
                     /locus_tag="Selsp_0219"
                     /EC_number="5.3.1.8"
                     /note="COGs: COG1482 Phosphomannose isomerase;
                     InterPro IPR001250;
                     KEGG: cce:Ccel_1179 mannose-6-phosphate isomerase, class
                     I;
                     PFAM: Mannose-6-phosphate isomerase, type I;
                     PRIAM: Mannose-6-phosphate isomerase;
                     SPTR: Mannose-6-phosphate isomerase, class I;
                     TIGRFAM: Mannose-6-phosphate isomerase, type I;
                     IMG reference gene:2504585676;
                     PFAM: Phosphomannose isomerase type I;
                     TIGRFAM: mannose-6-phosphate isomerase, class I"
                     /codon_start=1
                     /transl_table=11
                     /product="mannose-6-phosphate isomerase, class I"
                     /protein_id="YP_004412656.1"
                     /db_xref="GI:330838076"
                     /db_xref="InterPro:IPR001250"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR014628"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:10496427"
                     /translation="MDRMIYPMKLRAPLKDYIWGGTRLKTEYGRKTSLAKVAESWELA
                     CHKEDQSVIENGADAGLTLEAYIAREGAHAALGSHGSRYPYFPLLIKLIDAHNDLSVQ
                     VHPDDSYAFEHEGEYGKMEMWYILDAEPGAEIIYGFKEEISREECRRRIEENTLLDVV
                     RRVKVKAGDAIVIPAGTLHAIGRGIFLAEIQQNSDTTYRVYDYARCGADGRLRDLHID
                     KALDVLSFAPPAYDVNRGEKFSIFAEHEMTVVARTEFFTVYHFALKGRCHLQAGRTSF
                     QSIVALGGPMELSWSGGEEILEKGDSYFIPASFGDYTMRGEGAFLLTEI"
     misc_feature    249331..250287
                     /locus_tag="Selsp_0219"
                     /note="Alpha-Mannosidase Binding Domain of Atg19/34;
                     Region: ABD; cl19057"
                     /db_xref="CDD:267410"
     misc_feature    249334..250284
                     /locus_tag="Selsp_0219"
                     /note="Phosphomannose isomerase [Carbohydrate transport
                     and metabolism]; Region: ManA; COG1482"
                     /db_xref="CDD:224399"
     gene            complement(250352..251458)
                     /locus_tag="Selsp_0220"
                     /db_xref="GeneID:10496428"
     CDS             complement(250352..251458)
                     /locus_tag="Selsp_0220"
                     /note="InterPro IPR021330;
                     PFAM: Protein of unknown function DUF2939;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585677;
                     PFAM: Protein of unknown function (DUF2939)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412657.1"
                     /db_xref="GI:330838077"
                     /db_xref="InterPro:IPR021330"
                     /db_xref="GeneID:10496428"
                     /translation="MDDYTWRLQLRARKISSYNRTLTMLVIIFFALAVGSVLWYFFIH
                     ARSPEYALAEIQEAAEKHDAEKFERYVNVSLSMGRIYDDLTRSLFAADTSLTSDERTE
                     AVRFYQLIKPQVTAGMRTTLTGRIETGEWQKPGGLLQGRQLRIDFENLFERSLLKNIT
                     IVGLDSIDRDGATATAHVKAKDELTGTELTLLLAMEQAGDGHWQVSYIKNYRDCLDRL
                     TPLLEKDVASYLEASAPIVEQYNKRFAKEQQRFSALTDMPWDGTGLLSSAQKDGLKKL
                     IRTEIIPTLKERQQKLSALSVPPGARYLSQLRAESTELSITAWEHFANALETDDFAEF
                     DTAETVHKEALDIEMRLEDLLHHAALCSHPPEMP"
     misc_feature    complement(<251243..251362)
                     /locus_tag="Selsp_0220"
                     /note="Protein of unknown function (DUF2939); Region:
                     DUF2939; pfam11159"
                     /db_xref="CDD:256326"
     gene            251519..251971
                     /locus_tag="Selsp_0221"
                     /db_xref="GeneID:10496429"
     CDS             251519..251971
                     /locus_tag="Selsp_0221"
                     /note="InterPro IPR007404;
                     KEGG: ppd:Ppro_3763 membrane-bound metal-dependent
                     hydrolase;
                     PFAM: Protein of unknown function DUF457, transmembrane;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585678;
                     PFAM: Predicted membrane-bound metal-dependent hydrolase
                     (DUF457)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412658.1"
                     /db_xref="GI:330838078"
                     /db_xref="InterPro:IPR007404"
                     /db_xref="GeneID:10496429"
                     /translation="MKWVSHEVVTGMAVYTLTGALVPTACAMAGAVLPDWIEGKGGGV
                     RLPWAGLLAHRGWSHWPLLYVLGFLALGAFGEELGEDALSLILAGRFILLGALFHIAE
                     DALCGKVPLLHPKKKVGVRLFRVGSFGEYAFALVLVLFFYGIGRLVFR"
     misc_feature    251549..251968
                     /locus_tag="Selsp_0221"
                     /note="Predicted membrane-bound metal-dependent hydrolase
                     (DUF457); Region: DUF457; pfam04307"
                     /db_xref="CDD:252517"
     gene            252024..253973
                     /locus_tag="Selsp_0222"
                     /db_xref="GeneID:10496430"
     CDS             252024..253973
                     /locus_tag="Selsp_0222"
                     /EC_number="3.1.3.11"
                     /note="COGs: COG3855 conserved hypothetical protein;
                     HAMAP: Fructose-1,6-bisphosphatase, Bacillus type;
                     InterPro IPR009164;
                     KEGG: ols:Olsu_1042 fructose-16-bisphosphatase;
                     PFAM: Fructose-1,6-bisphosphatase, Bacillus type;
                     PRIAM: Fructose-bisphosphatase;
                     SPTR: Fructose-1,6-bisphosphatase class 3;
                     IMG reference gene:2504585679;
                     PFAM: Firmicute fructose-1,6-bisphosphatase"
                     /codon_start=1
                     /transl_table=11
                     /product="Fructose-1,6-bisphosphatase class 3"
                     /protein_id="YP_004412659.1"
                     /db_xref="GI:330838079"
                     /db_xref="InterPro:IPR009164"
                     /db_xref="GeneID:10496430"
                     /translation="MLAGKSISIGEEVTLEGITMEQGTQKKNKLLGLLAEKYPTLESV
                     YERLISLQAQLGLPKGIEHFMSDLHGEYESFFHILNNCSGVIREKVEYVFADRMTDEE
                     KAEFCTLIYYPKEKIERMHAERKDTPAWYRENLARLLELSKLMSYKYPAAKVRGFIPK
                     RYESVIVELLYTRPEEDTAQAQYHRRLLATIVQIDSGAGFIEAFCVLVKRLAVDHLHI
                     VGDFFDRGSRPDAILNMILDYHDIDIEWGNHDVMWMGAAAGSEVCIAGVVRNSLRYHN
                     TDVLERGYGISLRPLSLFSTRIYPDSNAIRASEKAITMIMLKLEGQLIARNPDFEMES
                     RRLLDKINYNSSYVMLGDRRYELESAYFPTIDPKDPFALSEEEERIIADLKSYFTESE
                     MLQKHVDFLYKKGSLYKCCNGNLLYHGCVPVNEDGSLRDVIFDGKAYKGRAYFDYADR
                     RARRAYLFRAQEDLDFMWFLWCGRTSPCSGREVKTFERSLLEDESTWKEPADPYYRLL
                     DDEDFCRSILAEFGLPESGHIINGHVPVKVKKGETPVKAHGKAIIIDGGFCQAYHKKT
                     GISGFTLISNSRGFRLLMHQQVADVRQALKENKDIESVSETVELQTKLTTLGDTDEGK
                     DIQEEIADLYNLLIAYQNGVIEPKA"
     misc_feature    252105..253952
                     /locus_tag="Selsp_0222"
                     /note="Firmicute fructose-1,6-bisphosphatase; Region:
                     FBPase_2; cl19619"
                     /db_xref="CDD:267972"
     gene            complement(254175..255179)
                     /locus_tag="Selsp_0223"
                     /db_xref="GeneID:10496431"
     CDS             complement(254175..255179)
                     /locus_tag="Selsp_0223"
                     /note="COGs: COG1342 DNA-binding protein;
                     InterPro IPR002852:IPR003731;
                     KEGG: ere:EUBREC_1223 putative DNA-binding protein;
                     PFAM: Uncharacterised protein family UPF0251;
                     Dinitrogenase iron-molybdenum cofactor biosynthesis;
                     SPTR: Putative DNA-binding protein;
                     IMG reference gene:2504585680;
                     PFAM: Protein of unknown function DUF134; Dinitrogenase
                     iron-molybdenum cofactor"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412660.1"
                     /db_xref="GI:330838080"
                     /db_xref="InterPro:IPR002852"
                     /db_xref="InterPro:IPR003731"
                     /db_xref="GeneID:10496431"
                     /translation="MPRPTRGRRICVRPAYERFTPAGFPGGEAVTLLVEEYECIRSID
                     HDGLKQEECAKRMAISRTTVAEIYAAARKKIAESLVHGRPLVIEGGFYQLCDMSAPCG
                     KCCPRAEARQGYCFSPPRKKGEGTMRIAVPYENENGTVFQHFGHSQAFKLYDVKEDAV
                     EKSEVVSTQGSGHGALAGLLKENEVDALICGGIGAGAIEALTDAGIRVYAGVKGAADE
                     AVAQHLAGTLEYTTEANCSHHGEGHEHAEGGHRCSHAHGAGEGQHRHGEGHGHCGQHH
                     GEGHGEGHAQHHGEGQAHAHRHGQDAAMGEGRCPHRGKGGGHGHGRGGHGAGHGPHQQ
                     "
     misc_feature    complement(254892..255179)
                     /locus_tag="Selsp_0223"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     misc_feature    complement(254508..254801)
                     /locus_tag="Selsp_0223"
                     /note="This uncharacterized conserved protein belongs to a
                     family of iron-molybdenum cluster-binding proteins that
                     includes NifX, NifB, and NifY, all of which are involved
                     in the synthesis of an iron-molybdenum cofactor (FeMo-co)
                     that binds the active site of...; Region: MTH1175;
                     cd00851"
                     /db_xref="CDD:238431"
     gene            255520..256458
                     /locus_tag="Selsp_0224"
                     /db_xref="GeneID:10496432"
     CDS             255520..256458
                     /locus_tag="Selsp_0224"
                     /EC_number="1.8.1.9"
                     /note="COGs: COG0492 Thioredoxin reductase;
                     InterPro IPR013027:IPR001327;
                     KEGG: cno:NT01CX_2374 thioredoxin reductase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase; Pyridine nucleotide-disulphide
                     oxidoreductase, NAD-binding region;
                     PRIAM: Thioredoxin-disulfide reductase;
                     SPTR: Thioredoxin-disulfide reductase;
                     IMG reference gene:2504585681;
                     PFAM: Pyridine nucleotide-disulphide oxidoreductase;
                     TIGRFAM: thioredoxin-disulfide reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioredoxin-disulfide reductase"
                     /protein_id="YP_004412661.1"
                     /db_xref="GI:330838081"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR001327"
                     /db_xref="InterPro:IPR008255"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:10496432"
                     /translation="MAKETIQKDVVIIGAGMAGLTAALYAGRMNFSTLVLENAIVGGQ
                     IANATGIENYPGFLSVSGSDLIQTVQQQAETFGAVVDEFDAIEQVTLEGAVKRVETES
                     AVYETPVVIIASGMSRRKLPLAAEAKYAGRGVHYCELCDGHMYQDKIIAVMGGGNAAL
                     DAANFLSRYAKKLYLVHRSKLRADEVSQKRLRENPKAEILLETEIRALRGEGKLESIE
                     IFDKKAGEARELAVDAIFVNIGVQPNTALFEGQVEINEKGHIVAGEDCRTNIPGVFVA
                     GDIREKEIHQLTTAASDGTTAALLAEKYITGGKTSW"
     misc_feature    255544..256434
                     /locus_tag="Selsp_0224"
                     /note="thioredoxin-disulfide reductase; Region:
                     TRX_reduct; TIGR01292"
                     /db_xref="CDD:233345"
     misc_feature    255550..256065
                     /locus_tag="Selsp_0224"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    255967..256185
                     /locus_tag="Selsp_0224"
                     /note="Pyridine nucleotide-disulphide oxidoreductase;
                     Region: Pyr_redox; pfam00070"
                     /db_xref="CDD:249559"
     gene            256452..256682
                     /locus_tag="Selsp_0225"
                     /db_xref="GeneID:10496433"
     CDS             256452..256682
                     /locus_tag="Selsp_0225"
                     /note="InterPro IPR002109;
                     KEGG: cno:NT01CX_2375 glutaredoxin;
                     PFAM: Glutaredoxin;
                     SPTR: Glutaredoxin;
                     IMG reference gene:2504585682;
                     PFAM: Glutaredoxin;
                     TIGRFAM: Glutaredoxin-like protein, YruB-family"
                     /codon_start=1
                     /transl_table=11
                     /product="glutaredoxin"
                     /protein_id="YP_004412662.1"
                     /db_xref="GI:330838082"
                     /db_xref="InterPro:IPR002109"
                     /db_xref="InterPro:IPR011767"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="GeneID:10496433"
                     /translation="MVKVYSITQCPWCDKVKKYLKSKNIAYEEHNIEEDEAARKECEA
                     ISGDLIVPVTTVNGKDFVVSFDKAKLDAILGI"
     misc_feature    256452..256673
                     /locus_tag="Selsp_0225"
                     /note="NrdH-redoxin (NrdH) family; NrdH is a small
                     monomeric protein with a conserved redox active CXXC motif
                     within a TRX fold, characterized by a glutaredoxin
                     (GRX)-like sequence and TRX-like activity profile. In
                     vitro, it displays protein disulfide reductase...; Region:
                     NrdH; cd02976"
                     /db_xref="CDD:239274"
     misc_feature    order(256479..256481,256488..256490)
                     /locus_tag="Selsp_0225"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239274"
     gene            256902..258167
                     /locus_tag="Selsp_0226"
                     /db_xref="GeneID:10496434"
     CDS             256902..258167
                     /locus_tag="Selsp_0226"
                     /EC_number="2.5.1.7"
                     /note="COGs: COG0766 UDP-N-acetylglucosamine enolpyruvyl
                     transferase;
                     InterPro IPR001986:IPR005750;
                     KEGG: vpr:Vpar_0517
                     UDP-N-acetylglucosamine1-carboxyvinyltransferase;
                     PFAM: Enolpyruvate transferase domain;
                     PRIAM: UDP-N-acetylglucosamine 1-carboxyvinyltransferase;
                     SPTR: UDP-N-acetylglucosamine 1-carboxyvinyltransferase;
                     TIGRFAM: UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase;
                     IMG reference gene:2504585683;
                     PFAM: EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase);
                     TIGRFAM: UDP-N-acetylglucosamine
                     1-carboxyvinyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="UDP-N-acetylglucosamine1-
                     carboxyvinyltransferase"
                     /protein_id="YP_004412663.1"
                     /db_xref="GI:330838083"
                     /db_xref="InterPro:IPR001986"
                     /db_xref="InterPro:IPR005750"
                     /db_xref="InterPro:IPR013792"
                     /db_xref="GeneID:10496434"
                     /translation="MEKLIIKGGCRLAGRVKISGAKNAVLPIIAATLLGQDAPSRLEE
                     VPSLDDVHTITEVLQALGVHAAFDNAANALTVDSCEIKRTEAPYELVRKMRASFLIMG
                     PLLARLGHAKISLPGGCAIGTRPIDLHLKGFEALGAKIEIGHGYIEARADAGLKGARI
                     YLDFPSVGATENILMAASMAEGQTVLENPAQEPEIVDLANFLNVMGAKVRGAGTNVIK
                     IEGVKKLTGHNYTIIPDRIEAGTYMVAAAMTQGDVYIENAISEHLKPVIAKLKEAGVT
                     IEEAVEGIRVTCDRRPKAVDIKTMPYPGFPTDMQAQFMALLAVSDGAGLVTETVFENR
                     FMHVDELKRMGASIKIDGRTSIVEGVDHLTGCQVKATDLRAGAAMVLAGLVSEGETQV
                     GYIHHIDRGYDKLVEKLVGLGADIRRTDD"
     misc_feature    256917..258128
                     /locus_tag="Selsp_0226"
                     /note="EPSP synthase (3-phosphoshikimate
                     1-carboxyvinyltransferase); Region: EPSP_synthase;
                     pfam00275"
                     /db_xref="CDD:249736"
     misc_feature    256935..258137
                     /locus_tag="Selsp_0226"
                     /note="UDP-N-acetylglucosamine enolpyruvyl transferase
                     catalyzes enolpyruvyl transfer as part of the first step
                     in the biosynthesis of peptidoglycan, a component of the
                     bacterial cell wall. The reaction is phosphoenolpyruvate +
                     UDP-N-acetyl-D-glucosamine =...; Region: UdpNAET; cd01555"
                     /db_xref="CDD:238796"
     misc_feature    order(256953..256964,257595..257606)
                     /locus_tag="Selsp_0226"
                     /note="hinge; other site"
                     /db_xref="CDD:238796"
     misc_feature    order(256968..256970,257184..257186,257196..257198,
                     257271..257288,257391..257393,257400..257405,
                     257823..257825)
                     /locus_tag="Selsp_0226"
                     /note="active site"
                     /db_xref="CDD:238796"
     gene            258253..258327
                     /locus_tag="Selsp_R0009"
                     /db_xref="GeneID:10496435"
     tRNA            258253..258327
                     /locus_tag="Selsp_R0009"
                     /product="tRNA-Arg"
                     /note="IMG reference gene:2504585684"
                     /db_xref="GeneID:10496435"
     gene            258396..258965
                     /locus_tag="Selsp_0227"
                     /db_xref="GeneID:10496436"
     CDS             258396..258965
                     /locus_tag="Selsp_0227"
                     /EC_number="3.5.4.16"
                     /note="COGs: COG0302 GTP cyclohydrolase I;
                     InterPro IPR020602;
                     KEGG: vpr:Vpar_0493 GTP cyclohydrolase I;
                     PFAM: GTP cyclohydrolase I/Nitrile oxidoreductase;
                     PRIAM: GTP cyclohydrolase I;
                     SPTR: GTP cyclohydrolase 1;
                     IMG reference gene:2504585685;
                     PFAM: GTP cyclohydrolase I;
                     TIGRFAM: GTP cyclohydrolase I"
                     /codon_start=1
                     /transl_table=11
                     /product="GTP cyclohydrolase I"
                     /protein_id="YP_004412664.1"
                     /db_xref="GI:330838084"
                     /db_xref="InterPro:IPR020602"
                     /db_xref="GeneID:10496436"
                     /translation="MNEKASAAMRRFLEAMGLDLAACGMEKTPERVTEMFELLFSGCG
                     EDASSAWGELFETKARGLTAVQHIPFYSLCEHHLVPFFGEVHIAYLPKDGRIAGFSRF
                     VHVVNLLARRPQLQERFTREIADAVLDGLSAEGVLVIVEARQLCMMMRGELAPGTRTL
                     TSETGGTITADAALGKEAWDLLMRGAKEG"
     misc_feature    258402..258947
                     /locus_tag="Selsp_0227"
                     /note="GTP cyclohydrolase I; Provisional; Region: folE;
                     PRK09347"
                     /db_xref="CDD:236472"
     misc_feature    order(258636..258638,258642..258644,258813..258815,
                     258882..258884)
                     /locus_tag="Selsp_0227"
                     /note="active site"
                     /db_xref="CDD:238351"
     gene            258971..259840
                     /locus_tag="Selsp_0228"
                     /db_xref="GeneID:10496437"
     CDS             258971..259840
                     /locus_tag="Selsp_0228"
                     /EC_number="2.5.1.15"
                     /note="COGs: COG0294 Dihydropteroate synthase;
                     InterPro IPR006390:IPR000489;
                     KEGG: tjr:TherJR_0210 dihydropteroate synthase;
                     PFAM: Pterin-binding;
                     PRIAM: Dihydropteroate synthase;
                     SPTR: Dihydropteroate synthase;
                     TIGRFAM: Dihydropteroate synthase;
                     IMG reference gene:2504585686;
                     PFAM: Pterin binding enzyme;
                     TIGRFAM: dihydropteroate synthase"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydropteroate synthase"
                     /protein_id="YP_004412665.1"
                     /db_xref="GI:330838085"
                     /db_xref="InterPro:IPR000489"
                     /db_xref="InterPro:IPR006390"
                     /db_xref="InterPro:IPR011005"
                     /db_xref="GeneID:10496437"
                     /translation="MKAKRHYRLPSGKELTVGEGTLVMGILNVTPDSFSDGGKWNTLD
                     KALDHALSMVENGAAIIDVGAESSRPGFVPVSAAEEIERLAPFLEHIAPKIPVPISID
                     TFKAETARAALRLGADILNDIWGLQYAAEERGAMARVAAEYHAPVVVMHNQTGTTYRT
                     DVIEAMQDFFRESCAIAEEAGVAKERLIFDPGIGFGKTPETNIEVLHRLHELMKLDGE
                     AYPLLLGASRKSFIGYALDLPVEERLEATGAATVLGVAAGASIVRVHDVKEIVRMCRM
                     SDVILEGGKHGQD"
     misc_feature    259019..259837
                     /locus_tag="Selsp_0228"
                     /note="Dihydropteroate synthase and related enzymes
                     [Coenzyme metabolism]; Region: FolP; COG0294"
                     /db_xref="CDD:223371"
     misc_feature    259031..259804
                     /locus_tag="Selsp_0228"
                     /note="DHPS subgroup of Pterin binding enzymes. DHPS
                     (dihydropteroate synthase), a functional homodimer,
                     catalyzes the condensation of p-aminobenzoic acid (pABA)
                     in the de novo biosynthesis of folate, which is an
                     essential cofactor in both nucleic acid and...; Region:
                     DHPS; cd00739"
                     /db_xref="CDD:238380"
     misc_feature    order(259052..259054,259274..259276,259331..259333,
                     259337..259339,259418..259420,259538..259540,
                     259643..259645,259655..259657,259757..259759,
                     259763..259765)
                     /locus_tag="Selsp_0228"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238380"
     misc_feature    order(259577..259579,259589..259594,259715..259717,
                     259727..259729,259739..259741,259784..259789)
                     /locus_tag="Selsp_0228"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238380"
     misc_feature    259649..259657
                     /locus_tag="Selsp_0228"
                     /note="inhibitor binding site; inhibition site"
                     /db_xref="CDD:238380"
     gene            259827..260189
                     /locus_tag="Selsp_0229"
                     /db_xref="GeneID:10496438"
     CDS             259827..260189
                     /locus_tag="Selsp_0229"
                     /EC_number="4.1.2.25"
                     /note="COGs: COG1539 Dihydroneopterin aldolase;
                     InterPro IPR006156:IPR006157;
                     KEGG: krh:KRH_19250 dihydroneopterin aldolase;
                     PFAM: Dihydroneopterin aldolase;
                     PRIAM: Dihydroneopterin aldolase;
                     SMART: Dihydroneopterin aldolase;
                     SPTR: Dihydroneopterin aldolase;
                     TIGRFAM: Dihydroneopterin aldolase subgroup;
                     Dihydroneopterin aldolase;
                     IMG reference gene:2504585687;
                     PFAM: Dihydroneopterin aldolase;
                     TIGRFAM: dihydroneopterin aldolase; FolB domain"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroneopterin aldolase"
                     /protein_id="YP_004412666.1"
                     /db_xref="GI:330838086"
                     /db_xref="InterPro:IPR006156"
                     /db_xref="InterPro:IPR006157"
                     /db_xref="GeneID:10496438"
                     /translation="MDRIELSGMEFFGYHGCFAEERQTGQNFIVDAVLCLDLAEAGRT
                     DDLCRSVNYAEVFEDVRTIVEGEAKNLIEAVAEEIAAQLLKKYAALTRVEIAVHKPQA
                     PLAGTFRDVCARIERSRA"
     misc_feature    259827..260180
                     /locus_tag="Selsp_0229"
                     /note="Dihydroneopterin aldolase (DHNA) and
                     7,8-dihydroneopterin triphosphate epimerase domain
                     (DHNTPE); these enzymes have been designated folB and
                     folX, respectively. Folate derivatives are essential
                     cofactors in the biosynthesis of purines, pyrimidines,
                     and...; Region: DHNA_DHNTPE; cd00534"
                     /db_xref="CDD:238298"
     misc_feature    order(259830..259862,259878..259904,260127..260132,
                     260145..260171)
                     /locus_tag="Selsp_0229"
                     /note="homooctamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238298"
     misc_feature    order(259872..259880,259887..259889,260034..260045,
                     260121..260123,260163..260165)
                     /locus_tag="Selsp_0229"
                     /note="active site"
                     /db_xref="CDD:238298"
     gene            260186..260779
                     /locus_tag="Selsp_0230"
                     /db_xref="GeneID:10496439"
     CDS             260186..260779
                     /locus_tag="Selsp_0230"
                     /EC_number="2.7.6.3"
                     /note="COGs: COG0801 7
                     8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
                     InterPro IPR000550;
                     KEGG: sga:GALLO_1229
                     7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase;
                     PFAM: 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase,
                     HPPK;
                     PRIAM:2-amino-4-hydroxy-6-hydroxymethyldihydropteri
                     dinediphosphokinase;
                     SPTR:2-amino-4-hydroxy-6-hydroxymethyldihydropterid
                     inediphosphokinase;
                     TIGRFAM:
                     7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK;
                     IMG reference gene:2504585688;
                     PFAM: 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK);
                     TIGRFAM: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
                     pyrophosphokinase"
                     /codon_start=1
                     /transl_table=11
                     /product="2-amino-4-hydroxy-6-
                     hydroxymethyldihydropteridine pyrophosphokinase"
                     /protein_id="YP_004412667.1"
                     /db_xref="GI:330838087"
                     /db_xref="InterPro:IPR000550"
                     /db_xref="GeneID:10496439"
                     /translation="MNGEEARAVEGASVHPAERGLAHDIAGRAERRYRIYLGLGANLG
                     DRRASLRRALRLLARLEDTQLLRVSSFYETPPWGNEKQPPFLNACAALETRLSPLVFL
                     RRAQRIERALGRVRKEHWGPRTIDIDLLFAEGFESAAPELRLPHPYLHERAFVLLPLA
                     EIAPGLIVRGRKIDEWLADLSETAACRRCGIYRPMKK"
     misc_feature    260288..260671
                     /locus_tag="Selsp_0230"
                     /note="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
                     (HPPK). Folate derivatives are essential cofactors in the
                     biosynthesis of purines, pyrimidines, and amino acids as
                     well as formyl-tRNA. Mammalian cells are able to utilize
                     pre-formed folates after...; Region: HPPK; cd00483"
                     /db_xref="CDD:238269"
     misc_feature    order(260303..260305,260405..260410,260414..260416,
                     260438..260440,260444..260446,260489..260491,
                     260501..260503,260510..260512,260525..260527,
                     260531..260533,260543..260545,260552..260554,
                     260561..260563,260567..260572,260612..260614,
                     260621..260626,260639..260641,260645..260647)
                     /locus_tag="Selsp_0230"
                     /note="catalytic center binding site [active]"
                     /db_xref="CDD:238269"
     misc_feature    order(260489..260491,260501..260503,260510..260512,
                     260525..260527,260531..260533,260552..260554,
                     260567..260572,260612..260614,260621..260626,
                     260639..260641)
                     /locus_tag="Selsp_0230"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238269"
     gene            260929..262944
                     /locus_tag="Selsp_0231"
                     /db_xref="GeneID:10496440"
     CDS             260929..262944
                     /locus_tag="Selsp_0231"
                     /note="COGs: COG2200 FOG: EAL domain;
                     InterPro IPR000160:IPR001633;
                     KEGG: bpb:bpr_I1677 GGDEF/EAL domain-containing protein;
                     PFAM: Diguanylate phosphodiesterase, EAL domain;
                     Diguanylate cyclase, predicted;
                     SMART: Diguanylate phosphodiesterase, EAL domain;
                     SPTR: Putative sensory box sensor/GGDEF/EAL domain
                     protein;
                     TIGRFAM: Diguanylate cyclase, predicted;
                     IMG reference gene:2504585689;
                     PFAM: EAL domain; GGDEF domain;
                     TIGRFAM: diguanylate cyclase (GGDEF) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="diguanylate cyclase/phosphodiesterase"
                     /protein_id="YP_004412668.1"
                     /db_xref="GI:330838088"
                     /db_xref="InterPro:IPR000160"
                     /db_xref="InterPro:IPR001054"
                     /db_xref="InterPro:IPR001633"
                     /db_xref="GeneID:10496440"
                     /translation="MARFSMQEARQLEQNLAHIYDFARFVDAKACELLHFEADGTVRR
                     EGRCFTTWGRSRRCRHCTSFCAAKSQSNFEKDEISDDKVYHVLSAPVEIEMPDKSILH
                     CAMELVTNYPRNADARAMCDREVLQLLSRAKDTAHAGVLCFNVEDSCIYANLEAYRAF
                     QVPPGELEALRTFFMTWLKDESWDSPWESAAAWEQEFFLEGERFVYRVSMAKLFDADG
                     HYKGYYYTIRDRQGAMEEQSDTSWSRDKLTGLYDREGFYDAVREELDYGIKGERCIIC
                     SNIKDFKLVNELLGEEKGNEILKSLAEFFSDLAMDSGAAARLHGDHFAAYVDRARFTE
                     KDLLDGLEHLGRAFDCNSFKLNIHLGIYKIQETQMPVSVMCDRAHLALSLVRDENGNK
                     VAFYDDALMERTLREKEILGSFEEGLAERQLAVYLQPQVSTEGDLLGAEALVRWNHPE
                     KGFLAPGQFIGILENAGLIHRLDQYVWEEAAAILKRWQGTEKEGLTISVNISVNDMLH
                     LDIFQTMTDIVKRYGIDAKQLKLEITETALMGDIEKYRKLISSLQESGFEVEIDDFGS
                     GYSSLSMLKDIEADILKIDMGFLRQTGNPKRSSVILNAVIAMAKWLGMRVITEGVETK
                     EQVEHLRSLGCDMFQGYFFAKPMPVEEFEAKYFKEASNVFALSEAGR"
     misc_feature    261658..262110
                     /locus_tag="Selsp_0231"
                     /note="Class III nucleotidyl cyclases; Region:
                     Nucleotidyl_cyc_III; cl11967"
                     /db_xref="CDD:264492"
     misc_feature    order(261760..261777,261889..261891,262063..262065)
                     /locus_tag="Selsp_0231"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143637"
     misc_feature    order(261760..261762,261889..261891)
                     /locus_tag="Selsp_0231"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143637"
     misc_feature    262162..262881
                     /locus_tag="Selsp_0231"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            263017..263886
                     /locus_tag="Selsp_0232"
                     /db_xref="GeneID:10496441"
     CDS             263017..263886
                     /locus_tag="Selsp_0232"
                     /note="KEGG: vcj:VCD_000991 hypothetical protein;
                     SPTR: Procyclic form-specific polypeptide A-beta;
                     IMG reference gene:2504585690"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412669.1"
                     /db_xref="GI:330838089"
                     /db_xref="GeneID:10496441"
                     /translation="MKRGWMKRAGQRAFALGACAFGGWSTQAFAARIDPQELEQLRGT
                     VGMLLEDVEEFYHVTLLIESFMLVMLLALIVVGLVGYIKLRKEVRELRRLVCGEDDFA
                     AETPEDVDSPFEPMPSFEPEPEPEPEPEPEPEPEPEPEPEPESPPIVRFLEAYNEVND
                     IEDPALQKARFASLLAEFSGKRFTCTNPEARKTNPNAPPTFETRDEGDFWAVEKGDGS
                     DDYYVIPDPMFPYSEERHRFCGMKEAFASNYQEGKTYTHMEIEAPARFSLMGSLWAPQ
                     RPGKIVLSGEQDA"
     gene            complement(264110..265840)
                     /locus_tag="Selsp_0233"
                     /db_xref="GeneID:10496442"
     CDS             complement(264110..265840)
                     /locus_tag="Selsp_0233"
                     /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
                     InterPro IPR003660:IPR004089;
                     KEGG: gmc:GY4MC1_2562 methyl-accepting chemotaxis sensory
                     transducer;
                     PFAM: Chemotaxis methyl-accepting receptor, signalling;
                     HAMP linker domain;
                     SMART: Chemotaxis methyl-accepting receptor, signalling;
                     HAMP linker domain;
                     SPTR: TlpA protein;
                     IMG reference gene:2504585691;
                     PFAM: HAMP domain; Methyl-accepting chemotaxis protein
                     (MCP) signaling domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_004412670.1"
                     /db_xref="GI:330838090"
                     /db_xref="InterPro:IPR003660"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR004090"
                     /db_xref="GeneID:10496442"
                     /translation="MKNMTVANKILFSFSILLIAFIAFGVFAYHSVGELDDLNTGINQ
                     RTTLVATSNRVAQAMQKTRLYVFYQVVSVDPAKKHDFAQKVQDSRQEVEDAFNALREA
                     KKNTDFGSPDITKQALSELDAEQELWESYKRLSQAGDAMKESNNREEAEAAILSPEIV
                     EAFDAAVAGINQDAQNCIKDAAAQKERSQAKEAQIAVITIVSLLLVIALTLAVLYWLR
                     REINNAVQGFLQAVRRAAGGDLSVHAPVENQDEFGEMATAFNGMIDNMRSMTKKIQDT
                     AAFVSDTSEQLTANANQSAEATQSVAQSITEVAESAAVQMDSLGETKHEIDALSDGIS
                     QAVSRIATIRKNIEDTVERANEGNELVKSTVEQMNTISETVDQSAQIVEKLGQRSQEI
                     GEIISTISGIAEQTNLLALNAAIEAARAGENGRGFAVVAEEVRKLAEESQQAAQQIGD
                     LISSIQTETEQAVSAMKDGREQAEKGLENVSSTGHGFSRILELIRICSDDSAQITDTM
                     QILDGRIHTIVNLSENVNNSAKRASDASQNVSAATEEQAAGMEEIAASSRGLADSAKN
                     LKEESVKFKV"
     misc_feature    complement(265271..265834)
                     /locus_tag="Selsp_0233"
                     /note="ligand binding domain of Tar- and Tsr-related
                     chemoreceptors; Region: Tar_Tsr_LBD; cl00144"
                     /db_xref="CDD:260214"
     misc_feature    complement(264113..265366)
                     /locus_tag="Selsp_0233"
                     /note="Methyl-accepting chemotaxis protein [Cell motility
                     and secretion / Signal transduction mechanisms]; Region:
                     Tar; COG0840"
                     /db_xref="CDD:223910"
     misc_feature    complement(265040..265153)
                     /locus_tag="Selsp_0233"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    complement(order(265043..265048,265055..265060,
                     265064..265069,265076..265081,265085..265090,
                     265136..265138,265142..265147))
                     /locus_tag="Selsp_0233"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    complement(264173..264862)
                     /locus_tag="Selsp_0233"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cd11386"
                     /db_xref="CDD:206779"
     misc_feature    complement(order(264173..264175,264182..264187,
                     264194..264196,264203..264208,264212..264217,
                     264224..264229,264233..264238,264245..264247,
                     264254..264259,264371..264373,264380..264385,
                     264392..264397,264401..264406,264413..264415,
                     264422..264427,264434..264436,264443..264448,
                     264485..264490,264497..264502,264506..264511,
                     264518..264523,264530..264532,264539..264544,
                     264551..264553,264560..264562,264572..264574,
                     264593..264595,264602..264604,264614..264616,
                     264623..264628,264635..264637,264644..264646,
                     264653..264658,264665..264670,264677..264679,
                     264686..264691,264695..264697,264707..264712,
                     264716..264721,264728..264730,264737..264742,
                     264749..264754,264761..264763,264770..264775,
                     264782..264784,264791..264796,264800..264805,
                     264812..264814,264821..264826,264833..264838))
                     /locus_tag="Selsp_0233"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    complement(264527..264628)
                     /locus_tag="Selsp_0233"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            complement(266068..266955)
                     /locus_tag="Selsp_0234"
                     /db_xref="GeneID:10496443"
     CDS             complement(266068..266955)
                     /locus_tag="Selsp_0234"
                     /note="COGs: COG0489 ATPase involved in chromosome
                     partitioning;
                     InterPro IPR005129:IPR019591;
                     KEGG: dhd:Dhaf_1985 nucleotide-binding protein;
                     PFAM: ATPase-like, ParA/MinD; ArgK protein;
                     SPTR: Nucleotide-binding protein;
                     IMG reference gene:2504585692;
                     PFAM: ParA/MinD ATPase like; ArgK protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase-like, ParA/MinD"
                     /protein_id="YP_004412671.1"
                     /db_xref="GI:330838091"
                     /db_xref="InterPro:IPR005129"
                     /db_xref="InterPro:IPR019591"
                     /db_xref="GeneID:10496443"
                     /translation="MSENCSSGCSSCSSAGGCGGAQQEPQSLLTPPNEHSSVKRVIAV
                     MSGKGGVGKSLVTSLLATAMARRGHRVGVLDADITGPSIPKVFGVKGEVEKASADAAG
                     IRPLKSAGGIDIMSINLLLKDESDPVVWRGPIVAGVVQQFWQDVVWENEDYLFVDMPP
                     GTGDVPLTVLQSLPVDGIIVVTSPQELVSMIVEKAVKMAGLMNAPILGIIENMAYFKC
                     PNCSAEHKIFGDSHIEEIARDYYLPLLARLPIEPKLAALCDAGKIESFEGDWVDAAAL
                     LLEELPEHDAAEVDDFKES"
     misc_feature    complement(266200..266835)
                     /locus_tag="Selsp_0234"
                     /note="MRP (Multiple Resistance and pH adaptation) is a
                     homologue of the Fer4_NifH superfamily. Like the other
                     members of the superfamily, MRP contains a ATP-binding
                     domain at the N-termini. It is found in bacteria as a
                     membrane-spanning protein and functions...; Region:
                     MRP-like; cd02037"
                     /db_xref="CDD:238994"
     misc_feature    complement(266197..266832)
                     /locus_tag="Selsp_0234"
                     /note="CobQ/CobB/MinD/ParA nucleotide binding domain;
                     Region: CbiA; pfam01656"
                     /db_xref="CDD:250775"
     misc_feature    complement(266794..266817)
                     /locus_tag="Selsp_0234"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238994"
     gene            complement(267067..267519)
                     /locus_tag="Selsp_0235"
                     /db_xref="GeneID:10496444"
     CDS             complement(267067..267519)
                     /locus_tag="Selsp_0235"
                     /note="COGs: COG1846 Transcriptional regulators;
                     InterPro IPR000835;
                     KEGG: cbt:CLH_3316 transcriptional regulator, MarR family;
                     PFAM: HTH transcriptional regulator, MarR;
                     SMART: HTH transcriptional regulator, MarR;
                     SPTR: Transcriptional regulator, MarR family;
                     IMG reference gene:2504585693;
                     PFAM: MarR family"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, MarR family"
                     /protein_id="YP_004412672.1"
                     /db_xref="GI:330838092"
                     /db_xref="InterPro:IPR000835"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:10496444"
                     /translation="MAKKEFDPLLLENQFCFPLYATGRKIVAAYNPFLKKIGLTYAQY
                     VTMMVLWEEHTVTMHDLGKRLYLDSGTLTPVLKKLESMGYLKRRRKADDERVVVVEIT
                     KEGEALREEAEKIPYAMGCLVNKKGTLFTLEEAEALKEQLYRILRALE"
     misc_feature    complement(267070..267423)
                     /locus_tag="Selsp_0235"
                     /note="Transcriptional regulators [Transcription]; Region:
                     MarR; COG1846"
                     /db_xref="CDD:224759"
     misc_feature    complement(267172..267423)
                     /locus_tag="Selsp_0235"
                     /note="helix_turn_helix multiple antibiotic resistance
                     protein; Region: HTH_MARR; smart00347"
                     /db_xref="CDD:197670"
     gene            268139..269095
                     /locus_tag="Selsp_0236"
                     /db_xref="GeneID:10496445"
     CDS             268139..269095
                     /locus_tag="Selsp_0236"
                     /note="COGs: COG0803 ABC-type metal ion transport system
                     periplasmic component/surface adhesin;
                     InterPro IPR006127;
                     KEGG: apr:Apre_0701 periplasmic solute binding protein;
                     PFAM: ABC transporter metal-binding lipoprotein;
                     SPTR: Zinc ABC transporter, periplasmic zinc-binding
                     protein;
                     IMG reference gene:2504585694;
                     PFAM: Periplasmic solute binding protein family"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type metal ion transporter, periplasmic
                     subunit"
                     /protein_id="YP_004412673.1"
                     /db_xref="GI:330838093"
                     /db_xref="InterPro:IPR006127"
                     /db_xref="InterPro:IPR006128"
                     /db_xref="InterPro:IPR006129"
                     /db_xref="GeneID:10496445"
                     /translation="MNFLKRMLRGNGKGLFLLALCLAAALLTAGCGGAAGDAPSGKKK
                     VTVTTSFLADMTKELAGDYVDIDLVIPAGEDPHLYVAQPADLKKLKDADLVLYHGLHF
                     EGKMVEILEKRGTAVTADFPADAVLRMEEDGESVVDPHFWFSIALYKKATEKAADSLS
                     KLVPEHEKEIRANSAAYLAKLDALDAEVKEKIASIPAGKRNLVTPHDAFNYFSKSYGM
                     TVVAPQGVSTNSEVANADIEKTADFIVEHKVKAVFAESTTNPERMKKLQEIVRSKGFD
                     VEIVGGEGNELFSDSLAPAGQKGDTFIDMYRFDVDLIVSHLK"
     misc_feature    268256..269092
                     /locus_tag="Selsp_0236"
                     /note="ABC-type metal ion transport system, periplasmic
                     component/surface adhesin [Inorganic ion transport and
                     metabolism]; Region: LraI; COG0803"
                     /db_xref="CDD:223874"
     misc_feature    268262..269092
                     /locus_tag="Selsp_0236"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    order(268457..268462,268469..268471,268607..268609)
                     /locus_tag="Selsp_0236"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            269188..269910
                     /locus_tag="Selsp_0237"
                     /db_xref="GeneID:10496446"
     CDS             269188..269910
                     /locus_tag="Selsp_0237"
                     /EC_number="3.6.3.28"
                     /note="COGs: COG1121 ABC-type Mn/Zn transport systems
                     ATPase component;
                     InterPro IPR003593:IPR003439;
                     KEGG: cag:Cagg_3554 ABC transporter-like protein;
                     PFAM: ABC transporter-like;
                     PRIAM: Phosphonate-transporting ATPase;
                     SMART: ATPase, AAA+ type, core;
                     SPTR: Iron chelate ABC transporter, ATP-binding protein;
                     IMG reference gene:2504585695;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphonate-transporting ATPase"
                     /protein_id="YP_004412674.1"
                     /db_xref="GI:330838094"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:10496446"
                     /translation="MGEKMLLHVEDVTMAYRESAVLWDIDLDVPTGVRCAIVGPNGAG
                     KSTLLKGVLGLEKPVAGYVRLWGKTIDEVRERIAYVPQRGAVNWDFPTTVFDVVLMGR
                     YVHIGLMRRPGREDRERARAALAEMQLEKLAERQISELSGGQKQRVFIARALAQESDL
                     YIMDEPLAGVDETTERIVMDKFVALQKARKTVIAVHHDLSTLDMYFDYLVVLNRTIKA
                     SGYLKDMDKEAALALAFRPKER"
     misc_feature    269200..269907
                     /locus_tag="Selsp_0237"
                     /note="ABC-type Mn/Zn transport systems, ATPase component
                     [Inorganic ion transport and metabolism]; Region: ZnuC;
                     COG1121"
                     /db_xref="CDD:224046"
     misc_feature    269209..269847
                     /locus_tag="Selsp_0237"
                     /note="ATP-binding cassette domain of the metal-type
                     transporters; Region: ABC_Metallic_Cations; cd03235"
                     /db_xref="CDD:213202"
     gene            269913..270782
                     /locus_tag="Selsp_0238"
                     /db_xref="GeneID:10496447"
     CDS             269913..270782
                     /locus_tag="Selsp_0238"
                     /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
                     permease components;
                     InterPro IPR001626;
                     KEGG: apr:Apre_0703 ABC-3 protein;
                     PFAM: ABC-3;
                     SPTR: Manganese transport system membrane protein MntC;
                     IMG reference gene:2504585696;
                     PFAM: ABC 3 transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, integral membrane subunit"
                     /protein_id="YP_004412675.1"
                     /db_xref="GI:330838095"
                     /db_xref="InterPro:IPR001626"
                     /db_xref="GeneID:10496447"
                     /translation="MDILMNYAFQIIALGTALLAAVAAPVGALSVYKGQSLIGDAIGH
                     ATFPGVVLAFMAFSTRSPAVLLVGAMAAAAVTFFAIQAAHENTRVGLNANLAVFLSGF
                     FGLGMVLKSFIQGNEAYRGASQAGLETYIFGQAAYMLEADVKLIAFVAALCAALLFAF
                     YKELKVFVFDAEYARAVGLPVRLLQVLLPFLTIAVIGIGIKAVGAILISSFLIIPCVA
                     ASQWSDDFAHVLFLSAVFGVVAALAGTYVSTLEQGMSTGPSIILAASAIAFLSMFFGK
                     RGAFRKRGRREEA"
     misc_feature    269985..270737
                     /locus_tag="Selsp_0238"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cl00462"
                     /db_xref="CDD:260438"
     misc_feature    order(269991..269993,270003..270011,270384..270389,
                     270393..270401,270405..270410,270414..270431,
                     270435..270443,270567..270569,270588..270590)
                     /locus_tag="Selsp_0238"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(270006..270008,270012..270014,270027..270029,
                     270183..270185,270189..270194,270201..270206,
                     270213..270218,270225..270227,270234..270239,
                     270243..270245,270294..270299,270306..270308,
                     270534..270536,270684..270686,270693..270698,
                     270705..270707,270714..270719,270726..270728)
                     /locus_tag="Selsp_0238"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(270243..270245,270336..270338,270510..270512,
                     270522..270524,270657..270659,270675..270677)
                     /locus_tag="Selsp_0238"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            270779..271879
                     /locus_tag="Selsp_0239"
                     /db_xref="GeneID:10496448"
     CDS             270779..271879
                     /locus_tag="Selsp_0239"
                     /note="COGs: COG1108 ABC-type Mn2+/Zn2+ transport systems
                     permease components;
                     InterPro IPR001626;
                     KEGG: apr:Apre_0704 ABC-3 protein;
                     PFAM: ABC-3;
                     SPTR: Zinc ABC transporter, permease protein;
                     IMG reference gene:2504585697;
                     PFAM: ABC 3 transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, integral membrane subunit"
                     /protein_id="YP_004412676.1"
                     /db_xref="GI:330838096"
                     /db_xref="InterPro:IPR001626"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:10496448"
                     /translation="MTDSFVVLALTAAACALPGVFLLLRNLSMMADAISHTVLLGIVL
                     AFFLVRDLSSPWLLFGAALMGVVTVLLVELLGKTKTTKSDDAIGIVFPVLFSLAVILI
                     SKYAGNVHLDTDMVLMGEVVYAGLDTVTLFGHEVASSAVKMGAIFLVNAAFITLFYKE
                     LKLSTFDEENARLIGMATGAIFYALMTLISLTTVAAFDAVGSILVISFFIAPAAAALL
                     FTKRLHHALFLAVSFGVLGSAIGYGLALHFNASMAGMCALVNMLGYVVAVFVYPKGVI
                     TRRLKRMRRKARLKEELLIIHLGTHTAENLYSEENAVRDIAEHLRWSEREMRRVSERL
                     KEAGIVRRSGGYYLLTDKGVERYRALCEEYVI"
     misc_feature    270833..271591
                     /locus_tag="Selsp_0239"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(270833..270835,270845..270853,271241..271246,
                     271250..271258,271262..271267,271271..271288,
                     271292..271300,271424..271426,271445..271447)
                     /locus_tag="Selsp_0239"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(270848..270850,270854..270856,270869..270871,
                     271025..271027,271031..271036,271043..271048,
                     271055..271060,271067..271069,271076..271081,
                     271085..271087,271118..271123,271130..271132,
                     271391..271393,271547..271549,271556..271561,
                     271574..271576,271583..271588)
                     /locus_tag="Selsp_0239"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(271085..271087,271160..271162,271367..271369,
                     271379..271381,271514..271516,271538..271540)
                     /locus_tag="Selsp_0239"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            271976..272698
                     /locus_tag="Selsp_0240"
                     /db_xref="GeneID:10496449"
     CDS             271976..272698
                     /locus_tag="Selsp_0240"
                     /note="InterPro IPR019613;
                     KEGG: vpr:Vpar_1323 hypothetical protein;
                     PFAM: Nickel transport complex, NikM subunit,
                     transmembrane;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585698;
                     PFAM: Nickel uptake substrate-specific transmembrane
                     region"
                     /codon_start=1
                     /transl_table=11
                     /product="Nickel transport complex protein, NikM subunit,
                     transmembrane"
                     /protein_id="YP_004412677.1"
                     /db_xref="GI:330838097"
                     /db_xref="InterPro:IPR019613"
                     /db_xref="GeneID:10496449"
                     /translation="MKKKLLAAALGAFVGLGMYAAPTDAHGVFYANRLDQKALVLGEG
                     PLDNAYDPACVQRIDAYDVNFEPTTVERVDAGNHVTIVPGDDLGVTATFFDYGYFAKT
                     TDGQVIPTRDYASVENLKAVTYARKYNVHYWNAAVKPGGLYNVPIQIVPAVNPLTLRR
                     GDALRLRIYKDGQPYANAPVIADVLGDLTTEANADANGYITVHVANNGLNVIGVEVGF
                     PTDDPIVTEKIFSSLSFIIPAE"
     misc_feature    <272240..272623
                     /locus_tag="Selsp_0240"
                     /note="Peptidase associated domain: C-terminal domain of
                     M14 N/E carboxypeptidase; putative folding, regulation, or
                     interaction domain; Region: Peptidase_M14NE-CP-C_like;
                     cl17499"
                     /db_xref="CDD:266731"
     gene            272999..273625
                     /locus_tag="Selsp_0241"
                     /db_xref="GeneID:10496450"
     CDS             272999..273625
                     /locus_tag="Selsp_0241"
                     /note="COGs: COG0811 Biopolymer transport protein;
                     InterPro IPR002898;
                     KEGG: vpr:Vpar_1341 MotA/TolQ/ExbB proton channel;
                     PFAM: MotA/TolQ/ExbB proton channel;
                     SPTR: MotA/TolQ/ExbB proton channel family domain protein;
                     IMG reference gene:2504585699;
                     PFAM: MotA/TolQ/ExbB proton channel family"
                     /codon_start=1
                     /transl_table=11
                     /product="MotA/TolQ/ExbB proton channel"
                     /protein_id="YP_004412678.1"
                     /db_xref="GI:330838098"
                     /db_xref="InterPro:IPR002898"
                     /db_xref="GeneID:10496450"
                     /translation="MENTWELFQKGGPVMYVLLACSIAVAVIAIERFRFYRQAGRGAS
                     DFVAKLPTFLKEHDLKQAAELCQTENTAPAYIAEIGVRAAAAGDDLTLALDTAYADMA
                     MRLRERLNYLSMIVTMAPLLGLLGTISGMIESFSIFSVRAGEPLAITGGIGEALIATA
                     TGLCVAIFSLIVHTYFVQKLDEMLATLDKAAAAVRNALKNTGEDGHAA"
     misc_feature    272999..273598
                     /locus_tag="Selsp_0241"
                     /note="Biopolymer transport proteins [Intracellular
                     trafficking and secretion]; Region: TolQ; COG0811"
                     /db_xref="CDD:223881"
     gene            273615..274028
                     /locus_tag="Selsp_0242"
                     /db_xref="GeneID:10496451"
     CDS             273615..274028
                     /locus_tag="Selsp_0242"
                     /note="COGs: COG0848 Biopolymer transport protein;
                     InterPro IPR003400;
                     KEGG: vpr:Vpar_1756 biopolymer transport protein
                     ExbD/TolR;
                     PFAM: Biopolymer transport protein ExbD/TolR;
                     SPTR: Iron-sulfur cluster-binding protein;
                     IMG reference gene:2504585700;
                     PFAM: Biopolymer transport protein ExbD/TolR"
                     /codon_start=1
                     /transl_table=11
                     /product="Biopolymer transport protein ExbD/TolR"
                     /protein_id="YP_004412679.1"
                     /db_xref="GI:330838099"
                     /db_xref="InterPro:IPR003400"
                     /db_xref="GeneID:10496451"
                     /translation="MRRDFRITKEPLVMIIPMIDIMLFLLVFFMISTIYMVQTNTVQV
                     ALPQAAAGKMETRPNIVPITVTEKGDVLYDKDELPNENLADKMKASLASDPDTVFVLR
                     GDKKTDYEAVVRVLDLLKRSGAKHVSIATETAGRQ"
     misc_feature    273657..274010
                     /locus_tag="Selsp_0242"
                     /note="Biopolymer transport protein [Intracellular
                     trafficking and secretion]; Region: ExbD; COG0848"
                     /db_xref="CDD:223917"
     gene            274030..274785
                     /locus_tag="Selsp_0243"
                     /db_xref="GeneID:10496452"
     CDS             274030..274785
                     /locus_tag="Selsp_0243"
                     /note="InterPro IPR006260;
                     KEGG: mfa:Mfla_1560 TonB-like protein;
                     PFAM: TonB, C-terminal;
                     SPTR: Putative ferric siderophore transporter, periplasmic
                     energy transduction protein TonB;
                     IMG reference gene:2504585701;
                     PFAM: Gram-negative bacterial tonB protein;
                     TIGRFAM: TonB family C-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB domain protein"
                     /protein_id="YP_004412680.1"
                     /db_xref="GI:330838100"
                     /db_xref="InterPro:IPR006260"
                     /db_xref="GeneID:10496452"
                     /translation="MRFKSYWRTTVVAAIFLHFFVWLGLALALPLLDFEGDPLAVQEM
                     EVVDLPEEGSSGEMEEKKPDPPKPEPPEPPKPETPPVETPPEDVIPTETSPTEAAELD
                     EAVAELQKQEEEAKKSGEDGKALPPAPPSQAVGVLITAGNTPDTRGTDFRGTVGILVS
                     IDAQGHITGYRFTQTSGRRVVDQIVLNAVRNFKFEPALDTNGQPMKTMRLLRFPFDGS
                     GSHAYEDDENKRIRVNKEMFLRELHARGQAPPT"
     misc_feature    <274297..274620
                     /locus_tag="Selsp_0243"
                     /note="Periplasmic protein TonB, links inner and outer
                     membranes [Cell envelope biogenesis, outer membrane];
                     Region: TonB; COG0810"
                     /db_xref="CDD:223880"
     misc_feature    274486..274677
                     /locus_tag="Selsp_0243"
                     /note="Gram-negative bacterial TonB protein C-terminal;
                     Region: TonB_C; pfam03544"
                     /db_xref="CDD:252020"
     gene            274837..276018
                     /locus_tag="Selsp_0244"
                     /db_xref="GeneID:10496453"
     CDS             274837..276018
                     /locus_tag="Selsp_0244"
                     /note="COGs: COG0672 High-affinity Fe2+/Pb2+ permease;
                     InterPro IPR004923;
                     KEGG: wsu:WS1566 high-affinity Fe2+/Pb2+ permease;
                     PFAM: Iron permease FTR1;
                     SPTR: Putative membrane protein;
                     IMG reference gene:2504585702;
                     PFAM: Iron permease FTR1 family;
                     TIGRFAM: FTR1 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="iron permease FTR1"
                     /protein_id="YP_004412681.1"
                     /db_xref="GI:330838101"
                     /db_xref="InterPro:IPR004923"
                     /db_xref="GeneID:10496453"
                     /translation="MKKILFLCMVLVLFAVPRADAAPKWQEVADRIAQTVDQAVSVYE
                     TGDYEGARDLVNSSYYGIYEKEGLESVMRSSVSAKETSLTEYQFYKVKKSMKNGESVD
                     TVKQEAEKLKSMVNENVKALENAHGSSGWAAFLPAYLILLREGLEAILVLVAIIAYLK
                     RAEDEKHLGTVYNFSIAAVVASFISAYLFNTLLNNTTGGMSREVLEGATALFAVVVLL
                     LTSAWLGGKANKDNWKQYIDGLVKESITHGTARALGMAAFLAVYREGAEVILFYQALF
                     NNAAADVTMIWAGFGAGCVTLALIFYGMQHGILKIPLRPFFLFTSILMFLLAVTFVGG
                     GIEELQEGGVVGITRFEGWPTVDLLGIFPTAETLGAQLLVLLLGVGMVIYAKKRKPKT
                     A"
     misc_feature    274933..275937
                     /locus_tag="Selsp_0244"
                     /note="High-affinity Fe2+/Pb2+ permease [Inorganic ion
                     transport and metabolism]; Region: FTR1; COG0672"
                     /db_xref="CDD:223744"
     gene            276163..276732
                     /locus_tag="Selsp_0245"
                     /db_xref="GeneID:10496454"
     CDS             276163..276732
                     /locus_tag="Selsp_0245"
                     /note="COGs: COG3470 Uncharacterized protein probably
                     involved in high-affinity Fe2+ transport;
                     InterPro IPR018470;
                     KEGG: cko:CKO_02056 hypothetical protein;
                     PFAM: Ferrous iron transport protein, bacterial;
                     SPTR: Putative pathogen-specific surface antigen;
                     IMG reference gene:2504585703;
                     PFAM: Fe2+ transport protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ferrous iron transport protein"
                     /protein_id="YP_004412682.1"
                     /db_xref="GI:330838102"
                     /db_xref="InterPro:IPR018470"
                     /db_xref="GeneID:10496454"
                     /translation="MKMFKLKKLKSALAVCAVAASLFTFGGSASAAGFTEYPIGDEIE
                     NEANHFKVALVYFQPIEMLPAGMMLSPDKADMHIETDIHATEGNDTGFGVGEWIPYLT
                     IHYKFTKRETGESVEGVFMPMNADDGPHYGANVKMLGAGTYDMHFSIESPYRQNYGLH
                     VDEETGVKGRFWDEPVTMDWVFNYVPRRW"
     misc_feature    276256..276720
                     /locus_tag="Selsp_0245"
                     /note="Fe2+ transport protein; Region: Iron_transport;
                     pfam10634"
                     /db_xref="CDD:151151"
     gene            276854..278113
                     /locus_tag="Selsp_0246"
                     /db_xref="GeneID:10496455"
     CDS             276854..278113
                     /locus_tag="Selsp_0246"
                     /note="COGs: COG4393 membrane protein;
                     InterPro IPR018758;
                     KEGG: tde:TDE1512 hypothetical protein;
                     PFAM: Protein of unknown function DUF2318, membrane;
                     SPTR: Putative integral membrane protein;
                     IMG reference gene:2504585704;
                     PFAM: Predicted membrane protein (DUF2318)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412683.1"
                     /db_xref="GI:330838103"
                     /db_xref="InterPro:IPR018758"
                     /db_xref="GeneID:10496455"
                     /translation="MLQMFLQQFVPAMEQVLTLAVPLGILFAILRRLPLEKYRRNYNT
                     AIHWGFWLSVAIVAARVGTRNAVSREVAEAGAIAFAMIAEVVLVAMLARGAGQKEELS
                     RPLQVSACVIGVLLFFYHGMELWLIPVGTIISAAGDYMTQTVAVKLAGFAAGLFFGVV
                     SSFVAYKAAAALNPRRLFFVFVIQAGAMFIQQGIFLVQVLMARHILDSAALLSIMAPI
                     IDHSSWLIFIIFFALLFVPLTLFSQKKPARPAGTNPAEYRRMIMQAMHKRRWGTATVL
                     FLAGMVFLSSFGASYANRKEELVPAVPVTAVDGFVDVDLSVVNDGHLHRFVYQTASGQ
                     MVRYIVILKGGNSYGVGLDACEICGPTGYYEKDGQVICRLCDVMMNKATIGTKGGCNP
                     IPIEYSVADGKLRVPQDALDKARDVFR"
     misc_feature    <277439..278107
                     /locus_tag="Selsp_0246"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG4393"
                     /db_xref="CDD:226828"
     misc_feature    277805..278107
                     /locus_tag="Selsp_0246"
                     /note="Predicted membrane protein (DUF2318); Region:
                     DUF2318; pfam10080"
                     /db_xref="CDD:150722"
     gene            278133..279404
                     /locus_tag="Selsp_0247"
                     /db_xref="GeneID:10496456"
     CDS             278133..279404
                     /locus_tag="Selsp_0247"
                     /note="COGs: COG0577 ABC-type antimicrobial peptide
                     transport system permease component;
                     InterPro IPR003838;
                     KEGG: tde:TDE1514 permease domain protein;
                     PFAM: Domain of unknown function DUF214, ABC transporter
                     permease;
                     SPTR: Permease domain protein;
                     IMG reference gene:2504585705;
                     PFAM: Predicted permease"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412684.1"
                     /db_xref="GI:330838104"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="GeneID:10496456"
                     /translation="MFWQMVKGALIRQRKRFFLIALTAALGVSLAAAMLNVMFDIGEK
                     VNQELKAYGANITVTPKTASVLQDVYGLEGGRKEYLNEADAAKIKTIFWTNNIVAFAP
                     ELSGEIALADGRNVPLMGTWFDHELELPTGEKMQTGEKEMKSWWKIDGAWPTESPDEA
                     LAGAKLADALGLKPGDTVSYRTKDGAERTLKITGVVTGGGTEDDALTVNLALAQELLD
                     APGKIDKIEVSAVTTPENDLARKAAENPERLSQKEREIWYCTAYVSSIAFQIEEAIPG
                     SSAQPVRQIAESEGKILEKTQMLMLLITGLSLLSAALGVSNLVSANIMERSREFGLMK
                     ALGATDLSVVLMVLAEIFIAGALGGFFGYFGGLALAQAIGQTVFGSSIANNLVVIPIV
                     GGLMALMLLIGSLPAIRMLLSLQPASVLHGR"
     misc_feature    278157..278867
                     /locus_tag="Selsp_0247"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    278172..279401
                     /locus_tag="Selsp_0247"
                     /note="ABC-type antimicrobial peptide transport system,
                     permease component [Defense mechanisms]; Region: SalY;
                     COG0577"
                     /db_xref="CDD:223650"
     misc_feature    279033..279380
                     /locus_tag="Selsp_0247"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            279411..280565
                     /locus_tag="Selsp_0248"
                     /db_xref="GeneID:10496457"
     CDS             279411..280565
                     /locus_tag="Selsp_0248"
                     /note="COGs: COG4591 ABC-type transport system involved in
                     lipoprotein release permease component;
                     InterPro IPR003838;
                     KEGG: tde:TDE1515 permease domain protein;
                     PFAM: Domain of unknown function DUF214, ABC transporter
                     permease;
                     SPTR: Permease domain protein;
                     IMG reference gene:2504585706;
                     PFAM: Predicted permease"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412685.1"
                     /db_xref="GI:330838105"
                     /db_xref="InterPro:IPR003838"
                     /db_xref="GeneID:10496457"
                     /translation="MAGRIKILEMFLRMIVRALFRQKSRMFVALLAVAVGAAIISGMI
                     TVYREVPAQLGREFRAYGANVLLLPAGEAKTFDSAALQKAREALAGRDVVGLAPFLYE
                     RLEVNKQPVLTGGTDFEEIKKVSPYWMVKGEYPKAGEREILLGAEMASKIARDTDKLI
                     GQTVSVSAGEGKAMLSFTVSGIVSTGGKEEQFAFLNLDELQKIVEKPGAVGLAQLSVV
                     ADGDSLKSVEDAIRTANIGIEPQEVQQIAHSEFNVLKKLEVLILLVTIIVLILTLICV
                     TTTMTAVVTERRREIGLKKALGASNANIVMEFLGEGCVLGLVGGLLGSGFGYLFAQSV
                     SINVFSRGIAFAPGIAVLAVVLSVIVTGVASLIPVRIATSVDPAIVLRGE"
     misc_feature    279459..280112
                     /locus_tag="Selsp_0248"
                     /note="MacB-like periplasmic core domain; Region:
                     MacB_PCD; pfam12704"
                     /db_xref="CDD:257236"
     misc_feature    280194..280541
                     /locus_tag="Selsp_0248"
                     /note="FtsX-like permease family; Region: FtsX; pfam02687"
                     /db_xref="CDD:251477"
     gene            280575..281276
                     /locus_tag="Selsp_0249"
                     /db_xref="GeneID:10496458"
     CDS             280575..281276
                     /locus_tag="Selsp_0249"
                     /EC_number="3.6.3.28"
                     /note="COGs: COG1136 ABC-type antimicrobial peptide
                     transport system ATPase component;
                     InterPro IPR003593:IPR003439;
                     KEGG: fnu:FN1352 ABC transporter ATP-binding protein;
                     PFAM: ABC transporter-like;
                     PRIAM: Phosphonate-transporting ATPase;
                     SMART: ATPase, AAA+ type, core;
                     SPTR: Macrolide-specific ABC-type efflux carrier MacB;
                     IMG reference gene:2504585707;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphonate-transporting ATPase"
                     /protein_id="YP_004412686.1"
                     /db_xref="GI:330838106"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:10496458"
                     /translation="MSLLELKDVTMAYGGKVKALDNVNLKVEKGDWLAVMGPSGSGKT
                     TLMNIIGCMDHATSGTVLLDGIDITKVSDHELTLLRRDKIGIVFQQFHMIPYLTAIEN
                     IMAAQYYHSIPDKKEALEALDRVGLADRADHLPSQLSGGEQQRVCIARALINYPVLIL
                     ADEPTGNLDEVNQNLVMKIFRELHAEGHTILTVTHSAEVGAAAERCVIIEHGRMVEKS
                     AEEQAAAKLKEGAKQ"
     misc_feature    280581..281228
                     /locus_tag="Selsp_0249"
                     /note="ABC-type antimicrobial peptide transport system,
                     ATPase component [Defense mechanisms]; Region: SalX;
                     COG1136"
                     /db_xref="CDD:224059"
     misc_feature    280584..281213
                     /locus_tag="Selsp_0249"
                     /note="ATP-binding cassette domain of the transporters
                     involved in export of lipoprotein and macrolide, and cell
                     division protein; Region: ABC_MJ0796_LolCDE_FtsE; cd03255"
                     /db_xref="CDD:213222"
     misc_feature    280683..280706
                     /locus_tag="Selsp_0249"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    order(280692..280697,280701..280709,280839..280841,
                     281058..281063,281157..281159)
                     /locus_tag="Selsp_0249"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213222"
     misc_feature    280830..280841
                     /locus_tag="Selsp_0249"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213222"
     misc_feature    280986..281015
                     /locus_tag="Selsp_0249"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213222"
     misc_feature    281046..281063
                     /locus_tag="Selsp_0249"
                     /note="Walker B; other site"
                     /db_xref="CDD:213222"
     misc_feature    281070..281081
                     /locus_tag="Selsp_0249"
                     /note="D-loop; other site"
                     /db_xref="CDD:213222"
     misc_feature    281145..281165
                     /locus_tag="Selsp_0249"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213222"
     gene            281273..281776
                     /locus_tag="Selsp_0250"
                     /db_xref="GeneID:10496459"
     CDS             281273..281776
                     /locus_tag="Selsp_0250"
                     /note="COGs: COG4939 Major membrane immunogen
                     membrane-anchored lipoprotein;
                     InterPro IPR007329;
                     KEGG: fma:FMG_0930 putative lipoprotein precursor;
                     PFAM: FMN-binding;
                     SMART: FMN-binding;
                     SPTR: Lipoprotein;
                     IMG reference gene:2504585708;
                     PFAM: FMN-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-binding domain protein"
                     /protein_id="YP_004412687.1"
                     /db_xref="GI:330838107"
                     /db_xref="InterPro:IPR007329"
                     /db_xref="GeneID:10496459"
                     /translation="MNLGRKSLTLVLGVAFAASLFAGCGDDAAKNEPKDGGAQGVAVK
                     KIADIDLSQAKDGTYNAESSENSEYGHGKIAITIKDHKIESATYFGIDKDGTMKGEDY
                     GKKNGQVSDAQNYKKAQNAVKANAAYGAQLVERQQPGKVDAISGATISYEQFIEASTK
                     ALDEAKK"
     misc_feature    <281438..281773
                     /locus_tag="Selsp_0250"
                     /note="FMN-binding domain; Region: FMN_bind; cl01081"
                     /db_xref="CDD:260782"
     gene            281779..282876
                     /locus_tag="Selsp_0251"
                     /db_xref="GeneID:10496460"
     CDS             281779..282876
                     /locus_tag="Selsp_0251"
                     /note="COGs: COG1477 Membrane-associated lipoprotein
                     involved in thiamine biosynthesis;
                     InterPro IPR003374;
                     KEGG: ele:Elen_0693 ApbE family lipoprotein;
                     PFAM: Thiamine synthesis ApbE/UPF0280;
                     SPTR: Membrane-associated lipoprotein;
                     IMG reference gene:2504585709;
                     PFAM: ApbE family"
                     /codon_start=1
                     /transl_table=11
                     /product="ApbE family lipoprotein"
                     /protein_id="YP_004412688.1"
                     /db_xref="GI:330838108"
                     /db_xref="InterPro:IPR003374"
                     /db_xref="GeneID:10496460"
                     /translation="MIRLQNLAAQGAGHLALCLLLVFFTASLLAGCLPEQMNRMSSGD
                     ASRAPEEASEEFFAMDTKMTVKVYGEGAPEAAREAKERLQALDALWSVTREGSDVERL
                     NSGAGEAIALSPKTMRLLRMSEEVREETKGALDVTLAPLLQLWGFTGGVHRVPTAEEI
                     EAARALTGAGKLKLDEAAGMARLEKGSSVELGAVAKGYAGELVAAELKSRGVRSALLD
                     LGGNIETIGAREDGTPWRVGLRNPFGGALLGTVAVADAAVVTSAIDQRFFTDEAGNRY
                     WHILDPATGKPAASGLASATVVASSGGRADALSTALFVMGADRAAAFWRGRQDFEMVL
                     VGMDGHVQITPGLLDRFSAGEGLTGEVEVIR"
     misc_feature    281821..282834
                     /locus_tag="Selsp_0251"
                     /note="Membrane-associated lipoprotein involved in
                     thiamine biosynthesis [Coenzyme metabolism]; Region: ApbE;
                     COG1477"
                     /db_xref="CDD:224394"
     gene            282873..283292
                     /locus_tag="Selsp_0252"
                     /db_xref="GeneID:10496461"
     CDS             282873..283292
                     /locus_tag="Selsp_0252"
                     /note="COGs: COG5341 conserved hypothetical protein;
                     InterPro IPR010739;
                     KEGG: ele:Elen_0692 protein of unknown function DUF1312;
                     PFAM: Protein of unknown function DUF1312;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585710;
                     PFAM: Protein of unknown function (DUF1312)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412689.1"
                     /db_xref="GI:330838109"
                     /db_xref="InterPro:IPR010739"
                     /db_xref="GeneID:10496461"
                     /translation="MNGGKKARLYALFAALLLGAAGAWLAAAASRGDEAAQSGAVEVV
                     QDGAVIYHFTQEELQEERHIRVPYGEHENVIATGGGTIRIESADCPDQICVNTGELKG
                     DGAPIICLPHRLEIRWAKAGSAGEAAVEADAPDAVAR"
     misc_feature    282993..283223
                     /locus_tag="Selsp_0252"
                     /note="N-Utilization Substance G (NusG) N terminal (NGN)
                     insert and Lin0431 are part of DUF1312; Region: DUF1312;
                     cd09846"
                     /db_xref="CDD:197363"
     gene            283289..283954
                     /locus_tag="Selsp_0253"
                     /db_xref="GeneID:10496462"
     CDS             283289..283954
                     /locus_tag="Selsp_0253"
                     /note="COGs: COG4769 membrane protein;
                     InterPro IPR010898;
                     KEGG: cpe:CPE2104 hypothetical protein;
                     PFAM: Heptaprenyl diphosphate synthase component I;
                     SPTR: Putative membrane protein;
                     IMG reference gene:2504585711;
                     PFAM: Heptaprenyl diphosphate synthase component I"
                     /codon_start=1
                     /transl_table=11
                     /product="Heptaprenyl diphosphate synthase component I"
                     /protein_id="YP_004412690.1"
                     /db_xref="GI:330838110"
                     /db_xref="InterPro:IPR010898"
                     /db_xref="InterPro:IPR014535"
                     /db_xref="GeneID:10496462"
                     /translation="MRGARRERGVRQGASARTRICAEGAEEAGLAQQGAARLTLLSIC
                     LALSLMLFFIELRLPLVAAVPGFKLGLANIVTVAALRLFRAREALLLLVLRIVLGSVF
                     AGSLPALSFSLAGGLLALSVGVLLLRAVPRVSLALLGVVGALSHNVGQLLAAAFWLGT
                     LDVFYYAPVLFALALVTGAATGFLAQEVLRRMGKHGYVQPLDFIVFRPFLDFKNKKNS
                     QKL"
     misc_feature    283424..283852
                     /locus_tag="Selsp_0253"
                     /note="Heptaprenyl diphosphate synthase component I;
                     Region: Hpre_diP_synt_I; pfam07456"
                     /db_xref="CDD:254210"
     gene            284022..284675
                     /locus_tag="Selsp_0254"
                     /db_xref="GeneID:10496463"
     CDS             284022..284675
                     /locus_tag="Selsp_0254"
                     /note="InterPro IPR013096;
                     KEGG: ccu:Ccur_09790 cupin domain-containing protein;
                     PFAM: Cupin 2, conserved barrel;
                     SPTR: Cupin region protein;
                     IMG reference gene:2504585712;
                     PFAM: Cupin domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Cupin 2 conserved barrel domain protein"
                     /protein_id="YP_004412691.1"
                     /db_xref="GI:330838111"
                     /db_xref="InterPro:IPR011051"
                     /db_xref="InterPro:IPR013096"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="GeneID:10496463"
                     /translation="MKGQAGKVFSPAEEMAPVPGCTVSEAISAAGGNNVVWFSLAEAT
                     DISAESYERRRLWYVASGAMEAVEESGNTPLAAGDFFVVPVGTPVGVKTERGAVYLEI
                     SLQEGKTMNKAIEDKKVFQLAELLPCQEGKIVNMDLVQSPNLKFVLMSFGAGTGLDEH
                     AAPGEALVFALEGEAVIGYEGKEYTVHAGENFKFAKNGRHYVRAVKNFKMALMLELA"
     misc_feature    <284430..284663
                     /locus_tag="Selsp_0254"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            284876..286174
                     /locus_tag="Selsp_0255"
                     /db_xref="GeneID:10496464"
     CDS             284876..286174
                     /locus_tag="Selsp_0255"
                     /EC_number="4.2.1.11"
                     /note="COGs: COG0148 Enolase;
                     InterPro IPR020811:IPR000941:IPR020810;
                     KEGG: ere:EUBREC_2823 enolase;
                     PFAM: Enolase, C-terminal; Enolase, N-terminal;
                     PRIAM: Phosphopyruvate hydratase;
                     SPTR: Enolase;
                     TIGRFAM: Enolase;
                     IMG reference gene:2504585713;
                     PFAM: Enolase, N-terminal domain; Enolase, C-terminal TIM
                     barrel domain;
                     TIGRFAM: phosphopyruvate hydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="YP_004412692.1"
                     /db_xref="GI:330838112"
                     /db_xref="InterPro:IPR000941"
                     /db_xref="InterPro:IPR020809"
                     /db_xref="InterPro:IPR020810"
                     /db_xref="InterPro:IPR020811"
                     /db_xref="GeneID:10496464"
                     /translation="MRNSKIKCIHAREIVDSRSNPTVEVDVVLEDGSFGRAASPSGAS
                     TGQFEALELRDGDKARYLGKGVLKAVENVNTTLAKAVVGVDAADTALVDRTMLEADGT
                     EDKSKLGANAILAVSMAAAKAAAASEETSLYRFLGGSQGGLLPVPMMNILNGGAHAAN
                     SIDVQEFMIMPVGAPDFRTCIQWSSEVFHALQSLLKADGHATGVGDEGGFAPNLKSDD
                     EAIDYIMRAIEKAGHKPGKDFVLAMDAAASEWKGAKKGEYKQPKSGQVFTTAELVEHW
                     KKLVDKYPIVSLEDPLDEEDWEGWQLITKELGDRLQIVGDDLFVTNTKRLKKGIDMKA
                     ANAILIKVNQIGTLSETLAAVAMAHNAGFKAVVSHRSGETEDTTIADLVVALNAGQIK
                     TGAPNRSERVAKYNQLLRIEEELGKNAVFAGKNAFNVPLP"
     misc_feature    284885..286156
                     /locus_tag="Selsp_0255"
                     /note="enolase; Provisional; Region: eno; PRK00077"
                     /db_xref="CDD:234617"
     misc_feature    284900..286117
                     /locus_tag="Selsp_0255"
                     /note="Enolase: Enolases are homodimeric enzymes that
                     catalyse the reversible dehydration of
                     2-phospho-D-glycerate to phosphoenolpyruvate as part of
                     the glycolytic and gluconeogenesis pathways. The reaction
                     is facilitated by the presence of metal ions; Region:
                     enolase; cd03313"
                     /db_xref="CDD:239429"
     misc_feature    order(284903..284905,284909..284935,284945..284947,
                     284981..284983,285347..285355,285416..285421,
                     285428..285433,285440..285445,285482..285487,
                     285506..285508,285512..285514,285992..286000,
                     286067..286075,286079..286084,286091..286093,
                     286100..286105,286112..286114)
                     /locus_tag="Selsp_0255"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239429"
     misc_feature    order(285005..285007,285605..285607,285740..285742,
                     285821..285823)
                     /locus_tag="Selsp_0255"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:239429"
     misc_feature    order(285344..285346,285494..285496,285896..285898,
                     285980..285988,286049..286051)
                     /locus_tag="Selsp_0255"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:239429"
     gene            286360..286731
                     /locus_tag="Selsp_0256"
                     /db_xref="GeneID:10496465"
     CDS             286360..286731
                     /locus_tag="Selsp_0256"
                     /note="InterPro IPR006121;
                     KEGG: eel:EUBELI_01465 hypothetical protein;
                     PFAM: Heavy metal transport/detoxification protein;
                     SPTR: Conserved domain protein;
                     IMG reference gene:2504585714;
                     PFAM: Heavy-metal-associated domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Heavy metal transport/detoxification protein"
                     /protein_id="YP_004412693.1"
                     /db_xref="GI:330838113"
                     /db_xref="InterPro:IPR006121"
                     /db_xref="InterPro:IPR017969"
                     /db_xref="GeneID:10496465"
                     /translation="MATYILGALLLVGLFFAVRGMVRHFGGGGACCGGGGSIEGGSKK
                     KLYHDVIGEKVLHIEGMHCDNCKNAVERMLNGIDGAAAEVDLGKNIAVLKMERMISDE
                     ELHAVLDKTEYKLARAELREV"
     misc_feature    286522..286701
                     /locus_tag="Selsp_0256"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(286540..286548,286555..286557)
                     /locus_tag="Selsp_0256"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     gene            complement(286788..287966)
                     /locus_tag="Selsp_0257"
                     /db_xref="GeneID:10496466"
     CDS             complement(286788..287966)
                     /locus_tag="Selsp_0257"
                     /note="COGs: COG2206 HD-GYP domain;
                     InterPro IPR003607:IPR006674;
                     KEGG: mta:Moth_2263 metal dependent phosphohydrolase;
                     PFAM: Metal-dependent phosphohydrolase, HD subdomain;
                     SMART: Metal-dependent phosphohydrolase, HD domain;
                     SPTR: Metal dependent phosphohydrolase;
                     IMG reference gene:2504585715;
                     PFAM: HD domain;
                     TIGRFAM: uncharacterized domain HDIG"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_004412694.1"
                     /db_xref="GI:330838114"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:10496466"
                     /translation="MIRLKSNQLKTGMVTAQSIFNEKGAAFLVRGTPLTDRYIYRLRQ
                     LSVPELHVTSLSSNFQLQPPPDIIKEHTRVQAVENVAETFRQAEMHGQFNMSLMERCA
                     DLLVRDIMSKKKNLVQITDIRLHDSYTFSHSVNVAVLATMLGNLCGYSKSKLQVITLG
                     GLLHDIGKLAVPTSILNKPGALTADEFKIIRRHPSEGRRLLKELKSPIASILAIIAVQ
                     HHEHIDGSGYPNHIRGKSIHPYCRITAIADVYDALTSVRPYKKAYKPNVVYQMMMHNS
                     PGHFDMDRLRLFFDNVAIYPVGTVMKTNLGYAIVKKVIFGHTLAPVVIVFADKNGGLL
                     KKPFGVNLAHCRRDAIQYVMDDVELLNFIRHTGIDPAVFLDDDLRAMKDYPRMGKHEI
                     "
     misc_feature    complement(287004..>287663)
                     /locus_tag="Selsp_0257"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    complement(287157..287585)
                     /locus_tag="Selsp_0257"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(287223..287225,287472..287477,
                     287571..287573))
                     /locus_tag="Selsp_0257"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(287472..287474)
                     /locus_tag="Selsp_0257"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            complement(288018..289184)
                     /locus_tag="Selsp_0258"
                     /db_xref="GeneID:10496467"
     CDS             complement(288018..289184)
                     /locus_tag="Selsp_0258"
                     /note="COGs: COG2206 HD-GYP domain;
                     InterPro IPR003607:IPR006674;
                     KEGG: mta:Moth_2263 metal dependent phosphohydrolase;
                     PFAM: Metal-dependent phosphohydrolase, HD subdomain;
                     SMART: Metal-dependent phosphohydrolase, HD domain;
                     SPTR: Metal dependent phosphohydrolase;
                     IMG reference gene:2504585716;
                     PFAM: HD domain"
                     /codon_start=1
                     /transl_table=11
                     /product="metal dependent phosphohydrolase"
                     /protein_id="YP_004412695.1"
                     /db_xref="GI:330838115"
                     /db_xref="InterPro:IPR003607"
                     /db_xref="InterPro:IPR006674"
                     /db_xref="GeneID:10496467"
                     /translation="MIHIPIKKLKNGMITAQSIYNPLGASYLTKGMELSPTYIERLEK
                     AGFDGVTVTSMDPKLKLAPPDDIVQEKTRISAIQNVATAFHSVEENGTFDPAPLQGIS
                     ENILQDIIAQQQNLVQLTDIRLHDTYTFAHSVNVAILSSLLGVLLKISREEQLKLTLG
                     GLLHDIGKVTVPYEILTKAGHLSDDEWSVMQGHPEAGRQRLKKMFPNDTLLSTIALQH
                     HEHIDGSGYPNHLKGEQIHRYGRIVAIADVYDALTSVRPYKRAYTPSVAHRLMATCSP
                     GHFDLDLLKLFFDNVAIYPVGTILKTQEGYAIVKKVEFGHTLTPVVCIFANREGKLLD
                     APHDLDLKEAPKGMLEGVISDSELYHFIHNINVDPAIFLQENAEKEDASQENAE"
     misc_feature    complement(288219..>288884)
                     /locus_tag="Selsp_0258"
                     /note="c-di-GMP phosphodiesterase class II (HD-GYP domain)
                     [Signal transduction mechanisms]; Region: COG2206"
                     /db_xref="CDD:225116"
     misc_feature    complement(288399..288803)
                     /locus_tag="Selsp_0258"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    complement(order(288444..288446,288690..288695,
                     288789..288791))
                     /locus_tag="Selsp_0258"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    complement(288690..288692)
                     /locus_tag="Selsp_0258"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            289429..290121
                     /locus_tag="Selsp_0259"
                     /db_xref="GeneID:10496468"
     CDS             289429..290121
                     /locus_tag="Selsp_0259"
                     /note="KEGG: ptm:GSPATT00028323001 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585717"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412696.1"
                     /db_xref="GI:330838116"
                     /db_xref="GeneID:10496468"
                     /translation="MIVRQRWGTVVLLAVLLHLFAFGIAGLLLPHEESFLDTAQEITW
                     LDVPEADETAAKVSPPREEKLRTEEKPPAENETLAVEEESAPEPWKPPSQEAAKSPSE
                     AEKRSIERQKAKPPKKRDYPAMRKPNKPAVLREETKRGLTEKETAYRGHVQFFADISQ
                     EGRVTGVQAWQFEPEIADEKERRLLEERLEKRIKESWRYAPSLTPEGVPTTQTKAEEL
                     DIPEKEKPKDDR"
     gene            complement(290171..290521)
                     /locus_tag="Selsp_0260"
                     /db_xref="GeneID:10496469"
     CDS             complement(290171..290521)
                     /locus_tag="Selsp_0260"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585718"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412697.1"
                     /db_xref="GI:330838117"
                     /db_xref="GeneID:10496469"
                     /translation="MPTAAKSSGARKTAVPKKSSAPSRTRRASNVAYIFFNCDAEKSH
                     GSMNIFYNHEIYRDTQASRKALWQKVKAEQDASRIEIAEDDLTSVRTAILESDPAEAS
                     RYIRFGAIETFTCH"
     gene            291043..292887
                     /locus_tag="Selsp_0261"
                     /db_xref="GeneID:10496470"
     CDS             291043..292887
                     /locus_tag="Selsp_0261"
                     /note="KEGG: gtn:GTNG_2007 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585719"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412698.1"
                     /db_xref="GI:330838118"
                     /db_xref="GeneID:10496470"
                     /translation="MFPFMDRKKGSWRAPVNDSGELVGYNDLARVSFGIRTVHYLVRE
                     TIQNSLDARREDAEGAVLVSFQSFDIPREKFPGREDFQNILERCFLSNREDKKCREAF
                     ERAADVLRAERIAVLRISDFRTRGLEGALAGEKGSLWSGLVKEQGFSVQKENDAGGSF
                     GIGKAVVYSCSELRTAFFASLDKDGVESYTGVAKLVSYKDEKERWTTGTVYYSDENKK
                     ALLDIFTLDPAFRRRTSGTDIFVMGLVPIEGLEQEMIRAVLDNFLLAIWLGNLEVEIG
                     DHRITKTSLGLYADSLPVEKTAGSPHHKEYYEENRMIQRYARMLLGEDEATQRIELRA
                     AEYGAKYGFPDGAATLFLTRGEGLNRRILMSRHIGMKLFEQKGFPSGIDFTGIFLIKE
                     NAMGQAFRRIEVPSHDAWEPGVVQDAAEEKQAKEMYLGLKRYLKEKVRERLMAEEERG
                     VDAFGAGDFLPDLEDAAVRRALAARKGKRREELQSCIEKVRKKKAAASRLSPLHMRSF
                     CVEREKGRYRLSLIAPRKAERVRLELFLAGEQTDVPVKLLAASLSGRARAKLARFEKN
                     VIELQNVAKGAKLFVDYTMDYRDYCLMEVKYVENPGASGAVSVAGEDE"
     gene            292835..293701
                     /locus_tag="Selsp_0262"
                     /db_xref="GeneID:10496471"
     CDS             292835..293701
                     /locus_tag="Selsp_0262"
                     /note="KEGG: gtn:GTNG_2006 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585720"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412699.1"
                     /db_xref="GI:330838119"
                     /db_xref="GeneID:10496471"
                     /translation="MKIRGRLAPYPLLAKTNDSYRKSSFDGIAELKASGKELRLEFRA
                     VLRCTSLRNLVRAGLAGYALHVESPVTSYRRLFEFNDAPFHLTLAADEVRVSLQVTPF
                     VVAKAAIEGYASDDFHEAYEGQVFSFARGHILAVDQTTEFLLQAHDERETLPSIVRVE
                     PLGREAGEAALRVDCGSDYIVARLPQGMYDAYRRYAKGVYSATFLSCVVQPALTAALE
                     KLQGALRAGEEPRTRWRRVLVHLLEEEKIDLAAKDAEPLAVAQRLLRDPLNRAVQELE
                     DLAQREEVGAWN"
     gene            293692..294444
                     /locus_tag="Selsp_0263"
                     /db_xref="GeneID:10496472"
     CDS             293692..294444
                     /locus_tag="Selsp_0263"
                     /note="KEGG: bwe:BcerKBAB4_0823 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585721"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412700.1"
                     /db_xref="GI:330838120"
                     /db_xref="GeneID:10496472"
                     /translation="MELSFMTQAGIDDMKTHVEEYAAMYQSADNAAMLAHLSARGYLE
                     KTELAALSPVELLTEGDFASTDVENVRRIYGAWRTLAPYTAADERFWAGLSHTLFWRY
                     IHYRKEKDFGEVKAAALRSDFFFAQGRRRSLFVNPIARLWWAGHMVFDERRRDPFELL
                     PVLAQEAFASQLVLLASSSLMSRRETRFAVLALLERFERSGRKVKREHLQALLARLNA
                     ISSLTLVDMLAQEEIEKRLEGVLFPLFENRRD"
     gene            294446..294751
                     /locus_tag="Selsp_0264"
                     /db_xref="GeneID:10496473"
     CDS             294446..294751
                     /locus_tag="Selsp_0264"
                     /note="InterPro IPR002934;
                     KEGG: ere:EUBREC_0313 hypothetical protein;
                     PFAM: Nucleotidyl transferase domain;
                     SPTR: Putative toxin-antitoxin system, toxin component;
                     IMG reference gene:2504585722;
                     PFAM: Nucleotidyltransferase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase beta domain protein region"
                     /protein_id="YP_004412701.1"
                     /db_xref="GI:330838121"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="GeneID:10496473"
                     /translation="MPEGIFTFDEIKRRLQPVFTSHRIRQAILFGSYGKGTATQKSDV
                     DLLVDSDLRGLKFMGFVEELREALDDKDMDVFDVAHIEPKSRIAEEIKQTGIEIYAR"
     misc_feature    294470..294739
                     /locus_tag="Selsp_0264"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(294533..294541,294548..294550,294569..294574,
                     294578..294580,294656..294658,294665..294667)
                     /locus_tag="Selsp_0264"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(294533..294541,294548..294550,294569..294574,
                     294578..294580)
                     /locus_tag="Selsp_0264"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(294572..294574,294578..294580,294665..294667)
                     /locus_tag="Selsp_0264"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    order(294656..294658,294665..294667)
                     /locus_tag="Selsp_0264"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            294741..294893
                     /locus_tag="Selsp_0265"
                     /pseudo
                     /db_xref="GeneID:10496474"
     gene            294954..295457
                     /locus_tag="Selsp_0266"
                     /db_xref="GeneID:10496475"
     CDS             294954..295457
                     /locus_tag="Selsp_0266"
                     /note="COGs: COG0778 Nitroreductase;
                     InterPro IPR000415;
                     KEGG: ccv:CCV52592_1605 NADPH-flavin oxidoreductase;
                     PFAM: Nitroreductase-like;
                     SPTR: Nitroreductase family protein;
                     IMG reference gene:2504585724;
                     PFAM: Nitroreductase family"
                     /codon_start=1
                     /transl_table=11
                     /product="nitroreductase"
                     /protein_id="YP_004412702.1"
                     /db_xref="GI:330838122"
                     /db_xref="InterPro:IPR000415"
                     /db_xref="GeneID:10496475"
                     /translation="MENDVVFQRRSIRKYQARPVEPEKVERILRAGMQAPSACNQRPW
                     EFFVVESREKIAALAKVTPYTGCAAGAPLLLALAYRTEGLTVPRFSHIDMAAAQQNIW
                     LEATYLGLGGVWFGIAPYEENMKKVEEILEMPANLKAFSLFALGYPNERKLHADRFEA
                     ERVHYVR"
     misc_feature    294963..295454
                     /locus_tag="Selsp_0266"
                     /note="NAD(P)H:flavin oxidoreductase-like family 1.  A
                     subfamily of the nitroreductase family containing
                     uncharacterized proteins that are similar to
                     nitroreductase. Nitroreductase catalyzes the reduction of
                     nitroaromatic compounds such as nitrotoluenes; Region:
                     NADPH_oxidoreductase_1; cd02150"
                     /db_xref="CDD:239063"
     misc_feature    order(294978..294980,294984..294986,294990..294992,
                     295068..295070,295299..295304)
                     /locus_tag="Selsp_0266"
                     /note="putative FMN binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239063"
     gene            295550..295909
                     /locus_tag="Selsp_0267"
                     /db_xref="GeneID:10496476"
     CDS             295550..295909
                     /locus_tag="Selsp_0267"
                     /note="COGs: COG4679 Phage-related protein;
                     InterPro IPR009241;
                     KEGG: afn:Acfer_1073 protein of unknown function DUF891;
                     PFAM: Protein of unknown function DUF891;
                     SPTR: Toxin-antitoxin system, toxin component, RelE
                     family;
                     IMG reference gene:2504585725;
                     PFAM: Phage derived protein Gp49-like (DUF891)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412703.1"
                     /db_xref="GI:330838123"
                     /db_xref="InterPro:IPR009241"
                     /db_xref="GeneID:10496476"
                     /translation="MNFEVQFYETEDGQCPVEEFLLGLNVKMRAKILGFMQILEEKGV
                     ELREPYTKPLDDGILELRCSFAGNITRVMFFFYIGGKIILTNGFVKKTQKTPPAEIEI
                     AKKRRADYIRRFGEGAE"
     misc_feature    295604..295873
                     /locus_tag="Selsp_0267"
                     /note="Phage derived protein Gp49-like (DUF891); Region:
                     Gp49; pfam05973"
                     /db_xref="CDD:253485"
     gene            295906..296199
                     /locus_tag="Selsp_0268"
                     /db_xref="GeneID:10496477"
     CDS             295906..296199
                     /locus_tag="Selsp_0268"
                     /note="InterPro IPR001387;
                     KEGG: afn:Acfer_1074 transcriptional regulator, XRE
                     family;
                     PFAM: Helix-turn-helix type 3;
                     SMART: Helix-turn-helix type 3;
                     SPTR: Toxin-antitoxin system, antitoxin component, Xre
                     family;
                     IMG reference gene:2504585726;
                     PFAM: Helix-turn-helix"
                     /codon_start=1
                     /transl_table=11
                     /product="helix-turn-helix domain protein"
                     /protein_id="YP_004412704.1"
                     /db_xref="GI:330838124"
                     /db_xref="InterPro:IPR001387"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="GeneID:10496477"
                     /translation="MKTLQDFKREQMKNPAFARVYQEMEPERNIIRAIVEARIAQNLT
                     QKEVAEKTGIAQAELSRMENGLRNPSIKLLQRFAEGLGLVLKISFEPKQDVQA"
     misc_feature    295999..296154
                     /locus_tag="Selsp_0268"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(296008..296010,296020..296022,296095..296097)
                     /locus_tag="Selsp_0268"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(296017..296019,296092..296094)
                     /locus_tag="Selsp_0268"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(296038..296043,296074..296076,296083..296085,
                     296095..296100)
                     /locus_tag="Selsp_0268"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            296698..298863
                     /locus_tag="Selsp_0269"
                     /db_xref="GeneID:10496478"
     CDS             296698..298863
                     /locus_tag="Selsp_0269"
                     /note="COGs: COG1629 Outer membrane receptor protein
                     mostly Fe transport;
                     InterPro IPR012910:IPR000531;
                     KEGG: axy:AXYL_03141 ferrichrome receptor FcuA 1;
                     PFAM: TonB-dependent receptor, beta-barrel; TonB-dependent
                     receptor, plug;
                     SPTR: Putative TonB-dependent receptor;
                     IMG reference gene:2504585727;
                     PFAM: TonB dependent receptor; TonB-dependent Receptor
                     Plug Domain"
                     /codon_start=1
                     /transl_table=11
                     /product="TonB-dependent receptor"
                     /protein_id="YP_004412705.1"
                     /db_xref="GI:330838125"
                     /db_xref="InterPro:IPR000531"
                     /db_xref="InterPro:IPR012910"
                     /db_xref="GeneID:10496478"
                     /translation="MGKQRKNWLALAIVGALTGMSLHGSVHAAEADGEETAHELSETV
                     VEAGRAKLAGGLVERRENIGLLGSKDVMETPFQAMTFGKKALEQFSVPDRTILDTLSL
                     SPAVRVGQGATDSNVTIRGLSSNGNKWYINGVPGMAHQKDMTANFIDSVTVIAGPALG
                     VRGTTAGWQENAGGVVDMISKKASAKGDREAKLSFHGKSYVSQSVDLGERFGENKEWG
                     MRFNVLQGQGTLSVDHARMWKWGVYLNLDHKTANSTTNLLMGYDYTRQRGDGNSLSVA
                     KTLKSLPKAPSGSVNFSPDWAEDTYNDWTFILNHEQKLSEHAKAFLNAGYHKENYTSW
                     IQGYGRTLLNLDGDYASLRSSGYGSGYSQWPVAHETKYIGIGVKGDFKLGEWKNDYVL
                     SLDKMWFRREVIGNYGSDPSDIYVPAPGNIYHSNSTPLPAPLPKHTLKTQYNLQMLGW
                     HVVDTFTAPGDKFGITLGLHGHRGIRARNYAGSSASEIDASATCPTVAVTYQFTPQFM
                     MYANHSESFDEGTVVGSSYANAGETIPPAKTKQNEVGVKYQSKGLLQTLSYYNMRKQG
                     TNDVLRGGLKYLEIDKEQKYLGVEYSAVGKISPQLDMILALNWLQAEQTDGNSVLGLP
                     KWAGTAALVYKPTEDLSVIGRLNYSAKARIRHSDPLDVPAYTTFDLGLNYKTKISSKD
                     VTFSLMCNNLFDKRYWYASGSSIALGMPRTVSLSASCDF"
     misc_feature    296971..298860
                     /locus_tag="Selsp_0269"
                     /note="Porin superfamily.  These outer membrane channels
                     share a beta-barrel structure that differ in strand and
                     shear number.  Classical (gram-negative ) porins are
                     non-specific channels for small hydrophillic molecules and
                     form 16 beta-stranded barrels (16,20)...; Region:
                     OM_channels; cl17244"
                     /db_xref="CDD:266582"
     misc_feature    296977..298860
                     /locus_tag="Selsp_0269"
                     /note="TonB-dependent siderophore receptor; Region:
                     TonB-siderophor; TIGR01783"
                     /db_xref="CDD:233575"
     gene            298932..299930
                     /locus_tag="Selsp_0270"
                     /db_xref="GeneID:10496479"
     CDS             298932..299930
                     /locus_tag="Selsp_0270"
                     /note="COGs: COG0614 ABC-type Fe3+-hydroxamate transport
                     system periplasmic component;
                     InterPro IPR002491;
                     KEGG: vpr:Vpar_0062 periplasmic binding protein;
                     PFAM: Periplasmic binding protein;
                     SPTR: Periplasmic binding protein;
                     IMG reference gene:2504585728;
                     PFAM: Periplasmic binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, periplasmic subunit"
                     /protein_id="YP_004412706.1"
                     /db_xref="GI:330838126"
                     /db_xref="InterPro:IPR002491"
                     /db_xref="GeneID:10496479"
                     /translation="MGGVLLGALFLFALIRAGFSYGGEREALQADGFAVENYDSALRP
                     HVYHYSEHPKRIVALWQNSIETLLALGVADRIIVAGGVSNTDVLAPENVSAYETIPLR
                     LKQVPDVETMLTLQPDLIVGWLFDFTRQSNGVGRSDFWEKRGTNVYMTTMNGADFKDV
                     HTLEDELRFIRDLGTIVDREERAAEIEQEIRAEMTPVMQGKRLRVLVVSSVARQLTIY
                     TPRTLAGDLLEQLGAEVLGADRQMVGEDEFISYEQLLLLNPDVIFVQSTSPHDQGPRE
                     QLLANPALHRLRAVREGHIYCVPFYLMRCPGVRVLDCIRCFKHGLQEAAALEGDAA"
     misc_feature    299088..299873
                     /locus_tag="Selsp_0270"
                     /note="Helical backbone metal receptor (TroA-like domain).
                     These proteins have been shown to function in the ABC
                     transport of ferric siderophores and metal ions such as
                     Mn2+, Fe3+, Cu2+ and/or Zn2+.  Their ligand binding site
                     is formed in the interface between...; Region: TroA-like;
                     cl00262"
                     /db_xref="CDD:260309"
     misc_feature    299097..299837
                     /locus_tag="Selsp_0270"
                     /note="Periplasmic binding protein; Region: Peripla_BP_2;
                     pfam01497"
                     /db_xref="CDD:250662"
     misc_feature    order(299343..299348,299355..299357,299454..299456)
                     /locus_tag="Selsp_0270"
                     /note="intersubunit interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238347"
     gene            299927..300979
                     /locus_tag="Selsp_0271"
                     /db_xref="GeneID:10496480"
     CDS             299927..300979
                     /locus_tag="Selsp_0271"
                     /note="COGs: COG0609 ABC-type Fe3+-siderophore transport
                     system permease component;
                     InterPro IPR000522;
                     KEGG: elm:ELI_3971 hypothetical protein;
                     PFAM: ABC transporter permease protein;
                     SPTR: Hemin ABC transporter, permease protein;
                     IMG reference gene:2504585729;
                     PFAM: FecCD transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC-type transporter, integral membrane subunit"
                     /protein_id="YP_004412707.1"
                     /db_xref="GI:330838127"
                     /db_xref="InterPro:IPR000522"
                     /db_xref="GeneID:10496480"
                     /translation="MKKKMWESSLSSWLLSGLLIASVLCAVTVGTVDVSLAEAFGSIV
                     YGITGCESFASYGDSAVYDIIWLLRLPRIVLAMLTGMGLSVCGVIMQAIVKNPLADPY
                     ILGISSGASLGATAAIMLGIGAFLGENFVGLAAAGGAFAVSMGVLVLSGVGGHSSPVK
                     LLLSGMALSAVCSAFSSFIVYFANNREGMQTIAYWLMGSLANAKWENLAVICPIIVLG
                     TAFFWTQSQILNLMLVGDAAAITLGRNLTRYRHGYLVLSSLMVGFVVYSAGMIGFVGL
                     ICPHVMRMLTGAEHRRLLPASAFAGAILLVWADVLCRTILPRTELPIGILVSLVGAPC
                     FVYLMVRRSYGFGDAE"
     misc_feature    300143..300943
                     /locus_tag="Selsp_0271"
                     /note="Transmembrane subunit (TM), of Periplasmic Binding
                     Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters involved in the uptake of siderophores, heme,
                     vitamin B12, or the divalent cations Mg2+ and Zn2+.
                     PBP-dependent ABC transporters consist of...; Region:
                     TM_ABC_iron-siderophores_like; cd06550"
                     /db_xref="CDD:119348"
     misc_feature    order(300197..300199,300209..300217,300593..300598,
                     300602..300610,300614..300619,300623..300640,
                     300644..300652,300773..300775,300794..300796)
                     /locus_tag="Selsp_0271"
                     /note="ABC-ATPase subunit  interface; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(300212..300214,300218..300220,300233..300235,
                     300404..300406,300410..300415,300422..300427,
                     300434..300439,300446..300448,300455..300460,
                     300464..300466,300503..300508,300515..300517,
                     300743..300745,300899..300901,300908..300913,
                     300920..300922,300929..300934,300941..300943)
                     /locus_tag="Selsp_0271"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119348"
     misc_feature    order(300464..300466,300545..300547,300719..300721,
                     300731..300733,300863..300865,300890..300892)
                     /locus_tag="Selsp_0271"
                     /note="putative PBP binding regions; other site"
                     /db_xref="CDD:119348"
     gene            301248..302558
                     /locus_tag="Selsp_0272"
                     /db_xref="GeneID:10496481"
     CDS             301248..302558
                     /locus_tag="Selsp_0272"
                     /note="COGs: COG1301 Na+/H+-dicarboxylate symporter;
                     InterPro IPR001991;
                     KEGG: vpr:Vpar_1603 sodium:dicarboxylate symporter;
                     PFAM: Sodium:dicarboxylate symporter;
                     SPTR: Sodium:dicarboxylate symporter family protein;
                     IMG reference gene:2504585730;
                     PFAM: Sodium:dicarboxylate symporter family"
                     /codon_start=1
                     /transl_table=11
                     /product="sodium:dicarboxylate symporter"
                     /protein_id="YP_004412708.1"
                     /db_xref="GI:330838128"
                     /db_xref="InterPro:IPR001991"
                     /db_xref="GeneID:10496481"
                     /translation="MSEEKNHAAVEETAQAAIAKSRQSGQGRQFVLWFLALIVGAGLG
                     WLNVGPLNELFDFVATVFTRLFQFIAVPTIALAVITTLAALGAKKDTGRIFAHAVTYT
                     LLTTISAATVGLALYVWIAPGNLPAEVIGAGAADVPQKLGTLSYYDHILSVIPNNLLQ
                     PFLSGNVLSVMLIAASVGLALAFMPKTENRTVLLKALHGAQELLFTLIRALLYVLPVG
                     ILAFAAQLSAQIEAGVIVGALGKYTAVVLGGNLIQFFIILPLFLLVRGLNPLHVFRKM
                     APAVAVALFTKSSAGTLPVTLASAEKNLKVNPTVSRFVLPICTTINMNGCAAFILVTS
                     LFVMQNAGFEITLGTMVTWLFVAVLAAVGNAGVPMGCYFLTLSLMSSLGAPLGLMGVI
                     LPIYTIIDMIETAENVWSDAAVCAMTDHDLEGTLDDEEAHPAEI"
     misc_feature    301347..302507
                     /locus_tag="Selsp_0272"
                     /note="Sodium:dicarboxylate symporter family; Region: SDF;
                     pfam00375"
                     /db_xref="CDD:249810"
     gene            complement(302578..303759)
                     /locus_tag="Selsp_0273"
                     /db_xref="GeneID:10496482"
     CDS             complement(302578..303759)
                     /locus_tag="Selsp_0273"
                     /note="COGs: COG2814 Arabinose efflux permease;
                     InterPro IPR004812:IPR011701;
                     KEGG: bbe:BBR47_33660 drug resistance transporter;
                     PFAM: Major facilitator superfamily MFS-1;
                     SPTR: TcaB protein;
                     TIGRFAM: Drug resistance transporter Bcr/CflA subfamily;
                     IMG reference gene:2504585731;
                     PFAM: Major Facilitator Superfamily;
                     TIGRFAM: drug resistance transporter, Bcr/CflA subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="drug resistance transporter, Bcr/CflA subfamily"
                     /protein_id="YP_004412709.1"
                     /db_xref="GI:330838129"
                     /db_xref="InterPro:IPR005829"
                     /db_xref="InterPro:IPR011701"
                     /db_xref="InterPro:IPR016196"
                     /db_xref="InterPro:IPR020846"
                     /db_xref="GeneID:10496482"
                     /translation="MKMTKRRRISLTIFLGIMSAMAPLATDMYLPALPELSAEFSAST
                     SATQLTLTMTLFGMAIGQVFLGPLSDMYGRKRPLFAGMVAFAIVSAGCFYASSIEPFL
                     ALRFLQGFAGASGIVIARAIARDVAEGVELTRFLSILMLVNGLAPILAPVAGGQLLVF
                     SSWRIVFAVLAAIGVLLAVWTLKTRETLAEGARQKSMTASFHAFPTLLRDRYFLGHCL
                     VQCFVFGAFFSYIAGSSFVFQNIYGVSAQGYSLIFGGIGTGLFLAGLLPARLAGRIKD
                     ISMLKASLLVPLVSSALLLASLLAGFAPLALTIVLLFITVVPLSVMGTASFSLALSRQ
                     GRNAGAASALIGFFSMVLGGVMMPLVGIAGDHTAIPMAVLMLTGYTLGAIVFYSNVKN
                     G"
     misc_feature    complement(302599..303726)
                     /locus_tag="Selsp_0273"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    complement(302599..303717)
                     /locus_tag="Selsp_0273"
                     /note="drug resistance transporter, Bcr/CflA subfamily;
                     Region: efflux_Bcr_CflA; TIGR00710"
                     /db_xref="CDD:233099"
     misc_feature    complement(order(302701..302703,302710..302715,
                     302722..302727,302734..302739,302779..302781,
                     302788..302793,302803..302805,302812..302817,
                     302824..302826,302968..302970,302980..302982,
                     302989..302991,303001..303003,303013..303015,
                     303055..303057,303064..303069,303076..303081,
                     303088..303090,303319..303321,303337..303342,
                     303349..303354,303388..303390,303397..303402,
                     303409..303414,303421..303426,303562..303567,
                     303571..303576,303586..303588,303595..303600,
                     303607..303609,303658..303663,303667..303675,
                     303682..303684))
                     /locus_tag="Selsp_0273"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            complement(304287..305765)
                     /locus_tag="Selsp_0274"
                     /db_xref="GeneID:10496483"
     CDS             complement(304287..305765)
                     /locus_tag="Selsp_0274"
                     /EC_number="6.2.1.26"
                     /note="COGs: COG0318 Acyl-CoA synthetase
                     (AMP-forming)/AMP-acid ligase II;
                     InterPro IPR000873;
                     KEGG: afn:Acfer_0829 AMP-dependent synthetase and ligase;
                     PFAM: AMP-dependent synthetase/ligase;
                     PRIAM: o-succinylbenzoate--CoA ligase;
                     SPTR: CoA ligase;
                     IMG reference gene:2504585732;
                     PFAM: AMP-binding enzyme;
                     TIGRFAM: O-succinylbenzoate-CoA ligase"
                     /codon_start=1
                     /transl_table=11
                     /product="o-succinylbenzoate--CoA ligase"
                     /protein_id="YP_004412710.1"
                     /db_xref="GI:330838130"
                     /db_xref="InterPro:IPR000873"
                     /db_xref="InterPro:IPR020845"
                     /db_xref="GeneID:10496483"
                     /translation="MLLHEILQNGRGEDIAVIDRGRRITYDELREALRASRDRFYAAG
                     IRAHDRVALFSHNRVELLVAYLAVNSLGAVAVPLNYQLSVREVAYIIKDAGVRHLVTE
                     KELPLESHLGQQGYGGELCQLPLLDVMKPASAMPAPKLSNIFSEENPCVIIYTSGTTG
                     APKGAVLSHRNQCTNAHQVMEHHAITPNDRVLCVLPMYHCFAWTCSVLATLTAGGTIV
                     IVNGFMPKETIRAIRDEKVTIMYAVPSVCAILTRQAEAEDLKSLRLTGIGGTALPQEI
                     AAAYREKFGLTIYEVYGLSEASPVVTMDSPRHYRPGSIGVPLKGLEVIIANTDGTELP
                     CGMTGELLVKGPTVMKGYWHQDEATARALKDGWLYTGDIARMDEDGFVYIVDRIKDMI
                     ISMGENVYPREIEELVYSFPGIEDAAVIAIPDPLRGQAGACYYTVKKNEEVDMRTLKK
                     FLQKNLAVYKVPREFCQIPEMPRTSTGKIAKREIARLYREDK"
     misc_feature    complement(304290..305765)
                     /locus_tag="Selsp_0274"
                     /note="long-chain-fatty-acid--CoA ligase; Validated;
                     Region: PRK06187"
                     /db_xref="CDD:235730"
     misc_feature    complement(304314..305723)
                     /locus_tag="Selsp_0274"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    complement(order(305277..305282,305286..305303,
                     305310..305312))
                     /locus_tag="Selsp_0274"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(304332..304334,304572..304574,
                     304605..304607,304614..304616,304650..304652,
                     304881..304898,304959..304964,305301..305303))
                     /locus_tag="Selsp_0274"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(304389..304391,304572..304583,
                     304605..304607,304614..304616,304650..304652,
                     304881..304898,304959..304964,305019..305021,
                     305028..305033,305037..305039,305178..305183,
                     305301..305303))
                     /locus_tag="Selsp_0274"
                     /note="active site"
                     /db_xref="CDD:213270"
     misc_feature    complement(order(304389..304391,304407..304409,
                     304575..304583,304962..304964,305019..305021,
                     305028..305033,305181..305183))
                     /locus_tag="Selsp_0274"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            305972..307000
                     /locus_tag="Selsp_0275"
                     /db_xref="GeneID:10496484"
     CDS             305972..307000
                     /locus_tag="Selsp_0275"
                     /note="COGs: COG1879 ABC-type sugar transport system
                     periplasmic component;
                     InterPro IPR001761;
                     KEGG: scb:SCAB_63951 solute-binding protein;
                     PFAM: Periplasmic binding protein/LacI transcriptional
                     regulator;
                     SPTR: Periplasmic ribose-binding protein;
                     IMG reference gene:2504585733;
                     PFAM: family"
                     /codon_start=1
                     /transl_table=11
                     /product="periplasmic binding protein/LacI transcriptional
                     regulator"
                     /protein_id="YP_004412711.1"
                     /db_xref="GI:330838131"
                     /db_xref="InterPro:IPR001761"
                     /db_xref="GeneID:10496484"
                     /translation="MRKIFALLLAAFVAIAAAGCTTNGQDASKVGSAEPGSGNRKITM
                     GYSQIGAQSTWRAAHTASIKQAAEDAGIELQFSNAELKQENQIRAIRSFIAQKVDIIA
                     FSPIVATGWDEVLKEAKAAKIPVIIVDRDLQTNDDSLYIMRIGTDSVREGREAFRWLD
                     GYMQEKGKKPRDGGAKFNIAEIKGPAGSSVVERRDTGFRDAMTASPNKDAYEILVAQN
                     STFQKDGGKQVMTEMLKNYKDKIDILFAQNDDMALGAIEAIEAAGLKPGQDIVIVSCD
                     GTRAIFQAMIDGKSNCTVEGNPLQGPLLMEMAKKVLAGEKVERTVFVKDSVYPAEIAP
                     MAIQERKY"
     misc_feature    306098..306955
                     /locus_tag="Selsp_0275"
                     /note="Periplasmic binding domain of ABC-type YtfQ-like
                     transport systems; Region: PBP1_YtfQ_like; cd06309"
                     /db_xref="CDD:107304"
     misc_feature    306104..306919
                     /locus_tag="Selsp_0275"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     misc_feature    order(306134..306136,306356..306358,306551..306553,
                     306797..306799,306857..306859)
                     /locus_tag="Selsp_0275"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107304"
     gene            307084..307440
                     /locus_tag="Selsp_0276"
                     /db_xref="GeneID:10496485"
     CDS             307084..307440
                     /locus_tag="Selsp_0276"
                     /note="KEGG: cki:Calkr_0678 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585734"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412712.1"
                     /db_xref="GI:330838132"
                     /db_xref="GeneID:10496485"
                     /translation="MMEFPAEEGCMKERLLQTIRQRCAGRKMQWTNHMMFRIMQRGIS
                     LADVSHVLQTGEIIEMYPTDYPYPSCLVSGYVENHACIHVVCGVGPCDLHLITAYRPD
                     PEQWDDDGKIRKEISS"
     misc_feature    307168..307386
                     /locus_tag="Selsp_0276"
                     /note="Domain of unknown function (DUF4258); Region:
                     DUF4258; pfam14076"
                     /db_xref="CDD:258301"
     gene            307437..307670
                     /locus_tag="Selsp_0277"
                     /db_xref="GeneID:10496486"
     CDS             307437..307670
                     /locus_tag="Selsp_0277"
                     /note="InterPro IPR022453;
                     KEGG: ckl:CKL_0470 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     TIGRFAM: Zinc finger, YgiT-type;
                     IMG reference gene:2504585735;
                     TIGRFAM: YgiT-type zinc finger domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Zinc finger, YgiT-type"
                     /protein_id="YP_004412713.1"
                     /db_xref="GI:330838133"
                     /db_xref="GeneID:10496486"
                     /translation="MNCFVCRGWMKEEKTAFMVEIDKQIIIVKNVPSRRCTQCGETTY
                     ADDVAHELERIVNELRKSPVEVSIVDYEAKPAA"
     misc_feature    307440..307622
                     /locus_tag="Selsp_0277"
                     /note="antitoxin MqsA for MqsR toxin; Region: MqsA;
                     cd12870"
                     /db_xref="CDD:240606"
     misc_feature    order(307440..307442,307446..307451,307455..307457,
                     307485..307487,307554..307574,307581..307586,
                     307590..307595,307605..307607,307614..307616)
                     /locus_tag="Selsp_0277"
                     /note="toxin interface [polypeptide binding]; other site"
                     /db_xref="CDD:240606"
     misc_feature    order(307443..307445,307452..307454,307542..307544,
                     307551..307553)
                     /locus_tag="Selsp_0277"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:240606"
     gene            307790..308020
                     /locus_tag="Selsp_0278"
                     /db_xref="GeneID:10496487"
     CDS             307790..308020
                     /locus_tag="Selsp_0278"
                     /note="InterPro IPR004692;
                     KEGG: vpr:Vpar_1010 preprotein translocase, SecG subunit;
                     PFAM: Preprotein translocase SecG subunit;
                     SPTR: Preprotein translocase, SecG subunit;
                     TIGRFAM: Preprotein translocase SecG subunit;
                     IMG reference gene:2504585736;
                     PFAM: Preprotein translocase SecG subunit;
                     TIGRFAM: protein translocase, SecG subunit"
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase, SecG subunit"
                     /protein_id="YP_004412714.1"
                     /db_xref="GI:330838134"
                     /db_xref="InterPro:IPR004692"
                     /db_xref="GeneID:10496487"
                     /translation="MLTLLMVLDALVAILLIVAVLGQEPKSAGMGGFDGGGGDTVFSA
                     KARGMDALLARVTVVLAVLFGAITLVIAKMTM"
     misc_feature    307790..308014
                     /locus_tag="Selsp_0278"
                     /note="preprotein translocase subunit SecG; Reviewed;
                     Region: secG; PRK06870"
                     /db_xref="CDD:235881"
     gene            308168..308917
                     /locus_tag="Selsp_0279"
                     /db_xref="GeneID:10496488"
     CDS             308168..308917
                     /locus_tag="Selsp_0279"
                     /EC_number="3.1.1.1"
                     /note="COGs: COG1647 Esterase/lipase;
                     InterPro IPR002925;
                     KEGG: afn:Acfer_0972 alpha/beta hydrolase fold protein;
                     PFAM: Dienelactone hydrolase;
                     PRIAM: Carboxylesterase;
                     SPTR: Putative carboxylesterase;
                     IMG reference gene:2504585737;
                     PFAM: Dienelactone hydrolase family"
                     /codon_start=1
                     /transl_table=11
                     /product="Carboxylesterase"
                     /protein_id="YP_004412715.1"
                     /db_xref="GI:330838135"
                     /db_xref="InterPro:IPR002925"
                     /db_xref="InterPro:IPR012354"
                     /db_xref="GeneID:10496488"
                     /translation="MIIEGAEPFLLPGGPHGVLLLHGFTGMPPEMRLLAEALYRAGHT
                     VLCPRLAGHGTSPEDLAHTDAEDWYDSALDGYAILSGLVPRISVVGHSMGALLALRLA
                     AQKRVTGVVTLAAPIFIDEGRGMKHLPPRSACIGRFHPKLRKSLRDVPEFCNVTYDRM
                     PLVAIHELVGFIEHVKALLPKVYAPLLLVHSLHDRTAHRRSLRYIYDHVGAAHKEVLW
                     LVRSGHLVMLDAERRAVFRRTASFLREMGSV"
     misc_feature    308168..308899
                     /locus_tag="Selsp_0279"
                     /note="Esterase/lipase [General function prediction only];
                     Region: COG1647"
                     /db_xref="CDD:224561"
     misc_feature    308267..>308449
                     /locus_tag="Selsp_0279"
                     /note="Probable pheophorbidase; Region: PLN02965; cl17657"
                     /db_xref="CDD:248211"
     gene            308941..309366
                     /locus_tag="Selsp_0280"
                     /db_xref="GeneID:10496489"
     CDS             308941..309366
                     /locus_tag="Selsp_0280"
                     /note="InterPro IPR006683;
                     KEGG: dau:Daud_0327 thioesterase superfamily protein;
                     PFAM: Thioesterase superfamily;
                     SPTR: Thioesterase family protein;
                     IMG reference gene:2504585738;
                     PFAM: Thioesterase superfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="thioesterase superfamily protein"
                     /protein_id="YP_004412716.1"
                     /db_xref="GI:330838136"
                     /db_xref="InterPro:IPR006683"
                     /db_xref="GeneID:10496489"
                     /translation="MPYEKIGQGEDYCFACGPKNPIGLHLEFQLADGKFRARKALSPE
                     YQGYSGIVHGGIVTTLLDEAMGGYLYDGLGERAVTARLAVRYRNPAPVGEELLIEGWE
                     ESRRKGFVNMRAKLSLADGTVLAEATAKMALVGEMNGTK"
     misc_feature    309010..309339
                     /locus_tag="Selsp_0280"
                     /note="PaaI_thioesterase is a tetrameric acyl-CoA
                     thioesterase with a hot dog fold and one of several
                     proteins responsible for phenylacetic acid (PA)
                     degradation in bacteria.  Although orthologs of PaaI exist
                     in archaea and eukaryotes, their function has not...;
                     Region: PaaI_thioesterase; cd03443"
                     /db_xref="CDD:239527"
     misc_feature    order(309094..309096,309175..309177,309196..309207)
                     /locus_tag="Selsp_0280"
                     /note="CoenzymeA binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239527"
     misc_feature    order(309097..309099,309103..309105,309112..309114,
                     309178..309192,309196..309198)
                     /locus_tag="Selsp_0280"
                     /note="subunit interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:239527"
     misc_feature    order(309100..309102,309124..309129,309136..309138,
                     309175..309177)
                     /locus_tag="Selsp_0280"
                     /note="PHB binding site; other site"
                     /db_xref="CDD:239527"
     gene            309353..311956
                     /locus_tag="Selsp_0281"
                     /db_xref="GeneID:10496490"
     CDS             309353..311956
                     /locus_tag="Selsp_0281"
                     /EC_number="3.1.13.1"
                     /note="COGs: COG0557 Exoribonuclease R;
                     InterProIPR011805:IPR001900:IPR003029:IPR022967:IPR
                     013223:IPR011129:IPR004476;
                     KEGG: afn:Acfer_0974 ribonuclease R;
                     PFAM: Ribonuclease II/R; Ribosomal protein S1, RNA-binding
                     domain; Ribonuclease B, N-terminal OB domain;
                     PRIAM: Exoribonuclease II;
                     SMART: Ribonuclease II/R; RNA-binding domain, S1; Cold
                     shock protein;
                     SPTR: Ribonuclease R;
                     TIGRFAM: Ribonuclease R, bacterial; Ribonuclease
                     II/ribonuclease R, bacteria;
                     IMG reference gene:2504585739;
                     PFAM: RNB domain; Ribonuclease B OB domain; S1 RNA binding
                     domain;
                     TIGRFAM: ribonuclease R; VacB and RNase II family 3'-5'
                     exoribonucleases"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonuclease R"
                     /protein_id="YP_004412717.1"
                     /db_xref="GI:330838137"
                     /db_xref="InterPro:IPR001900"
                     /db_xref="InterPro:IPR003029"
                     /db_xref="InterPro:IPR004476"
                     /db_xref="InterPro:IPR011129"
                     /db_xref="InterPro:IPR011805"
                     /db_xref="InterPro:IPR012340"
                     /db_xref="InterPro:IPR013223"
                     /db_xref="InterPro:IPR016027"
                     /db_xref="InterPro:IPR022966"
                     /db_xref="InterPro:IPR022967"
                     /db_xref="GeneID:10496490"
                     /translation="MEQNELQERIVNYMRTAAYKPLTADDLAAAMNLAQEELALFWTA
                     LEELEKTAAVIKTRHERFGVPERMNLVVGRLSMSAKGFGFIIPEVREKETDSDIFVPG
                     VSLGGAMNGDRVVARISPSEIAGRSREGEIIRIVERANEQIVGTFEESRHFGFVTPDD
                     KKIGQDIFIPKGAVHGAKAGMKVVVRITKWPAGRRNAEGEVEEILGRAGEPGVDVLSV
                     MSQYGLSEEFPADVAAEAAAIEDAVSPEEFSGRRDRRGFRIVTIDGEDAKDLDDGVYA
                     ERRADGSFFLGVYIADVSWYVRENSPLDREARARGTSVYLVDRVIPMLPKKLSNGICS
                     LNAGEDRLAMACEMEIGADGLVKSYEILPVVIHVYRRLTYTLVNEIFAEGADAVRTEN
                     ADLLPLLTPLREVHDAMEKARHERGSIGFDVPEIKVKLDESGKPVALIKRTGSLAESM
                     IEQCMLAANETVAEHMEKKEQPFLYRVHEQPSDEKIERLNNLLATFSLHLVPNEAGEV
                     APKDVQQVLEKVKGRPEERIVSAVSLRSMQQARYADAPLGHYGLAARHYTHFTSPIRR
                     YPDLIVHRLLRETFATGTIASERQERLRSLLPEIAEHTSARERIAIEAERETQDMKKI
                     EYMAQFVGDAFDAVISGVTAFGIFCELENGVEGLVHVSSMVNDYYEYREDLYALVGGA
                     THVSYRLGEPVRVVLVRANIAERNLDFILEDNGVFVAAKKKPEEGGVKRGESLKEKGA
                     KKDARSKKGRGRKAAKEKRTDEIIADVKGDKRPEKTSAPAETGEHKPHGKGHKGAKPH
                     DKGRSARRPERFQAERQGALADESSSSRPKAFWMKPPKDLRKKGKKSAPKPEKKRRPH
                     NKTQRATANSD"
     misc_feature    309365..311488
                     /locus_tag="Selsp_0281"
                     /note="ribonuclease R; Region: RNase_R; TIGR02063"
                     /db_xref="CDD:233703"
     misc_feature    309569..309757
                     /locus_tag="Selsp_0281"
                     /note="Ribonuclease B OB domain; Region: OB_RNB;
                     pfam08206"
                     /db_xref="CDD:254660"
     misc_feature    309809..309964
                     /locus_tag="Selsp_0281"
                     /note="Ribonuclease B OB domain; Region: OB_RNB;
                     pfam08206"
                     /db_xref="CDD:254660"
     misc_feature    310103..311083
                     /locus_tag="Selsp_0281"
                     /note="RNB domain; Region: RNB; pfam00773"
                     /db_xref="CDD:250123"
     misc_feature    311243..311485
                     /locus_tag="Selsp_0281"
                     /note="S1_RNase_R: RNase R C-terminal S1 domain. RNase R
                     is a processive 3' to 5' exoribonuclease, which is a
                     homolog of RNase II. RNase R degrades RNA with secondary
                     structure having a 3' overhang of at least 7 nucleotides.
                     RNase R and PNPase...; Region: S1_RNase_R; cd04471"
                     /db_xref="CDD:239917"
     misc_feature    order(311270..311272,311294..311296,311324..311326,
                     311330..311332)
                     /locus_tag="Selsp_0281"
                     /note="RNA binding site [nucleotide binding]; other site"
                     /db_xref="CDD:239917"
     gene            312012..312488
                     /locus_tag="Selsp_0282"
                     /db_xref="GeneID:10496491"
     CDS             312012..312488
                     /locus_tag="Selsp_0282"
                     /note="COGs: COG0691 tmRNA-binding protein;
                     InterPro IPR000037;
                     KEGG: bae:BATR1942_14765 SsrA-binding protein;
                     PFAM: SsrA-binding protein;
                     SPTR: SsrA-binding protein;
                     TIGRFAM: SsrA-binding protein;
                     IMG reference gene:2504585740;
                     PFAM: SmpB protein;
                     TIGRFAM: SsrA-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="SsrA-binding protein"
                     /protein_id="YP_004412718.1"
                     /db_xref="GI:330838138"
                     /db_xref="InterPro:IPR000037"
                     /db_xref="InterPro:IPR020081"
                     /db_xref="GeneID:10496491"
                     /translation="MGRKNDGVKIVAENRKARHDYFIHETFETGLVLQGTEVKSLRAG
                     RVNLKDSFASIKNGEIFVENMHISPYEQGNIFNHEPLRKRKLLMHKAEIVKLFSKTRE
                     KGFTLVPLKLYFSKGRAKLELALASGKHNYDKRRDLAAKAAKRDIERALKDHGKGR"
     misc_feature    312051..312398
                     /locus_tag="Selsp_0282"
                     /note="Small protein B (SmpB) is a component of the
                     trans-translation system in prokaryotes for releasing
                     stalled ribosome from damaged messenger RNAs; Region:
                     SmpB; cd09294"
                     /db_xref="CDD:187755"
     misc_feature    order(312093..312110,312114..312119,312123..312128,
                     312135..312137,312186..312188,312270..312287,
                     312369..312371)
                     /locus_tag="Selsp_0282"
                     /note="SmpB-tmRNA interface; other site"
                     /db_xref="CDD:187755"
     gene            312598..312849
                     /locus_tag="Selsp_0283"
                     /db_xref="GeneID:10496492"
     CDS             312598..312849
                     /locus_tag="Selsp_0283"
                     /note="InterPro IPR007712;
                     KEGG: gct:GC56T3_3131 plasmid stabilization system;
                     PFAM: Plasmid stabilisation system;
                     SPTR: Toxin-antitoxin system, toxin component, RelE
                     family;
                     IMG reference gene:2504585741"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization system"
                     /protein_id="YP_004412719.1"
                     /db_xref="GI:330838139"
                     /db_xref="GeneID:10496492"
                     /translation="MKIQYAKLAVKSIETMDRPTKQRIKQAIEGLPQGDVKRLKGSDG
                     LYRLRVGGWRIVFSYPAKDTLLIEKIAPRGDVYKGGFLL"
     misc_feature    312598..312831
                     /locus_tag="Selsp_0283"
                     /note="Cytotoxic translational repressor of
                     toxin-antitoxin stability system [Translation, ribosomal
                     structure and biogenesis / Cell division and chromosome
                     partitioning]; Region: RelE; COG2026"
                     /db_xref="CDD:224937"
     gene            312846..313049
                     /locus_tag="Selsp_0284"
                     /db_xref="GeneID:10496493"
     CDS             312846..313049
                     /locus_tag="Selsp_0284"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585742"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412720.1"
                     /db_xref="GI:330838140"
                     /db_xref="GeneID:10496493"
                     /translation="MTVKAQIVEMIEFIPDRELPILLEVVRRFLPKEMEDFASEDDRE
                     AHHIAMQEYMCGKTVSHDDIDWE"
     gene            313200..313502
                     /locus_tag="Selsp_0285"
                     /db_xref="GeneID:10496494"
     CDS             313200..313502
                     /locus_tag="Selsp_0285"
                     /note="InterPro IPR001845;
                     KEGG: aoe:Clos_0896 ArsR family transcriptional regulator;
                     PFAM: HTH transcriptional regulator, ArsR;
                     SMART: HTH transcriptional regulator, ArsR;
                     SPTR: Transcriptional repressor PagR;
                     IMG reference gene:2504585743;
                     PFAM: Bacterial regulatory protein, arsR family"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein ArsR"
                     /protein_id="YP_004412721.1"
                     /db_xref="GI:330838141"
                     /db_xref="InterPro:IPR001845"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:10496494"
                     /translation="MAEDQELARAAEMLKALSHPVRLCIARGLWQSGGCNVAHMQQCL
                     EAPQSTISQHLAKMRAVGIIEGERNGLEVVYRLKSRAVEQLLEGLFCKEKDYHDMG"
     misc_feature    313239..313466
                     /locus_tag="Selsp_0285"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    order(313239..313244,313248..313250,313257..313259,
                     313266..313271,313278..313283,313290..313292,
                     313383..313385,313440..313445,313449..313457,
                     313461..313466)
                     /locus_tag="Selsp_0285"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    order(313242..313247,313257..313265,313305..313313,
                     313338..313349,313353..313358,313365..313370,
                     313374..313379,313395..313403,313416..313424)
                     /locus_tag="Selsp_0285"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    order(313305..313307,313314..313316,313440..313442)
                     /locus_tag="Selsp_0285"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            join(313555..315582,315615..316124)
                     /locus_tag="Selsp_0286"
                     /pseudo
                     /db_xref="GeneID:10496495"
     gene            complement(316180..316662)
                     /locus_tag="Selsp_0287"
                     /db_xref="GeneID:10496496"
     CDS             complement(316180..316662)
                     /locus_tag="Selsp_0287"
                     /note="COGs: COG3467 flavin-nucleotide-binding protein;
                     InterPro IPR011576;
                     KEGG: cbi:CLJ_B0881 5-nitroimidazole resistance protein
                     NimA;
                     PFAM: Pyridoxamine 5'-phosphate oxidase-like, FMN-binding
                     domain;
                     SPTR: 5-nitroimidazole resistance protein NimA;
                     IMG reference gene:2504585745;
                     PFAM: Pyridoxamine 5'-phosphate oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-related
                     FMN-binding protein"
                     /protein_id="YP_004412722.1"
                     /db_xref="GI:330838142"
                     /db_xref="InterPro:IPR009002"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="GeneID:10496496"
                     /translation="MFREMRRKNQQMSDEEARDILAAATSGVLALAGENDYPYAVPMS
                     FAYDEEKERLLFHTARVGHKMTSIERCDKASFCIIAEDKVVPHRFLTQYRSVIAFGRL
                     RVLKSDEEKREAAEFLGEAYYPGHPEACDEEIKKHWPAFNMVELKIEHLTGKKGKDFV
                     "
     misc_feature    complement(316198..316650)
                     /locus_tag="Selsp_0287"
                     /note="Pyridoxamine 5'-phosphate oxidase; Region:
                     Pyridox_ox_2; cl17869"
                     /db_xref="CDD:266898"
     gene            316878..318233
                     /locus_tag="Selsp_0288"
                     /db_xref="GeneID:10496497"
     CDS             316878..318233
                     /locus_tag="Selsp_0288"
                     /note="COGs: COG0534 Na+-driven multidrug efflux pump;
                     InterPro IPR002528;
                     KEGG: amt:Amet_0616 MATE efflux family protein;
                     PFAM: Multi antimicrobial extrusion protein;
                     SPTR: Putative Na+ driven multidrug efflux pump;
                     IMG reference gene:2504585746;
                     PFAM: MatE"
                     /codon_start=1
                     /transl_table=11
                     /product="multi antimicrobial extrusion protein MatE"
                     /protein_id="YP_004412723.1"
                     /db_xref="GI:330838143"
                     /db_xref="InterPro:IPR002528"
                     /db_xref="InterPro:IPR015522"
                     /db_xref="GeneID:10496497"
                     /translation="MNTLAKHFSLGGLLRFAAPAVGMMLVISIYTVTDGIFIGRYAGS
                     LALAASNIVYPALNLVFGLSIMLSSGGSALVAKTLGEGDAALARGRFTLLAVVGAALG
                     ILFAGTVFLFMEPILALLGASPELYADCRAYLSANMFFAPFVVLMIIFNAFYIADGRP
                     VQGFLVSLTAGLVNVGLDYVFLAHFGMGIFGAGLATGISDVVAAVLGLVYFSRYSRTL
                     AFERFSFVVRPLFQALYNGSSEMVTQLSVGITTYLFNLVTFSYAGADGVAAISVILYA
                     EMLLTAILMGFANGVAPVFSYQFGAKGYAELLRLLRLSLGIIFLFGILSFAAANIFAV
                     PLMTLFLPDGGRAYALALGGFGLFSWSFLLCGFNLFSSTFFTALSDGRMSAILSFVRN
                     LVGIVVFLLLLPHFFGLDGAWLAVPAADAAAVLLSFRQLWGAARSFREEKAAGAVILE
                     R"
     misc_feature    316914..318116
                     /locus_tag="Selsp_0288"
                     /note="Multidrug and toxic compound extrusion family and
                     similar proteins; Region: MATE_like; cl09326"
                     /db_xref="CDD:263758"
     misc_feature    316914..318116
                     /locus_tag="Selsp_0288"
                     /note="Na+-driven multidrug efflux pump [Defense
                     mechanisms]; Region: NorM; COG0534"
                     /db_xref="CDD:223608"
     gene            318239..319846
                     /locus_tag="Selsp_0289"
                     /db_xref="GeneID:10496498"
     CDS             318239..319846
                     /locus_tag="Selsp_0289"
                     /note="InterPro IPR000064;
                     KEGG: afn:Acfer_1665 NLP/P60 protein;
                     PFAM: NLP/P60;
                     SPTR: NlpC/P60 family protein;
                     IMG reference gene:2504585747;
                     PFAM: NlpC/P60 family"
                     /codon_start=1
                     /transl_table=11
                     /product="NLP/P60 protein"
                     /protein_id="YP_004412724.1"
                     /db_xref="GI:330838144"
                     /db_xref="InterPro:IPR000064"
                     /db_xref="GeneID:10496498"
                     /translation="MCAKMNVSRNIGKHAACFLAAVGVFLGGADLTDAKAGTSAAAVL
                     SVTDAAAVSVQSASKAELADDMRAQTEAASLDYGVALGAPYDDAGFWCDAAGDRLLGT
                     AEDVARLNEELHANQPSLVSLAELPRAVSRRQLRHWMEEAAPEREDWYVPTEPLSDEA
                     YRATVENCAADRLPLRNPLRYGVTVRRADLRDLPTEEAWLDAPDDVHYDILQATAVDP
                     AEPLAVWHESADGKFLFVSMRYYRGWLARDAVALTTRETWLAYVQPEDFLVVTQNRYE
                     TPEEAGGQLYQLGSRIPLVQQGGAHLARLPQRAADGSLQEMFVPLPYSESASLAVEDA
                     GDMEAAALHRGSLPYTANNLRRAAFACLGDVYGWGGQDESVDCSSFVADVYRTVGIEL
                     PRDADEQEEAFLRASAHVGDEQNAAHGARGKAAAFGGRRCGTEDVAPHIFFTPLDDLT
                     PEERTEALLAAPPASLLFRPGHVMLTLGSVDGKTYVIHSLSGCWEKTQEGLKRCRIRR
                     VLVSDAYFLTSTEGRNLDDCTGVGSFR"
     misc_feature    318842..318979
                     /locus_tag="Selsp_0289"
                     /note="SH3 domain of the SH3b1 type; Region: SH3_6;
                     pfam12913"
                     /db_xref="CDD:205144"
     misc_feature    319325..>319453
                     /locus_tag="Selsp_0289"
                     /note="NlpC/P60 family; Region: NLPC_P60; cl17555"
                     /db_xref="CDD:266746"
     misc_feature    <319334..>319447
                     /locus_tag="Selsp_0289"
                     /note="Cell wall-associated hydrolases
                     (invasion-associated proteins) [Cell envelope biogenesis,
                     outer membrane]; Region: Spr; COG0791"
                     /db_xref="CDD:223862"
     gene            319953..320060
                     /locus_tag="Selsp_0290"
                     /pseudo
                     /db_xref="GeneID:10496499"
     gene            320426..322201
                     /locus_tag="Selsp_0291"
                     /db_xref="GeneID:10496500"
     CDS             320426..322201
                     /locus_tag="Selsp_0291"
                     /note="COGs: COG4295 conserved hypothetical protein;
                     InterPro IPR019261;
                     KEGG: fsu:Fisuc_1152 protein of unknown function DUF2263;
                     PFAM: Protein of unknown function DUF2263;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585749;
                     PFAM: Uncharacterized protein conserved in bacteria
                     (DUF2263);
                     TIGRFAM: TIGR02452 family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412725.1"
                     /db_xref="GI:330838145"
                     /db_xref="InterPro:IPR019261"
                     /db_xref="GeneID:10496500"
                     /translation="MKYIEDFNGRLKYRKRRDAFVDTQRIVLEDERLPGAWVRYGEKN
                     KDELQKSCWRRIYPRKCRIAVVQEPLVNVARALSVAYPKKCIVAVNPGSATRPGGRVH
                     IGESGVEESLCLCSDLYSVLELPGIWKKFYMKHLIGIYNTTEYPELMDEWLYSGDVTI
                     FKEIRDGVPELLPENEWGHIDVITSAPPGALADDLWTGYSGRSDLERAILRSVHLLQG
                     RNIFEAAIHEGGEYGNNVPHILVLPAFGCDLVWEDPTNFVADAYADLLRNYAEYFDMV
                     VFAAGRRSDVFCEAFEKKGLTVQTLEDIQETWQEEPELEEERKPYSTEDVILHALLGD
                     VEWLEMNDAWKQDPDREAWVREMLEEAEQSALKKAQERQQAEKALEKELKEPVLRQMA
                     EYSGGVSAEPNNKFCDVTGSILTAGWKCEAWKDKAWKDKAWKDKAWKDNADWYRAGIF
                     TDGKSFVEEGIRLPEDGINGVQEYRMFYIYALSSYEETEGKADDEKETLFMPMLPPQS
                     VLKKRAFAAKMKLGKISEDMWKFENYVRYLAGWGILLSPSNRYRGALQYMTDWRGKEV
                     VCVMIAMQDNDESYAFSGMGNSYWY"
     misc_feature    320429..321304
                     /locus_tag="Selsp_0291"
                     /note="Uncharacterized protein conserved in bacteria
                     (DUF2263); Region: DUF2263; cl19419"
                     /db_xref="CDD:267772"
     gene            complement(322345..322722)
                     /locus_tag="Selsp_0292"
                     /db_xref="GeneID:10496501"
     CDS             complement(322345..322722)
                     /locus_tag="Selsp_0292"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585750"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412726.1"
                     /db_xref="GI:330838146"
                     /db_xref="GeneID:10496501"
                     /translation="MTRLPSFDDFLDSTPFNSFLADSQTARHIYENIICTEEMQRKLT
                     EISDKGKPAILASGPAVEEYFRMHKDECDLRLKDDQVRQAIGRMNKEVLEALGYTKVR
                     DHVDLEKGFCEHFKSGTVFAKKA"
     gene            complement(322972..323316)
                     /locus_tag="Selsp_0293"
                     /db_xref="GeneID:10496502"
     CDS             complement(322972..323316)
                     /locus_tag="Selsp_0293"
                     /note="InterPro IPR002145;
                     KEGG: llc:LACR_C29 hypothetical protein;
                     PFAM: CopG-like DNA-binding;
                     SPTR: Ribbon-helix-helix protein, CopG family;
                     IMG reference gene:2504585751;
                     PFAM: Ribbon-helix-helix protein, copG family"
                     /codon_start=1
                     /transl_table=11
                     /product="CopG-like domain-containing protein DNA-binding
                     protein"
                     /protein_id="YP_004412727.1"
                     /db_xref="GI:330838147"
                     /db_xref="InterPro:IPR002145"
                     /db_xref="GeneID:10496502"
                     /translation="MKNLQVLLSDEEYAGLEKQAAQKGMPTSVYIRSLLLGEADELSK
                     AYIETIARVTALTPGTKFNLKSLFGTDWTQSRGTKLTLGRTFYEMVRSDTISMVKVLG
                     KDSSNIMQYERV"
     misc_feature    complement(322978..323175)
                     /locus_tag="Selsp_0293"
                     /note="Domain of unknown function (DUF1413); Region:
                     DUF1413; pfam07205"
                     /db_xref="CDD:254103"
     gene            complement(324030..324506)
                     /locus_tag="Selsp_0294"
                     /db_xref="GeneID:10496503"
     CDS             complement(324030..324506)
                     /locus_tag="Selsp_0294"
                     /note="InterPro IPR021215;
                     KEGG: tcu:Tcur_2876 putative transmembrane protein;
                     PFAM: Protein of unknown function DUF2752;
                     SPTR: Putative membrane protein;
                     IMG reference gene:2504585752;
                     PFAM: Protein of unknown function (DUF2752)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412728.1"
                     /db_xref="GI:330838148"
                     /db_xref="InterPro:IPR021215"
                     /db_xref="GeneID:10496503"
                     /translation="MNDTKKENPSAFGRFLFAAKTITGNAEGAARCFAAEQRTRAKVI
                     FQRYALLLAVGVAYLIFCRTTGLSLPCPFHAMTGLDCPGCGITRLMLSLSEGDLAAAF
                     HANEAIFILGPLLCIFLLRDDLHWILHGKRKEPPRPFVFFLLIVFAAFTIWRNFLR"
     misc_feature    complement(324144..324299)
                     /locus_tag="Selsp_0294"
                     /note="Protein of unknown function (DUF2752); Region:
                     DUF2752; pfam10825"
                     /db_xref="CDD:204556"
     gene            complement(324510..324881)
                     /locus_tag="Selsp_0295"
                     /db_xref="GeneID:10496504"
     CDS             complement(324510..324881)
                     /locus_tag="Selsp_0295"
                     /note="KEGG: cth:Cthe_0307 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585753"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412729.1"
                     /db_xref="GI:330838149"
                     /db_xref="GeneID:10496504"
                     /translation="MTKRSIPLAIVLSFITVGLYALYWVYTLTEDAHAAAGERTTASG
                     GMVILFSLLTCGIYSLYWLYKMGETIVMAKQKRGMTADTNLPIIYLVLALFGFGIISY
                     ALMQSALNDIIDHDGGISQAF"
     misc_feature    complement(324663..324872)
                     /locus_tag="Selsp_0295"
                     /note="Domain of unknown function (DUF4234); Region:
                     DUF4234; pfam14018"
                     /db_xref="CDD:258253"
     misc_feature    complement(324534..324749)
                     /locus_tag="Selsp_0295"
                     /note="Domain of unknown function (DUF4234); Region:
                     DUF4234; pfam14018"
                     /db_xref="CDD:258253"
     gene            complement(324936..325622)
                     /locus_tag="Selsp_0296"
                     /db_xref="GeneID:10496505"
     CDS             complement(324936..325622)
                     /locus_tag="Selsp_0296"
                     /note="KEGG: bpb:bpr_I0018 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585754"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412730.1"
                     /db_xref="GI:330838150"
                     /db_xref="GeneID:10496505"
                     /translation="MQIQKRDIALSIVLTVITCGIYGLYWMYKLTNEIHALSGKPRTV
                     DGGTAVLYTILTCSFYFYYWLYKIGGELVELRRENGLPPDSVSNKTYTIVTIVMTVIY
                     IVFTMLDYTFQFILSAAAEAAPVHHDSTEDAMAIGIVILAFIIGLLVTAIVQAILSGI
                     VLWAVYKRKDDSPTLVYLLMAILRTYNFTMAFLQASLNDFLQQKNCGAPPDPIFSADA
                     PRVSLQKPHA"
     misc_feature    complement(325389..325607)
                     /locus_tag="Selsp_0296"
                     /note="Domain of unknown function (DUF4234); Region:
                     DUF4234; pfam14018"
                     /db_xref="CDD:258253"
     misc_feature    complement(<325017..325601)
                     /locus_tag="Selsp_0296"
                     /note="ABC-type multidrug transport system, ATPase and
                     permease components [Defense mechanisms]; Region: MdlB;
                     COG1132"
                     /db_xref="CDD:224055"
     gene            complement(325714..326118)
                     /locus_tag="Selsp_0297"
                     /db_xref="GeneID:10496506"
     CDS             complement(325714..326118)
                     /locus_tag="Selsp_0297"
                     /note="COGs: COG1302 conserved hypothetical protein;
                     InterPro IPR005531;
                     KEGG: adg:Adeg_1282 protein of unknown function DUF322;
                     PFAM: Alkaline shock protein Asp23;
                     SPTR: Gls24 protein;
                     IMG reference gene:2504585755;
                     PFAM: Protein of unknown function (DUF322)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412731.1"
                     /db_xref="GI:330838151"
                     /db_xref="InterPro:IPR005531"
                     /db_xref="GeneID:10496506"
                     /translation="MAEDTAPLMTSNEGLGSIRVADEVVSVIAGLAAMDVDGVAGMSG
                     GLIGGIAEMLGRRNFSKGVKVEVGEQEAAVDLSIVVTYGVDIRHVATDVQKNVRRAIE
                     SMTGLKVVETNVQVQGVVFPEEEKEEPAARVR"
     misc_feature    complement(325753..326094)
                     /locus_tag="Selsp_0297"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG1302"
                     /db_xref="CDD:224221"
     gene            complement(326223..327407)
                     /locus_tag="Selsp_0298"
                     /db_xref="GeneID:10496507"
     CDS             complement(326223..327407)
                     /locus_tag="Selsp_0298"
                     /note="COGs: COG2367 Beta-lactamase class A;
                     KEGG: afn:Acfer_0879 beta-lactamase class A-like protein;
                     SPTR: Beta-lactamase;
                     IMG reference gene:2504585756;
                     PFAM: D-alanyl-D-alanine carboxypeptidase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412732.1"
                     /db_xref="GI:330838152"
                     /db_xref="InterPro:IPR001967"
                     /db_xref="InterPro:IPR012338"
                     /db_xref="GeneID:10496507"
                     /translation="MVKKRTQKSGKAGERAELQRKLDRLHADKKTPKKSSPWLKKAML
                     CTALLILVQTALCLGVAEYMWQKQNPDKPSPFLVALLDGSDAAQKELQEHWQSLTSAV
                     RAKQRGGEAEAAERSVQQDSSAAAKSAPPVPKLAERNSDQEALRADFSAILAPKSPDC
                     SVFLLRPREEKEPLLYQSHAMQPASMIKLFILAYAMQQAKDGTLSLAEPLSITEANIV
                     GGAGQLNWYDRGKQLTIEQLLERMITDSDNTATNILIDRLGIENIDGYIRQKGYADTR
                     LQHKMMLSNQGRPNLSSVKDIGTLLSLIYRGECVDYEHDKKMLQILSRQKDKDCLPSA
                     LPAFLVANKTGEITGVYADGGIAWSDAGDLILVVMDENCRDRQETIALFQRIAQRAAA
                     SL"
     misc_feature    complement(326304..326879)
                     /locus_tag="Selsp_0298"
                     /note="Beta-lactamase enzyme family; Region:
                     Beta-lactamase2; pfam13354"
                     /db_xref="CDD:257683"
     gene            complement(327401..328375)
                     /locus_tag="Selsp_0299"
                     /db_xref="GeneID:10496508"
     CDS             complement(327401..328375)
                     /locus_tag="Selsp_0299"
                     /note="COGs: COG0726 xylanase/chitin deacetylase;
                     InterPro IPR002509;
                     KEGG: dsy:DSY4849 hypothetical protein;
                     PFAM: Polysaccharide deacetylase;
                     SPTR: Peptidoglycan N-acetylglucosamine deacetylase A;
                     IMG reference gene:2504585757;
                     PFAM: Polysaccharide deacetylase"
                     /codon_start=1
                     /transl_table=11
                     /product="polysaccharide deacetylase"
                     /protein_id="YP_004412733.1"
                     /db_xref="GI:330838153"
                     /db_xref="InterPro:IPR002509"
                     /db_xref="InterPro:IPR011330"
                     /db_xref="GeneID:10496508"
                     /translation="MQKNTENTSGKNFLQNRHAKMFVLIACLMIACIAGWRIAWSELH
                     TEDNAAEPSTAQTTDSGAPAADPAKKTPPSGNYVVVSDDFSNLQITDAQTPVYDIYTL
                     AERREKGLPTEMPDLIPYTMPNVAYLTFDDGPDAKNTPAILDILKERGIHATFYVIGS
                     MAEAHPDVLKRIFAEGHAIGNHSYSHRYDILYPNKENFLEEIVHTDEVIYNILGVRPL
                     IVRAPGGAASMFKPGYSAMLKENGYVNHDWNVSSEDATGNNVSVQKILGSISYTCANR
                     PKDRGAIVLMHSKDGKETTVEALPAIIDMLQGAGFTFGVMTPRTAQPW"
     misc_feature    complement(327431..>328003)
                     /locus_tag="Selsp_0299"
                     /note="Predicted xylanase/chitin deacetylase [Carbohydrate
                     transport and metabolism]; Region: CDA1; COG0726"
                     /db_xref="CDD:223798"
     misc_feature    complement(327431..328003)
                     /locus_tag="Selsp_0299"
                     /note="Catalytic NodB homology domain of Streptococcus
                     mutans polysaccharide deacetylase PgdA, Bacillus subtilis
                     YheN, and similar proteins; Region: CE4_SmPgdA_like;
                     cd10944"
                     /db_xref="CDD:200569"
     misc_feature    complement(order(327515..327517,327521..327523,
                     327611..327616,327632..327634,327704..327709,
                     327713..327715,327815..327832,327980..327991))
                     /locus_tag="Selsp_0299"
                     /note="NodB motif; other site"
                     /db_xref="CDD:200569"
     misc_feature    complement(order(327515..327517,327521..327523,
                     327632..327634,327701..327709,327818..327820,
                     327830..327832,327980..327985))
                     /locus_tag="Selsp_0299"
                     /note="active site"
                     /db_xref="CDD:200569"
     misc_feature    complement(order(327515..327517,327614..327616,
                     327713..327715,327983..327985))
                     /locus_tag="Selsp_0299"
                     /note="catalytic site [active]"
                     /db_xref="CDD:200569"
     misc_feature    complement(order(327818..327820,327830..327832,
                     327980..327982))
                     /locus_tag="Selsp_0299"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:200569"
     gene            complement(328443..329495)
                     /locus_tag="Selsp_0300"
                     /db_xref="GeneID:10496509"
     CDS             complement(328443..329495)
                     /locus_tag="Selsp_0300"
                     /EC_number="2.6.1.9"
                     /note="COGs: COG0079 Histidinol-phosphate/aromatic
                     aminotransferase and cobyric acid decarboxylase;
                     InterPro IPR004839:IPR005861;
                     KEGG: eel:EUBELI_00629 histidinol-phosphate
                     aminotransferase;
                     PFAM: Aminotransferase, class I/classII;
                     PRIAM: Histidinol-phosphate transaminase;
                     SPTR: Histidinol-phosphate aminotransferase;
                     TIGRFAM: Histidinol-phosphate aminotransferase;
                     IMG reference gene:2504585758;
                     PFAM: Aminotransferase class I and II;
                     TIGRFAM: histidinol-phosphate aminotransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="YP_004412734.1"
                     /db_xref="GI:330838154"
                     /db_xref="InterPro:IPR001917"
                     /db_xref="InterPro:IPR004839"
                     /db_xref="InterPro:IPR005861"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496509"
                     /translation="MSLYDNIRRVTPYVPGEQPAGKVIKLNTNECPYAPSPRVAEAIA
                     VCDAGRLRLYPEPDCHTLKESIAAHYAVKPDEVFVGVGSDDVLALAFLTFFAGEKPVL
                     FPDITYSFYDVWAELYAIPYETVPLAADFTLRPEDYARENGGVIFANPNAPTGLALPL
                     SGVEEILAKNPESVVIVDEAYVDFGAETALPLLKKYENLVVVRTMSKSRALAGMRIGY
                     AFAAKRLIRAMEDVKASINSYTMTTLSLAAGKAAIEDEDYFQQTLGKIIKTREETKAS
                     LQKLGFSVTESKTNFLFARNPNIPAQTLFETLRKRGIYVRYFKKPRIDEHLRITIGTD
                     EDMKQLLEELRCLSKR"
     misc_feature    complement(328461..329495)
                     /locus_tag="Selsp_0300"
                     /note="histidinol-phosphate aminotransferase; Provisional;
                     Region: PRK05387"
                     /db_xref="CDD:235440"
     misc_feature    complement(328461..329426)
                     /locus_tag="Selsp_0300"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(328851..328853,328875..328880,
                     328884..328886,328953..328955,329040..329042,
                     329172..329174,329244..329252))
                     /locus_tag="Selsp_0300"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(328752..328754,328761..328763,
                     328851..328859,328974..328976,329142..329144,
                     329241..329243))
                     /locus_tag="Selsp_0300"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(328875..328877)
                     /locus_tag="Selsp_0300"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            329670..330314
                     /locus_tag="Selsp_0301"
                     /db_xref="GeneID:10496510"
     CDS             329670..330314
                     /locus_tag="Selsp_0301"
                     /note="KEGG: str:Sterm_1305 protein of unknown function
                     DUF1121;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585759;
                     PFAM: Uncharacterised ACR, YkgG family COG1556"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412735.1"
                     /db_xref="GI:330838155"
                     /db_xref="InterPro:IPR003741"
                     /db_xref="GeneID:10496510"
                     /translation="MTEDGKVREKERIERTLEAFRRNRYDVSLFQTKEEAADYLAREI
                     AGKRVGFGDSETLRALRLYEKLSVKNEVIDPARSGHIGGLEAFLGAGREALMTDVFLL
                     SANAITEAGQIVNMDGAGNRIAGSLFGHEKTYFVCGVNKLVKDVEAAIERIHAIAAPQ
                     NAARKKKRTPCAAKGDRCYDCTSPERICNALTIHYKKMSYRPMELVLIEECLGL"
     misc_feature    329706..330236
                     /locus_tag="Selsp_0301"
                     /note="Uncharacterized ACR, YkgG family COG1556; Region:
                     DUF162; pfam02589"
                     /db_xref="CDD:251397"
     gene            complement(330805..332001)
                     /locus_tag="Selsp_0302"
                     /db_xref="GeneID:10496511"
     CDS             complement(330805..332001)
                     /locus_tag="Selsp_0302"
                     /note="COGs: COG1472 Beta-glucosidase-related glycosidase;
                     InterPro IPR001764;
                     KEGG: vpr:Vpar_1773 glycoside hydrolase family 3 domain
                     protein;
                     PFAM: Glycoside hydrolase, family 3, N-terminal;
                     SPTR: Beta-hexosaminidase;
                     IMG reference gene:2504585760;
                     PFAM: Glycosyl hydrolase family 3 N terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="glycoside hydrolase family 3 domain protein"
                     /protein_id="YP_004412736.1"
                     /db_xref="GI:330838156"
                     /db_xref="InterPro:IPR001764"
                     /db_xref="InterPro:IPR017853"
                     /db_xref="GeneID:10496511"
                     /translation="MTKNRANRKTSLVPLLLCLIIFCTSLLLAGCLARSDDAASKDSA
                     ASHTQKGLSPDEKAAAIVQKMSDAEKVGQLLMIGIQGAELDADSRFMLSEYHIGGVIL
                     FDRNMKSQEQVRALNDSLQKNASDAGLPLFLAIDEEGGAVARMKEAFLPPPAAAEIGR
                     TGDPQAAYRYAADTAHGLKAMGFNLNFAPVADLGATYGRSYADDAATATKFVAAALEG
                     HADAGLLATLKHFPGLGRGESDTHEDTVTVRADRATLEASDLVPFREMITKRNAAKNA
                     KGASGWFVMATHTMYPALDAKNPASLSPAILQGLLREELSYDGVIVTDDLEMGAISRH
                     YGFDRAGVEAILAGADLVLVCHDYAHETAVYNGLLKAVKSGEISKDRLDASVRRIVKA
                     KIEYLE"
     misc_feature    complement(<330814..331809)
                     /locus_tag="Selsp_0302"
                     /note="Beta-glucosidase-related glycosidases [Carbohydrate
                     transport and metabolism]; Region: BglX; COG1472"
                     /db_xref="CDD:224389"
     gene            complement(332028..332915)
                     /locus_tag="Selsp_0303"
                     /db_xref="GeneID:10496512"
     CDS             complement(332028..332915)
                     /locus_tag="Selsp_0303"
                     /note="KEGG: ere:EUBREC_1021 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585761;
                     TIGRFAM: conserved hypothetical protein (putative
                     transposase or invertase)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412737.1"
                     /db_xref="GI:330838157"
                     /db_xref="GeneID:10496512"
                     /translation="MTIFDTPERQKVYRDIIKKLRLIDDAFFNSCFDGDIACMELLLQ
                     IIFGNPQLRVEEVLTQRSVPNLFGRGVRFDAIATDGERIFDVEVQRDDEGADPMRARY
                     NSCMMDARELDKGKDFRELPETYVIFITEHDVWKGNRPLYHVQKSFAETGVAFDDGAH
                     IIYVNAAYQDDTPLGRLMHDFFCENPNDMHYSVLANRARFFKENERGASTMCKLIEDL
                     VKSDLEHILKAEVAEAEVRGEARGEARGEARGKAHGEESAFLSSIRNLMKNAGVSPEK
                     AMDLLGIDAMARSKYMSLL"
     misc_feature    complement(332064..332768)
                     /locus_tag="Selsp_0303"
                     /note="conserved hypothetical protein (putative
                     transposase or invertase); Region: T_den_put_tspse;
                     TIGR01784"
                     /db_xref="CDD:130844"
     misc_feature    complement(<332523..>332723)
                     /locus_tag="Selsp_0303"
                     /note="PD-(D/E)XK nuclease family transposase; Region:
                     PDDEXK_2; pfam12784"
                     /db_xref="CDD:257294"
     gene            complement(333063..333413)
                     /locus_tag="Selsp_0304"
                     /db_xref="GeneID:10496513"
     CDS             complement(333063..333413)
                     /locus_tag="Selsp_0304"
                     /note="KEGG: afn:Acfer_2052 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585762"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412738.1"
                     /db_xref="GI:330838158"
                     /db_xref="GeneID:10496513"
                     /translation="MDKQTLIEKVKEIVSAPSCYEGLRKLGEDWLASIGTDAEKKLSE
                     KLIAALKEDVSSIDASLAFFQSDEAKSIFGSEEAANLAKKAEEFKAAGNKICFCPACQ
                     AGETVLENASVLLK"
     gene            333630..334502
                     /locus_tag="Selsp_0305"
                     /db_xref="GeneID:10496514"
     CDS             333630..334502
                     /locus_tag="Selsp_0305"
                     /EC_number="1.8.1.9"
                     /note="COGs: COG0492 Thioredoxin reductase;
                     InterPro IPR013027;
                     KEGG: cpy:Cphy_1503 thioredoxin-disulfide reductase;
                     PFAM: FAD-dependent pyridine nucleotide-disulphide
                     oxidoreductase;
                     PRIAM: Thioredoxin-disulfide reductase;
                     SPTR: Thioredoxin-disulfide reductase;
                     IMG reference gene:2504585763;
                     PFAM: Pyridine nucleotide-disulphide oxidoreductase"
                     /codon_start=1
                     /transl_table=11
                     /product="Thioredoxin-disulfide reductase"
                     /protein_id="YP_004412739.1"
                     /db_xref="GI:330838159"
                     /db_xref="InterPro:IPR000103"
                     /db_xref="InterPro:IPR013027"
                     /db_xref="GeneID:10496514"
                     /translation="MKHLLVIGQGPAGVSAAVYAKRGGAAVTVVANGVGALEKAERIE
                     NYYGFGEPLTGRELAAQGVEGAKRLGVDFVEGELVGLRFKDTMDGFVAELVHRTLEAD
                     AVVLAMGASRLAPPLSGLKELEGHGVSYCAICDAFFYRGKEAAVLGAGDYALAEAAAL
                     LPHAAKVHLLTNGEAAPAHVPAGLLVHTERLAAVEGEGRVERVVFAGGTALPVSGVFV
                     AVGTAGSTAIAKKLGILLDGVYLKVNEKMETNVPGVFAAGDATGGLLQVAKAVHEGAV
                     AGLSALKFLRGKKA"
     misc_feature    333630..334496
                     /locus_tag="Selsp_0305"
                     /note="Thioredoxin reductase [Posttranslational
                     modification, protein turnover, chaperones]; Region: TrxB;
                     COG0492"
                     /db_xref="CDD:223566"
     misc_feature    333639..>333740
                     /locus_tag="Selsp_0305"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            334718..336820
                     /locus_tag="Selsp_0306"
                     /db_xref="GeneID:10496515"
     CDS             334718..336820
                     /locus_tag="Selsp_0306"
                     /note="COGs: COG0840 Methyl-accepting chemotaxis protein;
                     InterPro IPR013702:IPR004089:IPR019494;
                     KEGG: sdl:Sdel_0982 domain of unknown function DUF1745;
                     PFAM: FIST C domain; FIST domain, N-terminal; Chemotaxis
                     methyl-accepting receptor, signalling;
                     SMART: FIST domain, N-terminal; Chemotaxis
                     methyl-accepting receptor, signalling;
                     SPTR: Putative mcp-domain signal transduction protein;
                     IMG reference gene:2504585764;
                     PFAM: FIST C domain; Methyl-accepting chemotaxis protein
                     (MCP) signaling domain; FIST N domain"
                     /codon_start=1
                     /transl_table=11
                     /product="methyl-accepting chemotaxis sensory transducer"
                     /protein_id="YP_004412740.1"
                     /db_xref="GI:330838160"
                     /db_xref="InterPro:IPR004089"
                     /db_xref="InterPro:IPR013702"
                     /db_xref="InterPro:IPR019494"
                     /db_xref="GeneID:10496515"
                     /translation="MFDFLKSRKDEEGKSSLRDRVDAKPLPQVQKAAAQNKAPAARDL
                     QGADVAVCYLHRSEIARENLAPIASLPDGAAIVLGFVSPDLDLTDVGRAVQQALGKEV
                     RVVLMTDAGELCRPQGSATLYQEAGEGRARVLLQGYSRRMIEGVFTMSVPLHSQDLKA
                     DRIDMSLEARLQAIKGELERHTPPFRISLYHTFALVYIDGLSRSETFLMQALYESRKF
                     PCPYIGGSSAPDAHGRACVYDGEASLEDHAVITLVRLRRGYRYGIFKTQAVEKTDTSF
                     IIDKASTALRSVETLQLSSGETLPALEALKRTLGVHSAADLDAAMQKYTFASDINEDF
                     FIRSVSALDHARGRLNLYCDIVTGERLHLMKRGSLADTLAKGLIDFQRGKPAPLGGIL
                     NDCILRRLCYASETGRIDEFRDVPVAGFSSFGEIAGLHVNETLTALFFYHVPSGVSFR
                     DDYIDNFASIYADCDAFFFRRMIDRQAHVGALKDDLVAMFRDYQQKIPAIIDSITRIS
                     DEVHAIQAALKNLSDGSAEQKQLFAQIVRQGEEIGPTLEKLAQDTKRIDEVIRLIAGI
                     ASQINLLALNATIEAARAGEAGRGFAVVAQEVGKLSGTTQENLTASDEAVRKLLHEVR
                     KIDAIMEANEEMEKKIRAFDAQFNEQMTVLQKTLEGSLVHIAESARSVSELEKVSESA
                     NMRMEAINLLIRNIERGA"
     misc_feature    334937..335560
                     /locus_tag="Selsp_0306"
                     /note="FIST N domain; Region: FIST; smart00897"
                     /db_xref="CDD:214894"
     misc_feature    335618..336004
                     /locus_tag="Selsp_0306"
                     /note="FIST C domain; Region: FIST_C; pfam10442"
                     /db_xref="CDD:255992"
     misc_feature    336218..336787
                     /locus_tag="Selsp_0306"
                     /note="Methyl-accepting chemotaxis protein (MCP),
                     signaling domain; Region: MCP_signal; cl19050"
                     /db_xref="CDD:267403"
     misc_feature    order(336224..336229,336236..336241,336248..336250,
                     336257..336259,336263..336268,336275..336277,
                     336284..336289,336296..336298,336305..336310,
                     336317..336322,336329..336331,336338..336343,
                     336347..336352,336353..336355,336359..336364,
                     336371..336373,336380..336385,336392..336397,
                     336404..336406,336413..336415,336422..336427,
                     336434..336436,336446..336448,336455..336457,
                     336476..336478,336488..336490,336497..336499,
                     336506..336511,336518..336520,336527..336532,
                     336539..336544,336548..336553,336560..336565,
                     336602..336607,336614..336616,336623..336628,
                     336635..336637,336644..336649,336653..336658,
                     336665..336670,336677..336679,336686..336691,
                     336698..336700,336707..336712,336716..336721,
                     336728..336733,336737..336742,336749..336751,
                     336758..336763,336770..336772,336779..336784)
                     /locus_tag="Selsp_0306"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:206779"
     misc_feature    336422..336523
                     /locus_tag="Selsp_0306"
                     /note="putative CheW interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:206779"
     gene            336830..337546
                     /locus_tag="Selsp_0307"
                     /db_xref="GeneID:10496516"
     CDS             336830..337546
                     /locus_tag="Selsp_0307"
                     /note="COGs: COG1296 branched-chain amino acid permease
                     (azaleucine resistance);
                     InterPro IPR011606;
                     KEGG: afn:Acfer_1854 AzlC family protein;
                     PFAM: Branched-chain amino acid transport, permease;
                     SPTR: Branched-chain amino acid transport protein AzlC;
                     IMG reference gene:2504585765;
                     PFAM: AzlC protein;
                     TIGRFAM: 4-azaleucine resistance probable transporter
                     AzlC"
                     /codon_start=1
                     /transl_table=11
                     /product="AzlC family protein"
                     /protein_id="YP_004412741.1"
                     /db_xref="GI:330838161"
                     /db_xref="InterPro:IPR011606"
                     /db_xref="GeneID:10496516"
                     /translation="MTLRGSGAKARALRAAFPRTVPILAGFLFLGMAYGVYMHVLGFS
                     FWYPVVMAVVIFGGSLEFVAGTLLLSPFAPVQAFFIALMIQARHLFYGLSMLEKYKGL
                     GAKRIYLIYGLCDETFSIAYTTRLPQDVDRGWFYFFVTLLNQLYWVAGTALGSLVGGL
                     MSFDTSGLGFVMTAMFVVIFLEQFLHEKQHISAAVGFLAAGVCLFFFGTDDFLIPTMV
                     LILLFLTALRRSIARKGGFR"
     misc_feature    336863..337522
                     /locus_tag="Selsp_0307"
                     /note="AzlC protein; Region: AzlC; cl00570"
                     /db_xref="CDD:260507"
     gene            337543..337872
                     /locus_tag="Selsp_0308"
                     /db_xref="GeneID:10496517"
     CDS             337543..337872
                     /locus_tag="Selsp_0308"
                     /note="COGs: COG1687 branched-chain amino acid permease
                     (azaleucine resistance);
                     InterPro IPR008407;
                     KEGG: afn:Acfer_1855 branched-chain amino acid transport;
                     PFAM: Branched-chain amino acid transport, AzlD;
                     SPTR: Branched-chain amino acid transport protein AzlD;
                     IMG reference gene:2504585766;
                     PFAM: Branched-chain amino acid transport protein (AzlD)"
                     /codon_start=1
                     /transl_table=11
                     /product="branched-chain amino acid transport"
                     /protein_id="YP_004412742.1"
                     /db_xref="GI:330838162"
                     /db_xref="InterPro:IPR008407"
                     /db_xref="GeneID:10496517"
                     /translation="MSFSEEAATITLCALATLLTRAVPFLIFSGRKPTPAYVRYLGDA
                     LPAAIFAMLVVYCLKDVAWLAAPHGLPELLGVAVTVGLHVWRRQFLFSIAGGTVCYML
                     LIQFVFI"
     misc_feature    337546..337866
                     /locus_tag="Selsp_0308"
                     /note="Predicted branched-chain amino acid permeases
                     (azaleucine resistance) [Amino acid transport and
                     metabolism]; Region: AzlD; COG1687"
                     /db_xref="CDD:224601"
     gene            complement(337985..338293)
                     /locus_tag="Selsp_0309"
                     /db_xref="GeneID:10496518"
     CDS             complement(337985..338293)
                     /locus_tag="Selsp_0309"
                     /note="COGs: COG3118 Thioredoxin domain-containing
                     protein;
                     InterPro IPR005746:IPR013766;
                     KEGG: csh:Closa_4027 thioredoxin;
                     PFAM: Thioredoxin domain;
                     SPTR: Thioredoxin;
                     TIGRFAM: Thioredoxin;
                     IMG reference gene:2504585767;
                     PFAM: Thioredoxin;
                     TIGRFAM: thioredoxin"
                     /codon_start=1
                     /transl_table=11
                     /product="thioredoxin"
                     /protein_id="YP_004412743.1"
                     /db_xref="GI:330838163"
                     /db_xref="InterPro:IPR005746"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="InterPro:IPR013766"
                     /db_xref="InterPro:IPR017936"
                     /db_xref="InterPro:IPR017937"
                     /db_xref="GeneID:10496518"
                     /translation="MNAIEITKENFESEVTAAKGAVLLDFWAPWCGPCRMLTPVIDEV
                     AAGHPDLKVGKVNIDEQPDLAVRFGVQSIPTLIVFKDGKKTKESVGFVPREMVESLLD
                     "
     misc_feature    complement(337988..338269)
                     /locus_tag="Selsp_0309"
                     /note="TRX family; composed of two groups: Group I, which
                     includes proteins that exclusively encode a TRX domain;
                     and Group II, which are composed of fusion proteins of TRX
                     and additional domains. Group I TRX is a small ancient
                     protein that alter the redox...; Region: TRX_family;
                     cd02947"
                     /db_xref="CDD:239245"
     misc_feature    complement(order(338192..338194,338201..338203))
                     /locus_tag="Selsp_0309"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239245"
     gene            338501..339064
                     /locus_tag="Selsp_0310"
                     /db_xref="GeneID:10496519"
     CDS             338501..339064
                     /locus_tag="Selsp_0310"
                     /EC_number="4.2.1.1"
                     /note="COGs: COG0288 Carbonic anhydrase;
                     InterPro IPR001765;
                     KEGG: vpr:Vpar_1311 carbonic anhydrase;
                     PFAM: Carbonic anhydrase;
                     PRIAM: Carbonate dehydratase;
                     SMART: Carbonic anhydrase;
                     SPTR: Carbonate dehydratase;
                     IMG reference gene:2504585768;
                     PFAM: Carbonic anhydrase"
                     /codon_start=1
                     /transl_table=11
                     /product="Carbonate dehydratase"
                     /protein_id="YP_004412744.1"
                     /db_xref="GI:330838164"
                     /db_xref="InterPro:IPR001765"
                     /db_xref="GeneID:10496519"
                     /translation="MTRLEEMLQANEAYCKNPPVDYTGEDAHESKLPKKKIAVFTCMD
                     TRLVELLEPALGLKRGDAKFVKTVGNTLIGPFDGVVRSLMVATYELGIEEIFVVGHDE
                     CGMAKTTAKSLIEAMHARGVDDAAIAPLREELVHWADSFSHPAENVKEVVQKLRENPL
                     LPKDLKIHGLMLHPRTGKVDLIESGDA"
     misc_feature    338597..339046
                     /locus_tag="Selsp_0310"
                     /note="Carbonic anhydrases (CA) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism in which the nucleophilic
                     attack of a zinc-bound hydroxide ion on carbon dioxide is
                     followed by the regeneration of an...; Region:
                     beta_CA_cladeD; cd03379"
                     /db_xref="CDD:239474"
     misc_feature    order(338597..338599,338603..338605,338624..338626,
                     338630..338638,338678..338680,338687..338689,
                     338753..338755,338768..338770,338798..338800,
                     338807..338809,339014..339016)
                     /locus_tag="Selsp_0310"
                     /note="active site clefts [active]"
                     /db_xref="CDD:239474"
     misc_feature    order(338624..338626,338630..338632,338798..338800,
                     338807..338809)
                     /locus_tag="Selsp_0310"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:239474"
     misc_feature    order(338627..338638,338660..338665,338678..338686,
                     338690..338692,338696..338698,338738..338743,
                     338750..338755,339014..339016,339020..339025,
                     339029..339031,339035..339037)
                     /locus_tag="Selsp_0310"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:239474"
     gene            339122..339637
                     /locus_tag="Selsp_0311"
                     /db_xref="GeneID:10496520"
     CDS             339122..339637
                     /locus_tag="Selsp_0311"
                     /note="COGs: COG4720 membrane protein;
                     InterPro IPR009825;
                     KEGG: eel:EUBELI_20609 hypothetical protein;
                     PFAM: Protein of unknown function DUF1393;
                     SPTR: Putative membrane spanning protein;
                     IMG reference gene:2504585769;
                     PFAM: Protein of unknown function (DUF1393)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412745.1"
                     /db_xref="GI:330838165"
                     /db_xref="InterPro:IPR009825"
                     /db_xref="GeneID:10496520"
                     /translation="MMAARRKNRDFTAKDLVLTALMTAIVFLATFVPHIPIPLGYAHL
                     GDAAIFLFALLAPRRSALFAACFGSALADFMSGFALWIVPTLVIKFVMAEIVCRMADA
                     ASLVGRIGVALTLSSLWMAAAYTFAGAVLYDSLAAALASFPGLFAEGVVNSVLALAAL
                     PFLRGRFLRKD"
     misc_feature    339152..339592
                     /locus_tag="Selsp_0311"
                     /note="ECF-type riboflavin transporter, S component;
                     Region: ECF-ribofla_trS; pfam07155"
                     /db_xref="CDD:254082"
     gene            339659..340768
                     /locus_tag="Selsp_0312"
                     /db_xref="GeneID:10496521"
     CDS             339659..340768
                     /locus_tag="Selsp_0312"
                     /note="COGs: COG1060 Thiamine biosynthesis protein ThiH;
                     InterPro IPR022432:IPR020050:IPR006638:IPR007197;
                     KEGG: slp:Slip_1167 radical SAM domain protein;
                     PFAM: Radical SAM;
                     SMART: Elongator protein 3/MiaB/NifB;
                     SPTR: Menaquinone biosynthesis protein, SCO4494 family;
                     TIGRFAM: Menaquinone biosynthesis, SCO4494, predicted; FO
                     synthase, subunit 2;
                     IMG reference gene:2504585770;
                     PFAM: Radical SAM superfamily;
                     TIGRFAM: putative menaquinone biosynthesis protein,
                     SCO4494 family; radical SAM domain protein, CofH
                     subfamily"
                     /codon_start=1
                     /transl_table=11
                     /product="putative menaquinone biosynthesis protein"
                     /protein_id="YP_004412746.1"
                     /db_xref="GI:330838166"
                     /db_xref="InterPro:IPR005244"
                     /db_xref="InterPro:IPR007197"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:10496521"
                     /translation="MTELLAPKGYEDIEEKVLAKERLTREDGVRLFDCRNIAWLGALA
                     DHVRCEKCGDVVYYNVNCHVNLTNICRAHCKFCAFGRDAEDKGAYEMEAADAIAVVED
                     AMKDPHLAGLHVVSGLHPEWSFDDYLARLRALHERFPKLYLKGFTGVEITHFSKISGL
                     SVREVLERLKAAGLDAIAGGGAEILSDRIREELCPNKATAKEWLDAARTAHELGIKSN
                     ASMLYGHIETLAERVDHLLALRSLQDETGGFQTFICFPFLPKNTALAAESGISQTSMW
                     DDLRTMAISRLMLDNFTNIKAYWVMLTVPVAQVALGFGANDIDGTVHKETILHDAGAK
                     SPRALTEDRIIRIVKEAGRIPAACDCNFNILHVYE"
     misc_feature    339695..340753
                     /locus_tag="Selsp_0312"
                     /note="putative menaquinone biosynthesis protein, SCO4494
                     family; Region: mena_SCO4494; TIGR03700"
                     /db_xref="CDD:213851"
     misc_feature    339848..340510
                     /locus_tag="Selsp_0312"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    order(339866..339868,339872..339874,339878..339880,
                     339884..339892,340001..340003,340007..340009,
                     340121..340129,340199..340201,340322..340324,
                     340424..340429)
                     /locus_tag="Selsp_0312"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     gene            complement(340789..341119)
                     /locus_tag="Selsp_0313"
                     /pseudo
                     /db_xref="GeneID:10496522"
     gene            complement(341116..341439)
                     /locus_tag="Selsp_0314"
                     /db_xref="GeneID:10496523"
     CDS             complement(341116..341439)
                     /locus_tag="Selsp_0314"
                     /note="KEGG: dae:Dtox_0466 hypothetical protein;
                     SPTR: Toxin-antitoxin system, antitoxin component, PHD
                     family;
                     IMG reference gene:2504585772;
                     PFAM: Phd_YefM"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412747.1"
                     /db_xref="GI:330838167"
                     /db_xref="InterPro:IPR006442"
                     /db_xref="GeneID:10496523"
                     /translation="MPQIRPLPPTIPITAFNRGQAGKIFSNVKQIGMTVVMKNNEPEC
                     VLLSPADYNALVERLEDADLLHLASERLKDFDSKEQAAIPFEEVCKRNGIDLPSLDFE
                     SVEIE"
     misc_feature    complement(341218..341412)
                     /locus_tag="Selsp_0314"
                     /note="Antitoxin Phd_YefM, type II toxin-antitoxin system;
                     Region: PhdYeFM_antitox; pfam02604"
                     /db_xref="CDD:251410"
     gene            341730..342089
                     /locus_tag="Selsp_0315"
                     /db_xref="GeneID:10496524"
     CDS             341730..342089
                     /locus_tag="Selsp_0315"
                     /note="COGs: COG1393 Arsenate reductase and related
                     protein glutaredoxin family;
                     InterPro IPR006504:IPR006660;
                     KEGG: cth:Cthe_1508 hypothetical protein;
                     PFAM: Arsenate reductase-like;
                     SPTR: ArsC family protein;
                     TIGRFAM: Transcriptional regulator Spx/MgsR;
                     IMG reference gene:2504585773;
                     PFAM: ArsC family;
                     TIGRFAM: transcriptional regulator, Spx/MgsR family"
                     /codon_start=1
                     /transl_table=11
                     /product="ArsC family protein"
                     /protein_id="YP_004412748.1"
                     /db_xref="GI:330838168"
                     /db_xref="InterPro:IPR006660"
                     /db_xref="InterPro:IPR012335"
                     /db_xref="InterPro:IPR012336"
                     /db_xref="GeneID:10496524"
                     /translation="MKKGLFVCYPRCTTCQKARRWLEERGALVEERDIKEERPTADEL
                     RAWHAKSGLPLKRFFNTSGLKYKELGLKDKLPTLSEAAQYDLLASDGMLVKRPLLVAA
                     DFVLVGFKEKEWQERFE"
     misc_feature    341745..342071
                     /locus_tag="Selsp_0315"
                     /note="Arsenate Reductase (ArsC) family, unknown
                     subfamily; uncharacterized proteins containing a CXXC
                     motif with similarity to thioredoxin (TRX)-fold arsenic
                     reductases, ArsC. Proteins containing a redox active CXXC
                     motif like TRX and glutaredoxin (GRX)...; Region:
                     ArsC_like; cd03036"
                     /db_xref="CDD:239334"
     misc_feature    order(341763..341765,341907..341909,342015..342017,
                     342054..342056)
                     /locus_tag="Selsp_0315"
                     /note="putative ArsC-like catalytic residues; other site"
                     /db_xref="CDD:239334"
     misc_feature    order(341763..341765,341772..341774)
                     /locus_tag="Selsp_0315"
                     /note="putative TRX-like catalytic residues [active]"
                     /db_xref="CDD:239334"
     gene            342324..342665
                     /locus_tag="Selsp_0316"
                     /db_xref="GeneID:10496525"
     CDS             342324..342665
                     /locus_tag="Selsp_0316"
                     /note="KEGG: hor:Hore_17170 flagellar protein;
                     SPTR: Flagellar protein;
                     IMG reference gene:2504585774"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein"
                     /protein_id="YP_004412749.1"
                     /db_xref="GI:330838169"
                     /db_xref="GeneID:10496525"
                     /translation="MNGNLKNCPSCGKLFIAQPKQRLCMDCFEKQREEEERIIRYVNA
                     HPEVTTLDEIAAGTGAEPKEILRMIHDSRLLQADREIRYPCESCGTLITRGRYCAGCM
                     RDFKAGADRIG"
     misc_feature    342330..>342647
                     /locus_tag="Selsp_0316"
                     /note="flagellar operon protein TIGR03826; Region: YvyF"
                     /db_xref="CDD:163538"
     gene            342870..343163
                     /locus_tag="Selsp_0317"
                     /db_xref="GeneID:10496526"
     CDS             342870..343163
                     /locus_tag="Selsp_0317"
                     /note="InterPro IPR007412;
                     PFAM: Anti-sigma-28 factor, FlgM;
                     SPTR: Negative regulator of flagellin synthesis FlgM;
                     IMG reference gene:2504585775;
                     PFAM: Anti-sigma-28 factor, FlgM"
                     /codon_start=1
                     /transl_table=11
                     /product="Anti-sigma-28 factor FlgM family protein"
                     /protein_id="YP_004412750.1"
                     /db_xref="GI:330838170"
                     /db_xref="InterPro:IPR007412"
                     /db_xref="GeneID:10496526"
                     /translation="MSIQVQGRVQALYGVYAANEALSAVQTQERYRPEAPRKDAVVLS
                     EEGRTFGEILNRLKADNDKVREDKVGLYEERIAAGDYYVAGRDIAAKMLDQRI"
     misc_feature    342984..343154
                     /locus_tag="Selsp_0317"
                     /note="Anti-sigma-28 factor, FlgM; Region: FlgM;
                     pfam04316"
                     /db_xref="CDD:252522"
     gene            343203..343688
                     /locus_tag="Selsp_0318"
                     /db_xref="GeneID:10496527"
     CDS             343203..343688
                     /locus_tag="Selsp_0318"
                     /note="InterPro IPR007809;
                     PFAM: FlgN-like domain;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585776;
                     PFAM: FlgN protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FlgN family protein"
                     /protein_id="YP_004412751.1"
                     /db_xref="GI:330838171"
                     /db_xref="InterPro:IPR007809"
                     /db_xref="GeneID:10496527"
                     /translation="MWREMKEVMRALSSCYAELVRVSEAKHKALAAMDLKAIERAVKE
                     EERFAAEIERLETRRKAALRVMAEKEAGIRPTMKMRELLAQCPDRRIAGELAALHEEL
                     DRRMKEVERFGERNTLLAEGALAAVTANLNRIGGTAAGASYGAGGKESVTRERRFDFK
                     A"
     misc_feature    343212..343604
                     /locus_tag="Selsp_0318"
                     /note="FlgN protein; Region: FlgN; pfam05130"
                     /db_xref="CDD:253028"
     gene            343693..344166
                     /locus_tag="Selsp_0319"
                     /db_xref="GeneID:10496528"
     CDS             343693..344166
                     /locus_tag="Selsp_0319"
                     /note="InterPro IPR007809;
                     KEGG: toc:Toce_1598 FlgN family protein;
                     PFAM: FlgN-like domain;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585777;
                     PFAM: FlgN protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FlgN family protein"
                     /protein_id="YP_004412752.1"
                     /db_xref="GI:330838172"
                     /db_xref="InterPro:IPR007809"
                     /db_xref="GeneID:10496528"
                     /translation="MGEIIKLLRQQIDLCQRLLLATERQRQALCSGSGDSLSKETKAI
                     EVLLIELRRIEKRQALLLKGTATRDLTELLSRTTPSEERTVAKRLLKEADTVMREMQE
                     AVAMNGALLDRHMQFILFNINVMAGTPAEATYTAKDVQKGKKQAGADTKVFDASV"
     misc_feature    343699..344103
                     /locus_tag="Selsp_0319"
                     /note="FlgN protein; Region: FlgN; pfam05130"
                     /db_xref="CDD:253028"
     gene            344265..345980
                     /locus_tag="Selsp_0320"
                     /db_xref="GeneID:10496529"
     CDS             344265..345980
                     /locus_tag="Selsp_0320"
                     /note="COGs: COG1256 Flagellar hook-associated protein;
                     InterPro IPR010930:IPR002371;
                     KEGG: adg:Adeg_0248 flagellar hook-associated protein
                     FlgK;
                     PFAM: Domain of unknown function DUF1078, C-terminal;
                     SPTR: Flagellar hook-associated protein FlgK;
                     TIGRFAM: Flagellar hook-associated protein, FlgK;
                     IMG reference gene:2504585778;
                     PFAM: Domain of unknown function (DUF1078);
                     TIGRFAM: flagellar hook-associated protein FlgK"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein FlgK"
                     /protein_id="YP_004412753.1"
                     /db_xref="GI:330838173"
                     /db_xref="InterPro:IPR002371"
                     /db_xref="InterPro:IPR010930"
                     /db_xref="GeneID:10496529"
                     /translation="MVRGIYNNQLSLDTVGHNITNANTEGYSRQRVNPAATRPLEQGG
                     MFGGLFVGTGVDSESLTRARDFFADKQYWQEEATESYAKYRQKNYDKIEAVFNDSKTK
                     GLQNAMHKFYSAWNDLSVYASDPAKRVSVVESGKQFADRLEESAQNVQKQLDLVYREM
                     DTQVKDVNEITQKIVELNKNISLAEANGAMANDLRDKRDLLVDKLSGYMSLHVYEMDN
                     GMYQIVSGGASIVNGISRLELKMDGPVENKRYGVNDYSLIFKDTNTLFVPGNGTLQAA
                     VDSIKEDKAYMDKLANIAATFMTQFNDQHRAGAGIDKDKTSNLNFFGRNDKYYVWDKE
                     RQSLLAAKVTGTGSTTAGSPPVTTHTTTLSTTPGDTEELQGLEIIKAMKVSAELVTQN
                     GELKVAARGFGDNSDAKNSYVQNFSYSNSTVPPNITGTGTVVHTTSDMNGTADGSNAV
                     LLTNIFNMEQKDTGLTIYKNPTAGSPTETRPTGTVSLNNYYNSVTSALGIDSNAMDTK
                     VKFQQDVMTQIEAWRTSVSGVNWNEELSNMIKFQQGYSACARCMTTMDEMLDRLVNNT
                     GLVGR"
     misc_feature    344271..345977
                     /locus_tag="Selsp_0320"
                     /note="flagellar hook-associated protein FlgK; Validated;
                     Region: flgK; PRK07739"
                     /db_xref="CDD:236084"
     misc_feature    <345843..345956
                     /locus_tag="Selsp_0320"
                     /note="Flagellar basal body rod FlgEFG protein C-terminal;
                     Region: Flg_bbr_C; pfam06429"
                     /db_xref="CDD:253725"
     gene            345991..347331
                     /locus_tag="Selsp_0321"
                     /db_xref="GeneID:10496530"
     CDS             345991..347331
                     /locus_tag="Selsp_0321"
                     /note="COGs: COG1344 Flagellin and related hook-associated
                     protein;
                     InterPro IPR001029:IPR013384;
                     KEGG: aoe:Clos_2520 flagellar hook-associated protein 3;
                     PFAM: Flagellin, D0/D1 domain;
                     SPTR: Flagellar hook-associated protein 3;
                     TIGRFAM: Flagellar hook-associated protein 3;
                     IMG reference gene:2504585779;
                     PFAM: Bacterial flagellin N-terminal helical region;
                     TIGRFAM: flagellar hook-associated protein 3"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated protein 3"
                     /protein_id="YP_004412754.1"
                     /db_xref="GI:330838174"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR013384"
                     /db_xref="GeneID:10496530"
                     /translation="MRIGSLQMVSRYQKQLNTAAEEQAKLMEQSDGQSLHRPSDDPVR
                     YSNWLRYSTEQNENEQYKKNVDAGKSWMQRTDGAVSGMADIFKTLKEKTIQAAQSPHQ
                     NTDMAAIAKEMTAKLHEIVSLGNSQQGDRYIFSGQSDLTQPFLLTEKKVARGVPKTLD
                     DQQSKFFNNTNVSGRMKQMITLQGDDKNEYYLDTKTGDIYSYDFMKDGYKKKVAAGQT
                     EVNPAADRAGTLGGAFNVSDNFLNTGQIKDASTTPPAAAGKGANWSQSITVNGQTVNL
                     KLKTIDQQIVKYQGDFKQISMVKKNGAVEPTADTVNATAGDIFGTDIFDDENSGNTQS
                     GTAAINDMLTVAAKVDSSDVNWLISDGVTLADESHNNVVIAQDHIAARHNVYKGMADI
                     LDDYAVSIKQDISDTNSTDVAKLAVQLMQASAIYNMSLSVGSRILPPTLTDYLR"
     misc_feature    345991..347328
                     /locus_tag="Selsp_0321"
                     /note="flagellar hook-associated protein FlgL; Validated;
                     Region: flgL; PRK07701"
                     /db_xref="CDD:181087"
     misc_feature    346003..346398
                     /locus_tag="Selsp_0321"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     gene            347360..347950
                     /locus_tag="Selsp_0322"
                     /db_xref="GeneID:10496531"
     CDS             347360..347950
                     /locus_tag="Selsp_0322"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585780"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412755.1"
                     /db_xref="GI:330838175"
                     /db_xref="GeneID:10496531"
                     /translation="MLSNMTYLNVRHTLPVLGWQARSFKLQTSMTPAKMQGRRREASA
                     NLGTTQVRIDIDSYESRKAYGFRKDADLCADFKNAGISGVKSGTSRRSSEAWQAIDGA
                     AKPNADFFQKQAKGKIEAEIKEQKEIELRPIPRPKITVYPAEVKGSPDVGEHSIDIRS
                     DPFATYDYEPGSIDYHMKVEGSIHMWTSIGHYDVYA"
     gene            347962..348432
                     /locus_tag="Selsp_0323"
                     /db_xref="GeneID:10496532"
     CDS             347962..348432
                     /locus_tag="Selsp_0323"
                     /note="COGs: COG1699 conserved hypothetical protein;
                     InterPro IPR003775;
                     KEGG: swo:Swol_0195 hypothetical protein;
                     PFAM: Flagellar assembly factor FliW;
                     SPTR: Flagellar assembly factor fliW;
                     IMG reference gene:2504585781;
                     PFAM: FliW protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Flagellar assembly factor FliW"
                     /protein_id="YP_004412756.1"
                     /db_xref="GI:330838176"
                     /db_xref="InterPro:IPR003775"
                     /db_xref="GeneID:10496532"
                     /translation="MRKITTTRFGEIEEDESKIVHFAAGLPAFEDEHEFIIIPYDEES
                     PYVFLQSAVTPDLAFLMAIPFIFFPDYEFRLEDDVLESLALERQEDLLLYTLLTIPGK
                     DIREMTANLLAPIVINSRTNEGCQIVLDKSGYCTKHKLFSKKAEDKEASEREAN"
     misc_feature    347968..348408
                     /locus_tag="Selsp_0323"
                     /note="flagellar assembly protein FliW; Provisional;
                     Region: PRK13285"
                     /db_xref="CDD:237334"
     gene            348433..348657
                     /locus_tag="Selsp_0324"
                     /db_xref="GeneID:10496533"
     CDS             348433..348657
                     /locus_tag="Selsp_0324"
                     /note="COGs: COG1551 Carbon storage regulator (could also
                     regulate swarming and quorum sensing);
                     InterPro IPR003751;
                     KEGG: dsy:DSY3024 hypothetical protein;
                     PFAM: Carbon storage regulator;
                     SPTR: Carbon storage regulator homolog;
                     TIGRFAM: Carbon storage regulator;
                     IMG reference gene:2504585782;
                     PFAM: Global regulator protein family;
                     TIGRFAM: carbon storage regulator (csrA)"
                     /codon_start=1
                     /transl_table=11
                     /product="carbon storage regulator, CsrA"
                     /protein_id="YP_004412757.1"
                     /db_xref="GI:330838177"
                     /db_xref="InterPro:IPR003751"
                     /db_xref="GeneID:10496533"
                     /translation="MLVLTRKPRQQIMIGDDVVVHVVEVQGDNVRIAIEAPREVKIYR
                     GEIYRAIQDENKRAAAPADIDLSGALPGTE"
     misc_feature    348433..348642
                     /locus_tag="Selsp_0324"
                     /note="RNA-binding global regulator CsrA [Signal
                     transduction mechanisms]; Region: CsrA; COG1551"
                     /db_xref="CDD:224468"
     gene            348787..349314
                     /locus_tag="Selsp_0325"
                     /db_xref="GeneID:10496534"
     CDS             348787..349314
                     /locus_tag="Selsp_0325"
                     /note="COGs: COG1334 Uncharacterized flagellar protein
                     FlaG;
                     InterPro IPR005186;
                     KEGG: aae:aq_2000 hypothetical protein;
                     PFAM: Flagellar protein FlaG protein;
                     SPTR: FlaG protein;
                     IMG reference gene:2504585783;
                     PFAM: FlaG protein"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FlaG protein"
                     /protein_id="YP_004412758.1"
                     /db_xref="GI:330838178"
                     /db_xref="InterPro:IPR005186"
                     /db_xref="GeneID:10496534"
                     /translation="MISKIQDALGAAAVMQMTDLAVGGSPAPAPAAPANSGQQAAATG
                     VDNPAASGLAGEASPAAVVDEHLSTQLQAREISEAAKAKSEAAEQERREKAGKDKPVD
                     ESQMTYLMKEINRIMSRMNCNIAFEYHKEVDVMSVRMLEKKTGKLIKEMPPEYMIKGM
                     EKTREWLGTFLDQPA"
     misc_feature    <349051..349305
                     /locus_tag="Selsp_0325"
                     /note="FlaG protein; Region: FlaG; pfam03646"
                     /db_xref="CDD:252082"
     gene            349327..351039
                     /locus_tag="Selsp_0326"
                     /db_xref="GeneID:10496535"
     CDS             349327..351039
                     /locus_tag="Selsp_0326"
                     /note="COGs: COG1345 Flagellar capping protein;
                     InterPro IPR010809:IPR003481;
                     KEGG: hmo:HM1_1211 flagellar hook-associated protein 2;
                     PFAM: Flagellar hook-associated 2, C-terminal; Flagellar
                     hook-associated protein 2, N-terminal;
                     SPTR: Putative flagellar hook-associated protein 2;
                     IMG reference gene:2504585784;
                     PFAM: Flagellar hook-associated protein 2 C-terminus"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar hook-associated 2 domain-containing
                     protein"
                     /protein_id="YP_004412759.1"
                     /db_xref="GI:330838179"
                     /db_xref="InterPro:IPR003481"
                     /db_xref="InterPro:IPR010809"
                     /db_xref="GeneID:10496535"
                     /translation="MGVNGIYGLSGSGLDVESLVKMGMKGKQNQYDKMYKREMTNEYT
                     KTALNELYNKVNTYNLSELTNYKKQSDMAAKSASSSDDKTVTVNANGAAAVMSHTVTV
                     EKLASNSYFVSNAPITRSSDNPSKAMSTELADIAFKRIDKLTTPGPGGVQQYHVYYAD
                     GTDAVVNEGDTAIDMDLADKDPASADDIYHVKYTFKDLVENKKTLNDLASSIQNAKRP
                     PKGPKDVAHKANFNASYDAATGSFSIYNKNGGASNVISVKTLDKGSTQLVNNLHFAKF
                     DQSTNTLTNLPSFVQGTEQKFGGTAGKVKVDGREYIVDENRLVAGGVTYNFLNKTQTG
                     QTVTVSVSQNVDAVVDRVKKFVESYNKLLDELQKEYNTQHDKDYDPLTKEQEKGMSEE
                     QVKRWNEKAKGGLLYHNTYLGRLISKMREAVATPVAAAESKYNSASSLGITTKVGNNH
                     GHLSLDEDKLKKALAEDPDSVYRVFGSLDEKDDFKNSGVSMRLSKVALDSLKEISKEA
                     GTKSDWDDASTLGNLIRSQKKKMKDFKNLLDDFQSQLYKKYDAMESALQRMNSTYSSI
                     FGAK"
     misc_feature    349333..351030
                     /locus_tag="Selsp_0326"
                     /note="flagellar capping protein; Validated; Region: fliD;
                     PRK07737"
                     /db_xref="CDD:236082"
     misc_feature    349357..349653
                     /locus_tag="Selsp_0326"
                     /note="Flagellar hook-associated protein 2 N-terminus;
                     Region: FliD_N; pfam02465"
                     /db_xref="CDD:251313"
     misc_feature    350233..351009
                     /locus_tag="Selsp_0326"
                     /note="Flagellar hook-associated protein 2 C-terminus;
                     Region: FliD_C; pfam07195"
                     /db_xref="CDD:254097"
     gene            351064..351513
                     /locus_tag="Selsp_0327"
                     /db_xref="GeneID:10496536"
     CDS             351064..351513
                     /locus_tag="Selsp_0327"
                     /note="COGs: COG1516 Flagellin-specific chaperone FliS;
                     InterPro IPR003713;
                     KEGG: cth:Cthe_2217 flagellar protein FliS;
                     PFAM: Flagellar protein FliS;
                     SPTR: Flagellar protein FliS;
                     TIGRFAM: Flagellar protein FliS;
                     IMG reference gene:2504585785;
                     PFAM: Flagellar protein FliS;
                     TIGRFAM: flagellar biosynthetic protein FliS"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellar protein FliS"
                     /protein_id="YP_004412760.1"
                     /db_xref="GI:330838180"
                     /db_xref="InterPro:IPR003713"
                     /db_xref="GeneID:10496536"
                     /translation="MVNAAAEAYKRQQIMTATPEALTLMLYNGALRFMSEGKEALEKK
                     DYESANNSIIKAEKIITEFRVTLDFNYEISHQLLPLYNYVYDCLVQGNLASDTAKIDE
                     AAGIIRELRDAWAQAMKKARAEKSGESLESAAPPMPEISTTPPPEGA"
     misc_feature    351064..351447
                     /locus_tag="Selsp_0327"
                     /note="Flagellin-specific chaperone FliS [Cell motility
                     and secretion / Intracellular trafficking and secretion /
                     Posttranslational modification, protein turnover,
                     chaperones]; Region: FliS; COG1516"
                     /db_xref="CDD:224433"
     gene            351513..351848
                     /locus_tag="Selsp_0328"
                     /db_xref="GeneID:10496537"
     CDS             351513..351848
                     /locus_tag="Selsp_0328"
                     /note="KEGG: dhd:Dhaf_4162 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585786"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412761.1"
                     /db_xref="GI:330838181"
                     /db_xref="GeneID:10496537"
                     /translation="MEMHTPEELWRLYLELSREMLKFLKEDDIDRFLDLEEQRAKIFE
                     KMEACSIEAFKVTQEGRALVEELKPVEMQIIYNTKVWLNKSRTQHETVRDYEVRGFDP
                     SGHLVNREM"
     gene            352193..353506
                     /locus_tag="Selsp_0329"
                     /db_xref="GeneID:10496538"
     CDS             352193..353506
                     /locus_tag="Selsp_0329"
                     /note="COGs: COG1344 Flagellin and related hook-associated
                     protein;
                     InterPro IPR001029;
                     KEGG: hmo:HM1_1250 flagellin protein;
                     PFAM: Flagellin, D0/D1 domain;
                     SPTR: Flagellin;
                     IMG reference gene:2504585787;
                     PFAM: Bacterial flagellin N-terminal helical region;
                     Bacterial flagellin C-terminal helical region"
                     /codon_start=1
                     /transl_table=11
                     /product="flagellin domain protein"
                     /protein_id="YP_004412762.1"
                     /db_xref="GI:330838182"
                     /db_xref="InterPro:IPR001029"
                     /db_xref="InterPro:IPR001492"
                     /db_xref="GeneID:10496538"
                     /translation="MALVVKNNMMAVNTLNTLNKNQSALSTSLKQVSSGMKINGAVDD
                     ASGYAISERMRVQIRSLDQDNQNTQNGNSMMKVAEGAVSSTVDILKTLKEKVINAAND
                     TNTDDDRLTIQKELNQSIDQINDNANITFNGKYLVDGTHNQKVTATTTTFTNQSMSTA
                     TVATSAMTGLLDRTGRNLNIHSQDTITVSYVNQGKTETTSFKVSTQTFSEVIKRLSGT
                     GIVGGMATDVGATSVIGTNVAGDTVYTASGESAISLYAAGTGVGKSVGGITFSITDTQ
                     GNINKSANAVLDAFSETVRAQDNSQDNSMNFQIGTRANQAIRVGMTDMRAQALGLQGS
                     DGSTLNISTRDKANAAINVLDNAISKALDQQTTIGAVQSRLNYTSQNLTTASENVQAS
                     ESTIRDADMAKAMTNYTKNNVLMQAAQAMLAQANQSSSGVLSLLQ"
     misc_feature    352202..353503
                     /locus_tag="Selsp_0329"
                     /note="Flagellin and related hook-associated proteins
                     [Cell motility and secretion]; Region: FlgL; COG1344"
                     /db_xref="CDD:224263"
     misc_feature    352205..352612
                     /locus_tag="Selsp_0329"
                     /note="Bacterial flagellin N-terminal helical region;
                     Region: Flagellin_N; pfam00669"
                     /db_xref="CDD:250043"
     misc_feature    353243..353500
                     /locus_tag="Selsp_0329"
                     /note="Bacterial flagellin C-terminal helical region;
                     Region: Flagellin_C; pfam00700"
                     /db_xref="CDD:144340"
     gene            353615..356470
                     /locus_tag="Selsp_0330"
                     /db_xref="GeneID:10496539"
     CDS             353615..356470
                     /locus_tag="Selsp_0330"
                     /note="COGs: COG0463 Glycosyltransferase involved in cell
                     wall biogenesis;
                     InterPro IPR001173;
                     KEGG: dsy:DSY3021 hypothetical protein;
                     PFAM: Glycosyl transferase, family 2;
                     SPTR: Putative glycosyltransferase;
                     IMG reference gene:2504585788;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="YP_004412763.1"
                     /db_xref="GI:330838183"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:10496539"
                     /translation="MIKGNLYDMKISACYITKNESANIAASIESIAASVDEIIVYDTG
                     SEDDTCRIAEALPKVKLFRGAWCDDFAVARNAALSHATGDWVVFLDADERFSEATRGN
                     LCTVLEKAEGFDALAVKIVNLDVDGEKEERIDHTYVVRAFRRLPEIRYVGRIHEHIER
                     EDGALRLGFISEESLVLLHTGYTASRAKGKAERNLRLLLQELEQTQSPEDLYRYLAEA
                     YEGVGDEERALHYARLDIADGPRPVLFASRCYRMLLYTLPEGEERTRVLEKARRDFPR
                     IPEFHAEYAEHLARQMKFPEAIATMEEALRAYAEHEEDGEAMEFDDAMLAVAKERAAL
                     WQKITEREKTLRISACAIVRDEAHDMPRWLQNTAVYSDERIVVDTGSKDDTKALAEAA
                     GARVYDYMWRDDFAAAKNEALSHAAGDWVAFLDADEYFAEPQAVRPYLAALSVEQPEI
                     EAVMLAIANLDEDDHFKEIQRFPTVRIFRRRADIAFAGRIHEAVGKKEGQLEIKLEKK
                     HLLVCHLGYSAGRVRKKIERNFALLQADIEKNGEQPGHYRYLADCYVAFGDWKKALYY
                     ALSALDSSVTAIGSDSDMYRTALQAMRECRMTAEDMLALADRALEAFPELPDFYAEKG
                     MILSSMGRLKDAADSFEQAFSRAAQEAESTWQASRFAADAPVAWRRLGEIYLALGETT
                     KAKAALAASLRLHPFSEEALAAWQRLVGVPCGETLREFFPHTAEALRFLVRWAASAGE
                     AKLAADAAADLAAIFGERLPESDCLAAWQAGDWQKMAGVATRLVADTMQDLFLTLLQL
                     SEQKGKAHLPVQEMQPLLPALQEIVRCYAKEEPLTEELWESYWTFFPALAQRLPDEAL
                     LRYVRILSALSPEKKREAAAVLLAAEKWRASLELLAAVPADAAAADAAFWHDAGIAFY
                     RLGDFACAHDSFSRARQMGSQEKDIDAYEAWMKEAEA"
     misc_feature    353642..>354163
                     /locus_tag="Selsp_0330"
                     /note="UDP-glucose LOS-beta-1,4 glucosyltransferase is
                     required for biosynthesis of lipooligosaccharide; Region:
                     Beta4Glucosyltransferase; cd02511"
                     /db_xref="CDD:133005"
     misc_feature    order(353882..353884,353888..353890)
                     /locus_tag="Selsp_0330"
                     /note="putative metal binding site; other site"
                     /db_xref="CDD:133005"
     misc_feature    354650..355258
                     /locus_tag="Selsp_0330"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    order(354668..354670,354674..354676,354743..354745,
                     354887..354889,354893..354895)
                     /locus_tag="Selsp_0330"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            356467..358851
                     /locus_tag="Selsp_0331"
                     /db_xref="GeneID:10496540"
     CDS             356467..358851
                     /locus_tag="Selsp_0331"
                     /note="COGs: COG0463 Glycosyltransferase involved in cell
                     wall biogenesis;
                     InterPro IPR001173;
                     KEGG: clj:CLJU_c09640 putative glycosyltransferase;
                     PFAM: Glycosyl transferase, family 2;
                     SPTR: Glycosyltransferase;
                     IMG reference gene:2504585789;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="YP_004412764.1"
                     /db_xref="GI:330838184"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="GeneID:10496540"
                     /translation="MKLSACVITKNEEENIGTWLTSMKKIADEMIVVDTGSTDRTVEM
                     AKEAGARVFHHAWQNDFAAAKNCALEKAKGDWILFLDADEYFSPQTIAKVRPLLLEVE
                     KSTKPIVGVICRLVNIDKDQGNRFTGAIFQLRIFRNSPDLRYEGKIHEHVVDAHRAEH
                     EMFVTPKLVIFHTGYSQHIVRKKLERNLDFLRQKEEAEGESVDDALHYMDCYYGLGDF
                     AKAVEYAQKAIASKIVYMGREGAEYWGLVRALLAQKRPKEELVPVLQEAMEKYPDLAE
                     FPMEFGLLAWEERDYLLAEKMFRRGMACREKVPTSLRADNSLQMFPFVCLSLGKIEAM
                     KGRPAEAFDYFLRAVKEYPYDTRIFLALYDALAGQKPADVIALLDTLYDKERDAPFIT
                     AALAMRELTHVALYYARFLPPEKRDEVLLYRAAGRTDAAAVELSARLKSFSSLLAEAK
                     GETGVLPEEDAVSLLLAEPYKRHWRRKALPLVSIMIPTYNRPKFFELALQSALRQKYE
                     NLEIIVCDNGTDDRTEALIEKYLGDPRLCYHRNRTAKTKEENFAPFEHLAKGEYLQWL
                     MDDDILLDGKIEKMMQAFRENPAARLVTSRRAQIDGEGRVQPNPCTEGVPESEADYSV
                     FEGEAVGRETLLGCRNFLGEPSAVLFRRADLKHHYWRAESRGYKTISDVAMWLKLLEG
                     GDCIFFQKPLSCYRRHEEQEGQQAEVILLSRLEWLRLIKEYFERRIYVATEEEYAQPL
                     ELLYGEYLEERDRFDRAAAGEMWREYEEAMRSTRRTLEKMKKKERAHGKREGKR"
     misc_feature    356470..357063
                     /locus_tag="Selsp_0331"
                     /note="UDP-glucose LOS-beta-1,4 glucosyltransferase is
                     required for biosynthesis of lipooligosaccharide; Region:
                     Beta4Glucosyltransferase; cd02511"
                     /db_xref="CDD:133005"
     misc_feature    order(356707..356709,356713..356715)
                     /locus_tag="Selsp_0331"
                     /note="putative metal binding site; other site"
                     /db_xref="CDD:133005"
     misc_feature    357097..357387
                     /locus_tag="Selsp_0331"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(357097..357099,357199..357204,357208..357213,
                     357220..357225,357301..357306,357313..357318,
                     357325..357330)
                     /locus_tag="Selsp_0331"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(357127..357129,357139..357141,357148..357150,
                     357208..357210,357244..357246,357256..357258,
                     357265..357267,357310..357312,357346..357348,
                     357358..357360,357367..357369)
                     /locus_tag="Selsp_0331"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    357901..>358221
                     /locus_tag="Selsp_0331"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    357913..358560
                     /locus_tag="Selsp_0331"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    order(357925..357927,357931..357933,358009..358011,
                     358165..358167,358171..358173)
                     /locus_tag="Selsp_0331"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            358826..363877
                     /locus_tag="Selsp_0332"
                     /db_xref="GeneID:10496541"
     CDS             358826..363877
                     /locus_tag="Selsp_0332"
                     /note="COGs: COG3914 O-linked N-acetylglucosamine
                     transferase SPINDLY family;
                     InterPro IPR019734;
                     KEGG: glo:Glov_2093 TPR repeat-containing protein;
                     SPTR: Putative tetratricopeptide repeat-containing domain
                     protein;
                     IMG reference gene:2504585790"
                     /codon_start=1
                     /transl_table=11
                     /product="TPR repeat-containing protein"
                     /protein_id="YP_004412765.1"
                     /db_xref="GI:330838185"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:10496541"
                     /translation="MASEKEKDRLRERIGACLAVRDFDAAMDAVRELAKDEATQSEAL
                     GAAASIHIEAGDYEGAAPLVEALLQKEPQSVYGAFLRARLLFAEGKLLSAHHALVSLL
                     QREEGIASLYVEKVCNLLGQTARAMGLAEEAAAAYEKAAAAAETPELRAVAWSNVLFA
                     LHFLRVPQQEVYRAHCAYGELFRAVTPFLHRCRQKRRKIRIGYISPDLRHHVVLRFAE
                     ALFTHYNAERFEVYCYQNGPEDEESRRIMRLVDAWRNISPLSPQEAARRIYEDDIDVL
                     VDLAGHTRGTGLPVLVHRPAPVQMSGIGYFATTGLPAVDYMIGDVWLDGAPAGIKEAP
                     FFTEKLLVLSHTHLCYTPEAGAPLAGAAPCLRKGFVTFGSFNAFAKASDETLAAWAQI
                     LAAVPQSRLLLKSAAFSSEEGCTAALERLQAAGIEPARVELRPDTREYLHEYHDVDIA
                     LDTFPYPGGGTTFDALYMGVPVVTLKGDSHGTRFGCSILANLGLEDLAAADAASYVET
                     AAALAEDTELLAALHRNLRPMMEKSPLMDGASYVAALEVGYEAALTAHDAAQTAISPE
                     EAARLAVALKRFFAAGDLRQALAAADTLLAAGRAERDVWRLTAGLYIDAGEGENAARA
                     AGLYISGKDDAFGLFLRARAAFLLGHWQAARLDAQRALSLGMLARGDEVLAHNLLARV
                     SCSMGEVEESLREERAAFESAETLEDKASSWSNYLFALHYVERESQFMLDAARRYGEL
                     FKGVPRMKRAPKRRGKIRIGYISPDFTFHIVALFSFAFFTHFDKSRFEVFGYSLAGEN
                     AMAAELSSHASAWRYVGGGTPAEIAERIRADEIDILFDLAGHSANNALPVLALRPAPV
                     QISGIGYFDTTGLSAVDYFLTDAYIDPMGENDGCFTEKLLRLPESHLCYRASRAGEKS
                     RIAPLPAREKGYITFGSFNNFAKVTDRVLHLWAKILRAVPRSRLFLKTAVFDASDGRE
                     EALRRLEAAGIDLARIRTEGHTAEYLVAYGEVDIALDTFPYPGGGTTCDALYMGVPVV
                     TLAGVRHGARFGASILANLGLADACCAHTADEYVEKACVLAADVAALAVLRRTLRTRM
                     EASPLMDAARYMLHLEAAYEKIWAHKLGEDSKKQCRKLVPRLQAEADAAFAAREWHSF
                     LAAAHRLVALDAASSRLLMSMGFASLQLEEPKKARGFLEMALEKAQEERPEILQLLAE
                     VQKLAGDHAAALASAEEAQARTEKTRETRPFRHRLALAKAHAAYMLARADEASGAYRE
                     AADLADDLHARTEAYSSHLLALHNTAIGQEELFAAHRGYEKLLAGIEPLAERAWKDHE
                     KIRIGYLSPDFRCHVMFSFIYGLFVRFDRTRFEVYAYSLAEEEDGFTEALKEHATAWR
                     NVAGLSFAEIAERIRADEIDVLVDLAGHSAGGALPVLAYRPAPVQVSGLGYVNTTGLS
                     AVDYFLTDDIVDPLGRHDALFTEEPVCLTSQFLYTAKSAAPEPSGAPCRKAGHVVFGV
                     FNHWYKVTEEMLFCWREILERVPKSRLFVKCQELFAPKMREEVLRRMAKAQIDIERVD
                     LEPATSDYMERYRTVDIALDTYPYPGGGTTCDALYMGIPVVTRYGRRRGTRFGLSLLK
                     NVGLSELAAADARTYIEKAVALAHEADLLDELHRTLHARFIASPVMQTPHYMEELERF
                     YCMAVERKKEEEGGR"
     misc_feature    358853..359107
                     /locus_tag="Selsp_0332"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(358856..358861,358868..358873,358958..358963,
                     358967..358972,358979..358984,359060..359065,
                     359072..359077,359084..359089)
                     /locus_tag="Selsp_0332"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(358865..358867,358901..358903,358913..358915,
                     358922..358924,358967..358969,359003..359005,
                     359015..359017,359024..359026,359069..359071,
                     359105..359107)
                     /locus_tag="Selsp_0332"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    358877..359077
                     /locus_tag="Selsp_0332"
                     /note="Tetratricopeptide repeat; Region: TPR_19;
                     pfam14559"
                     /db_xref="CDD:258697"
     misc_feature    359420..360475
                     /locus_tag="Selsp_0332"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     misc_feature    361094..362158
                     /locus_tag="Selsp_0332"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     misc_feature    362789..363832
                     /locus_tag="Selsp_0332"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     gene            363874..365334
                     /locus_tag="Selsp_0333"
                     /db_xref="GeneID:10496542"
     CDS             363874..365334
                     /locus_tag="Selsp_0333"
                     /note="COGs: COG3914 O-linked N-acetylglucosamine
                     transferase SPINDLY family;
                     KEGG: gem:GM21_3825 tetratricopeptide TPR_2 repeat
                     protein;
                     SPTR: Putative UDP-N-acetylglucosamine--peptide
                     N-acetylglucosaminyltransferase SPINDLY;
                     IMG reference gene:2504585791"
                     /codon_start=1
                     /transl_table=11
                     /product="tetratricopeptide TPR_2 repeat protein"
                     /protein_id="YP_004412766.1"
                     /db_xref="GI:330838186"
                     /db_xref="GeneID:10496542"
                     /translation="MKDFSKITEELAVLQERTDWAQGTERIGQLLEKHGAELDRGEKS
                     FLYGRLGYFLRFLERAEESAAAYREAVLYAPYLAQQRKLYSDYLLICHYLPHVSDEEL
                     AESHFFYQNFFRPKEELQHVRDDHRRHSKIRIGYLSSNFKTHIMSCFMMQLLALADRD
                     RFEVYCYDLGGLSDGAAEQMKSFGNIWRNIALPEAKERARTIAADEIDILFDLGVHTD
                     GGHGLATLGYKAAPVQIAGIGYMSTSGLKAVDYYLSDRFLDPPGKGDAYFSEKLLRLS
                     HSHFCYTPFEEIFKSTIDWQPHERPVFGCFNNSAKISEEMLRLWLTLLRRVPGAKLLL
                     KAWKPEALIEKALSLGYCRGEIEVRPMTLDYVHEYMDMDIALDTFPYTGGGTTCEAIY
                     MGVPVVTLAGTRHGTRFGLSLLENVGLGELVSNTPEEYVEKAAALASDAELLAALHKN
                     LRPMMQRSPVMDGKSYVREIEAMYEDVWQAWLDGRE"
     misc_feature    364267..365307
                     /locus_tag="Selsp_0333"
                     /note="Glycosyl transferases group 1; Region:
                     Glycos_transf_1; cl19138"
                     /db_xref="CDD:267491"
     gene            365412..366275
                     /locus_tag="Selsp_0334"
                     /db_xref="GeneID:10496543"
     CDS             365412..366275
                     /locus_tag="Selsp_0334"
                     /note="SPTR: Putative tetratricopeptide repeat-containing
                     domain protein;
                     IMG reference gene:2504585792"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412767.1"
                     /db_xref="GI:330838187"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="InterPro:IPR019734"
                     /db_xref="GeneID:10496543"
                     /translation="MSKWHKKNAKTASVDEAKRKLVVQMADEEYGEALGTVAAMIEQG
                     IEDSDAFYDASYAYFMSGDYERATQWVDNTLRLAPQHLGARILLARICFLQERTSDGL
                     AIAEFVLKNYAASLSAEDKEELAEMLDCYGTTKEDEIRAGYPAIARFLQVDDAAPKAQ
                     TEAFQPLAQQVQRIEAQPLQQMQPAQQSAADDEKEAMRLAQEILGKNIALLEKVHLLN
                     SFAAGFFLAGSFAAAKHLLKQALGLDAHDEMTLKNMGYTLVALGERDAALELAARMKL
                     PDFGLLAAVRG"
     misc_feature    365496..365723
                     /locus_tag="Selsp_0334"
                     /note="Anaphase-promoting complex, cyclosome, subunit 3;
                     Region: Apc3; pfam12895"
                     /db_xref="CDD:257383"
     gene            366411..367595
                     /locus_tag="Selsp_0335"
                     /db_xref="GeneID:10496544"
     CDS             366411..367595
                     /locus_tag="Selsp_0335"
                     /note="KEGG: met:M446_3121 O-methyltransferase;
                     SPTR: O-methyltransferase I;
                     IMG reference gene:2504585793;
                     PFAM: Cephalosporin hydroxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412768.1"
                     /db_xref="GI:330838188"
                     /db_xref="InterPro:IPR007072"
                     /db_xref="GeneID:10496544"
                     /translation="MTEAEVREKDVLVIGLSYFGTGVIAALQEPFLSRGARVDYVPLF
                     NEDFGISSSLQEVADVMEGKQYDLVVLAEGLEQEPHFAKSAEAVAACCRIGGKMLLFV
                     QTPDALDEERSVLRCWERVWAYDLQDIASIFPGFAMLFHMRTAPALLLAAKLEKRREA
                     RPLHPTAFNLRLKRHVSEKKGLQAGFFHEFHELDRIGVEECTDKCRYRHNYLKKYEFF
                     LRDWKNKPLRLLELGVSKGGSERMWKRFFPQAQVYGVDIDENCRAYEEERIKIRIADL
                     SQDDVLESLKGIRPHIIIDDASHFWSHQIKALFTLFPVLPSGGVYILEDIETSFHPLV
                     FSSEYCDAPLDAYTVAERITRVAASRVPCKEGPFAEEITAVGMDTELVATMLSSCIFI
                     KR"
     misc_feature    367092..367391
                     /locus_tag="Selsp_0335"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(367104..367124,367176..367181,367230..367238,
                     367296..367298)
                     /locus_tag="Selsp_0335"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            367604..369373
                     /locus_tag="Selsp_0336"
                     /db_xref="GeneID:10496545"
     CDS             367604..369373
                     /locus_tag="Selsp_0336"
                     /note="InterPro IPR001173;
                     KEGG: mch:Mchl_3179 hypothetical protein;
                     PFAM: Glycosyl transferase, family 2;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585794"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="YP_004412769.1"
                     /db_xref="GI:330838189"
                     /db_xref="GeneID:10496545"
                     /translation="MNKIIAVSLVADSADIIESFVRHTLTYADEMLVVDHAAIDGTAN
                     ILCALRAEGLPVRVERYESAELCHDEIMTALMHRAFDERGADIVVPVDADEFLVTEDA
                     AKPCRSVLRRLRTDMTFYAWHWMYELEKPEEDAGKFLLSRPLRRKKEHEMMQKAIVGR
                     EAAHAYPLLAQGTHYLYRMEGERRVPAPALPISFLHFAHFQWRGAQHTAVKVLNGWIA
                     NAAKYSLHTARCYYWKEHFDTVFQGDVPPVAIASDESETVQGLILPKGQIELRYTEGA
                     TFSPLQSLMCLAEQLAQDFAEERVRSRRKLVSVIVPYFGNLSFWHRTLENIASQTYPY
                     MEVAVLDFADGASDLQEMLAALHLPHCIVRADSPGWGVRLAQTARGEYIQWVMPGDRL
                     FPEKILQMVTTLELDDELSFVLADAEETATAEGADPERFVFSMHRSHCFVAAGAWHRA
                     YALAAGRTPMGGLSGVLLRRRVLDACAWLELAFFRKRFFPLAAFVLLFQMEKDFRAGV
                     FDVPLLSHEFHDEGTLVWHPAEWASLLLSCGQELAAHSFVEARQTLAERAREVFAREE
                     LRAHADFSRARSIFEELFAALPE"
     misc_feature    367637..367933
                     /locus_tag="Selsp_0336"
                     /note="Glycosyl transferase family 2; Region:
                     Glyco_tranf_2_4; pfam13704"
                     /db_xref="CDD:258002"
     misc_feature    367643..>368197
                     /locus_tag="Selsp_0336"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    368513..>369124
                     /locus_tag="Selsp_0336"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    368528..>368842
                     /locus_tag="Selsp_0336"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    order(368537..368539,368543..368545,368621..368623,
                     368765..368767,368771..368773)
                     /locus_tag="Selsp_0336"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            369410..370126
                     /locus_tag="Selsp_0337"
                     /db_xref="GeneID:10496546"
     CDS             369410..370126
                     /locus_tag="Selsp_0337"
                     /note="COGs: COG4750 CTP:phosphocholine
                     cytidylyltransferase involved in choline phosphorylation
                     for cell surface LPS epitopes;
                     InterPro IPR005835;
                     KEGG: ele:Elen_2028 CTP:phosphocholine
                     cytidylyltransferase-like protein;
                     PFAM: Nucleotidyl transferase;
                     SPTR: Putative choline kinase;
                     IMG reference gene:2504585795;
                     PFAM: Nucleotidyl transferase"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleotidyl transferase"
                     /protein_id="YP_004412770.1"
                     /db_xref="GI:330838190"
                     /db_xref="InterPro:IPR005835"
                     /db_xref="GeneID:10496546"
                     /translation="MSDPYIAERAIVLAAGRGERMRPLTDEMPKPMVRVDGRRIIDTL
                     LAALVAADIPEIYVVRGYLGEKFDALKEEYPTLHFIDNPHWHEANNISSLLAAGALVE
                     NAFVVEGDLFLQNPSLLSREQQGSNYLAIPVKETTDWCFFPDEAGVIRRMAVGGTDCW
                     KMVGISYWTTEDGRKLAQSIRHLYETPGGAARYWDEAALSADIEDFSVHVRACTAEDV
                     QEIDTLAELETLRKSLKGKG"
     misc_feature    369437..370102
                     /locus_tag="Selsp_0337"
                     /note="Phosphocholine cytidylyltransferases catalyze the
                     synthesis of CDP-choline; Region: PC_cytidylyltransferase;
                     cd02523"
                     /db_xref="CDD:133014"
     misc_feature    order(369446..369457,369674..369679,369686..369688,
                     369734..369739,369824..369826,369986..369988,
                     369995..369997,370067..370069,370073..370075)
                     /locus_tag="Selsp_0337"
                     /note="active site"
                     /db_xref="CDD:133014"
     misc_feature    order(369737..369739,370067..370069,370073..370075)
                     /locus_tag="Selsp_0337"
                     /note="metal-binding site"
                     /db_xref="CDD:133014"
     gene            370128..371429
                     /locus_tag="Selsp_0338"
                     /db_xref="GeneID:10496547"
     CDS             370128..371429
                     /locus_tag="Selsp_0338"
                     /EC_number="5.4.2.9"
                     /note="COGs: COG2513 PEP phosphonomutase;
                     InterPro IPR004821:IPR004820:IPR012698;
                     KEGG: ols:Olsu_0594 phosphoenolpyruvate phosphomutase;
                     PFAM: Cytidylyltransferase;
                     PRIAM: Phosphoenolpyruvate mutase;
                     SPTR: Phosphoenolpyruvate mutase;
                     TIGRFAM: Phosphoenolpyruvate phosphomutase, core;
                     Cytidyltransferase-related;
                     IMG reference gene:2504585796;
                     PFAM: Cytidylyltransferase;
                     TIGRFAM: phosphoenolpyruvate phosphomutase;
                     cytidyltransferase-related domain"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoenolpyruvate phosphomutase"
                     /protein_id="YP_004412771.1"
                     /db_xref="GI:330838191"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR012698"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="InterPro:IPR015813"
                     /db_xref="GeneID:10496547"
                     /translation="MKEKIAYACFCTDAIHEGHRNILREAKKRGTVVAGVLSDREMVR
                     YNRFPAVSLEERIALLEAEPEVERVIVQDAIMYDEVIASLKPDFVVHGDNWRGGPMSA
                     IRENVLANLKKMGGELIEVPYTWNPDVKKIDERMKERLVMPEFRRRRLRRLLEIVPIV
                     KTIEVHDGLTGLLAEKTVVEHEGGLDQFDALWISSLCDSTAKGKPDIELVDMSSRIRT
                     IDDVMDVTTKPIILDADTGGLIEHFVYHVHTLERMGVSAVILEDKIGLKKNSLFGTEV
                     EQQQDTIEHFAAKIRAGKEAQRTDDFMIIARIESLILEKGLPDALERASAYVAAGADG
                     VMIHSRRKEPDEVFAFADAFQKEYAHVPLVAVPTSYSSVTEAELAAHGVNIVIYANQL
                     TRSAFPAMERTAMSILKHHRSLEADADLMPFKDIIRLIDEV"
     misc_feature    370134..370544
                     /locus_tag="Selsp_0338"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    order(370173..370184,370509..370520)
                     /locus_tag="Selsp_0338"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    order(370173..370175,370182..370184,370512..370514)
                     /locus_tag="Selsp_0338"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    370173..370184
                     /locus_tag="Selsp_0338"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    370509..370520
                     /locus_tag="Selsp_0338"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    370599..371339
                     /locus_tag="Selsp_0338"
                     /note="Members of the ICL/PEPM enzyme family catalyze
                     either P-C or C-C bond formation/cleavage. Known members
                     are phosphoenolpyruvate mutase (PEPM), phosphonopyruvate
                     hydrolase (PPH), carboxyPEP mutase (CPEP mutase),
                     oxaloacetate hydrolase (OAH), isocitrate...; Region:
                     ICL_PEPM; cd00377"
                     /db_xref="CDD:119340"
     misc_feature    order(370602..370604,370608..370619,370623..370637,
                     370641..370646,370653..370655,370686..370694,
                     370713..370715,370725..370730,370737..370742,
                     370749..370760,370764..370769,370776..370781,
                     370785..370790,370797..370802,370839..370841,
                     370857..370862,370872..370874,370881..370883,
                     370977..370982,370989..370991,370998..371003,
                     371010..371012,371310..371318,371322..371330,
                     371334..371339)
                     /locus_tag="Selsp_0338"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119340"
     misc_feature    order(370701..370703,370707..370715,370743..370745,
                     370824..370826,370830..370832,370908..370910,
                     371046..371048,371139..371141,371223..371225,
                     371229..371231,371292..371294)
                     /locus_tag="Selsp_0338"
                     /note="active site"
                     /db_xref="CDD:119340"
     misc_feature    order(370743..370745,370824..370826,370830..370832,
                     370908..370910)
                     /locus_tag="Selsp_0338"
                     /note="Mg2+/Mn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:119340"
     gene            371426..373549
                     /locus_tag="Selsp_0339"
                     /db_xref="GeneID:10496548"
     CDS             371426..373549
                     /locus_tag="Selsp_0339"
                     /note="COGs: COG3119 Arylsulfatase A;
                     InterPro IPR000917;
                     KEGG: cdf:CD0212 putative choline sulfatase;
                     PFAM: Sulfatase;
                     SPTR: Putative arylsulfatase;
                     IMG reference gene:2504585797;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004412772.1"
                     /db_xref="GI:330838192"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496548"
                     /translation="MTGTESILSCEAEGKKESMQEQENLGWDTGEEDALGLWLREAVR
                     EGAYTEEYCTKLEAYDKVTKNRAAVFYFTARLAFALGEMEEAHRLAHEAYRRRKISHK
                     IWQILFEIADALGLDEEAIFFKALCQKNMELDVPLPIFQEARWQDAFFCGMLDVQLAP
                     FRFDFVERADGSRNLDLVSAHGQFLLNEGHEAERRRYYCGIYNAEDLFHVRARRLDLL
                     KRSDGSVVDDYCGMVFDVMKARRAEGSVEVAEECILPVAVTQEEQRIDVADVRTEGSI
                     LSGRGEFRFLRLEGGTKVSSAEPFIVAAPILPGHSPKRKKLVLNLLLDGLSWQAMRAR
                     DFRSVPNLMRFFSDGVIFNNNYCVAEYTFVSLGTIETGMMPHRSQVVWDKPMFAIDKD
                     IKTLSEQMKDLGYYCVNVMGDGRGIYDGVTRGFDRLIVNPYLAQPAYDGVARTIAHLE
                     AFDECDNYVFLHVGDAHSTPATIAPLALKTQTHIPWQHTRVMPGDDVSVRLPYNDVYG
                     YDNPHRIEMMDRELGRLFDYIEEHYAPDEYIVCAYSDHGSSVYSEDAWYFSETQGGAA
                     LMLRGAGVQHRGTVEELSSCLDIYPIMEKLAGFSAPAGQLDGVLPRALGGEGRSYCIS
                     NSIYPEQTYKLSIRTQEYEFRMETERPTHHDGTVDLSRFTAHIYTRDALHREVFDAAL
                     MEEFLQLAREHTASFHEKWEEDCGC"
     misc_feature    372431..373510
                     /locus_tag="Selsp_0339"
                     /note="Arylsulfatase A and related enzymes [Inorganic ion
                     transport and metabolism]; Region: AslA; COG3119"
                     /db_xref="CDD:225661"
     misc_feature    372443..373219
                     /locus_tag="Selsp_0339"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            373543..375705
                     /locus_tag="Selsp_0340"
                     /db_xref="GeneID:10496549"
     CDS             373543..375705
                     /locus_tag="Selsp_0340"
                     /note="COGs: COG3119 Arylsulfatase A;
                     InterPro IPR000917;
                     KEGG: cdf:CD0212 putative choline sulfatase;
                     PFAM: Sulfatase;
                     SPTR: Putative arylsulfatase;
                     IMG reference gene:2504585798;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004412773.1"
                     /db_xref="GI:330838193"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496549"
                     /translation="MLNDRAEHMYEEKSEAGRAFFTALLQRSECSRYDATYLVLLEEY
                     RRLFPDSENVQIFYARHALAHGDTEAALAAAQEAYAKKKYHYEVWKILIECYRRLGDM
                     RSLLIFEGISSRVYRTPIEVPLARETLEESLALLSVAMGVPTHAPYTIGRARMGEDGL
                     LALPGAFAGEFLPTLRPAHDEYRYWSGIFVEMTSLDAKAALFEALKADPAIVSAAEEL
                     VFDVMKVKQVDGAAAVDVWRDTRDRIGSSDLVVPLAGTESGQEIFFRSASLGESSMHL
                     GKWVTSFFRLSERTELKSSAPFMMGEPVRLGHSPKRKRLILHILVDALCWPAMKRYGF
                     APMPNLMRFFSKGMIFQDNFSVAEYTYPALATIDTGLYPHHSQIFNSTCMGELAPSIL
                     TLSEQMKRLGYYCVNVWGDSSGIYNGVTRGYDRLMAKPGGDGLHAYHGVHNALTQMRA
                     FAECDQFIFLHVEDAHPSTTARWQVPLETQVSLGLADRLDDTDDDTPSVDRVNSRLHL
                     EAVLEGMRRADRSLGELFAYIEENYAEDEYVVQLYSDHGAAVFGEVVDYVSENLNGTA
                     WMLRGAGVPNAGFVDELTSVLDIYPTTAHLAGFLPPADLDGSLPRVFGGCGRDHTVSY
                     TLFPGKPFNMALRTKTHEFCLGSAEVVDEDGSVDLRQPKQRLFLRGEKRREIHDEALR
                     QSFLSLARTYTSSLDTRGEVWPAKRALRAAWFPDAAEE"
     misc_feature    374470..375687
                     /locus_tag="Selsp_0340"
                     /note="Arylsulfatase A and related enzymes [Inorganic ion
                     transport and metabolism]; Region: AslA; COG3119"
                     /db_xref="CDD:225661"
     misc_feature    374482..375336
                     /locus_tag="Selsp_0340"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            375717..377915
                     /locus_tag="Selsp_0341"
                     /db_xref="GeneID:10496550"
     CDS             375717..377915
                     /locus_tag="Selsp_0341"
                     /note="COGs: COG3119 Arylsulfatase A;
                     InterPro IPR000917;
                     KEGG: ppy:PPE_04397 hypothetical protein;
                     PFAM: Sulfatase;
                     SPTR: Putative arylsulfatase;
                     IMG reference gene:2504585799;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004412774.1"
                     /db_xref="GI:330838194"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496550"
                     /translation="MKMPAEEAAYQERAREAGRIFAALQEKSTCGAYDDSFLSLLVEY
                     QALFPQSENFDIFYAQYALAHDSVTVALEAAERAYEKKKCHYEVWKLLIECYKRLGDK
                     RRLLTIEGVASRIYRFPVDVPIEKAELTESLALLSLAMGLPNLAPYVLGRARFGADGI
                     EAPPGVFLGEFLPSFQEPADGWRYWSGVLVDRGRLHAKAMLLEALKETTDFPLAEDDA
                     FVFDIMRAREIRSPLAIGGADAADLDGAQADDVQEGLHDVIVPLAGTEARQEVVFRSA
                     SIAEGRATLGKWVTSFFRLSERTEISSASPVILGKPIRLGHSPHRKKLVLHILIDALC
                     WPEMKRRDFEPMPNLMRFFSKGVIFNNHYSVAEYTFPSLATIETGVYAHSSQVFNPTC
                     MAELSTRYITIAEQMAHLGYYCVSTMGDATGIYPQVTRGYDRLMIVHGDASLAYRGVE
                     QTVQTMRAFSECDPFILLHLMDAHPGSIADFQLPLATQVQLPLAERLAGAAEGVASVN
                     LPHVPIYAEGVLEHMRSIDRSLGELFAYIEANYSEDEYIVQVYSDHGVSVFSDDVDYI
                     GENQTGAAWMLRGAGVPQTGIVDELTSALDIYPATAHLAGFDAPAHLDGNLPKALGGE
                     EREFVISNSLFPGQTYKLAIRSKMHEFRLESREPLDEDGMTDLRQPKLQQLFLRGKDR
                     HSVEDEGLRQKFLAMARAHTAAIDTRGEVWREKRALRPSWFSGDRNEGKT"
     misc_feature    376683..377534
                     /locus_tag="Selsp_0341"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     misc_feature    376689..377849
                     /locus_tag="Selsp_0341"
                     /note="Arylsulfatase A and related enzymes [Inorganic ion
                     transport and metabolism]; Region: AslA; COG3119"
                     /db_xref="CDD:225661"
     gene            377915..380050
                     /locus_tag="Selsp_0342"
                     /db_xref="GeneID:10496551"
     CDS             377915..380050
                     /locus_tag="Selsp_0342"
                     /note="COGs: COG3119 Arylsulfatase A;
                     InterPro IPR000917;
                     KEGG: ppy:PPE_04397 hypothetical protein;
                     PFAM: Sulfatase;
                     SPTR: Putative arylsulfatase;
                     IMG reference gene:2504585800;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004412775.1"
                     /db_xref="GI:330838195"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496551"
                     /translation="MERDMRAISANESLYQESCVRGGKLFAALEEKSARKDYDDSFLQ
                     LLVEYRALFPQSENFDIFYARYALFHGSFEVARDTLEQAYRKKKCHYEIWKSLIECCR
                     HFGDVRRQLILEGIASHIYRLPIEVAIPREQFSEYLDLLSLAMGEPVYAPIAKSRAHL
                     ADGVLADEIGVFAGEFLPMLEESRADLRYWVGAYIGQGGLNNKGLLLEMYKEDPRFCA
                     IGGADFVFDVLRARLVQESITLDEDEEVFLPLIGTEETQEIRLAPVGEEGGSIFLGKW
                     ATNFYRISEKTQISSEHPFLTGKPIPLRHSPQRKKLVLHILADGFSWTAMKQHGYALM
                     PNLMRFFLKGTIFDQHFSVAEYTYPSLATIETGCHLHRLQSFNENCMNELDPSFVTLS
                     EQMKALGYYCTNVMGDGNGIYNGATRGHDRLIVNAWDLSASEGVRRTIGSLKAFAPCD
                     QFVFLHFTDMHPWPSRSSAMPLPVQTGASLADCIQGAKAALPSVYLPNEPIFAAAARE
                     NMASVDESLGRLFSYIEEHYGEDEYIIQLYSDHGSAVLVDEPQYLMGAAQTGAAWMLR
                     GAGVPQLGVVDELTSALDIYPAAARLAGFTAPAHIDGNLPAALGGEARDHVISNSIFP
                     GQTYKLCIRTREHEFRLESQEVVDEDGSVDLRRPKMQLFRRADMTREIEDGERLAHFL
                     AIARAHTASFDTRGEIWQEKRALRKSWFG"
     misc_feature    378845..379696
                     /locus_tag="Selsp_0342"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            380078..381604
                     /locus_tag="Selsp_0343"
                     /db_xref="GeneID:10496552"
     CDS             380078..381604
                     /locus_tag="Selsp_0343"
                     /note="COGs: COG0463 Glycosyltransferase involved in cell
                     wall biogenesis;
                     InterPro IPR001173;
                     KEGG: cbb:CLD_1848 glycosyl transferase family protein;
                     PFAM: Glycosyl transferase, family 2;
                     SPTR: Glycosyl transferase, group 2 family;
                     IMG reference gene:2504585801;
                     PFAM: Glycosyl transferase family 2"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 2"
                     /protein_id="YP_004412776.1"
                     /db_xref="GI:330838196"
                     /db_xref="InterPro:IPR001173"
                     /db_xref="GeneID:10496552"
                     /translation="MNKEKREEAMKDQEIQPQNEVVQDAKKIAVIVARQGEELPQDLL
                     MSIRLLEQPEGFTMELVEVEGKAGMAAAYGQAMEASAAKYKVYLDERVRILDSHLLVR
                     IVHLFETHVDLGVLGISGTKLLPPDGIAFHSTRRIGALRLAEGARTVSWGRVLGEMEN
                     VLAVDGFLMATQVDLPWREDLFHGAAFFDAAQCLEFRRQGLRSAVLGQDEPLVEFLGE
                     SFPADEAGRRAFLEEYATEALPLVSILIPTHERPEFFKLALESALAQTYRHIEIIISD
                     NSSDDCTEELMRGYADDARIHYVHDSSLSLRQNWLRPLERANGEYLAYLFDDDLYAPE
                     KIERMADALSMEDGIAFVTSHRRVIDEEGNFVDDPAVDPLPVEETSRIPGELAIYGLL
                     EKQANFIGEFTTVLLPRRMKEIVHEILRREPPSVLPDVECWLRLLEEGDLLYIVDTLS
                     YFRKHEGQEGAALAVQIEGARAWAQLLRERAARESGMRRKKMFEQADLIEMVLRARRR
                     "
     misc_feature    380159..380779
                     /locus_tag="Selsp_0343"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cl11394"
                     /db_xref="CDD:264347"
     misc_feature    380792..>381163
                     /locus_tag="Selsp_0343"
                     /note="Glycosyltransferases involved in cell wall
                     biogenesis [Cell envelope biogenesis, outer membrane];
                     Region: WcaA; COG0463"
                     /db_xref="CDD:223539"
     misc_feature    380807..381172
                     /locus_tag="Selsp_0343"
                     /note="Glycosyltransferase family A (GT-A) includes
                     diverse families of glycosyl transferases with a common
                     GT-A type structural fold; Region: Glyco_tranf_GTA_type;
                     cd00761"
                     /db_xref="CDD:132997"
     misc_feature    order(380816..380818,380822..380824,380900..380902,
                     381053..381055,381059..381061)
                     /locus_tag="Selsp_0343"
                     /note="active site"
                     /db_xref="CDD:132997"
     gene            381609..382949
                     /locus_tag="Selsp_0344"
                     /db_xref="GeneID:10496553"
     CDS             381609..382949
                     /locus_tag="Selsp_0344"
                     /note="COGs: COG0399 pyridoxal phosphate-dependent enzyme
                     apparently involved in regulation of cell wall biogenesis;
                     InterPro IPR000653;
                     KEGG: elm:ELI_2397 lipopolysaccharide biosynthesis protein
                     RfbH;
                     PFAM: DegT/DnrJ/EryC1/StrS aminotransferase;
                     SPTR: Lipopolysaccharide biosynthesis protein RfbH;
                     IMG reference gene:2504585802;
                     PFAM: DegT/DnrJ/EryC1/StrS aminotransferase family"
                     /codon_start=1
                     /transl_table=11
                     /product="DegT/DnrJ/EryC1/StrS aminotransferase"
                     /protein_id="YP_004412777.1"
                     /db_xref="GI:330838197"
                     /db_xref="InterPro:IPR000653"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496553"
                     /translation="MKEIEAKKQELHDKILALVREYADEYHKPMPWTKGARIPYAGRV
                     YDHEEMEALVDSSLEFWLTAGRYAAQFEKGLAAFLGTRHALAVNSGSAANLLAFMALT
                     SPLLGERAVRPGDEVITVAAGFPTTVAPIIQYGAVPVFVDVTIPQYNIDVTRLEEALS
                     PKTRAVMLAHTLGNPFDLQAVKAFCEKHGLWLVEDNCDALGSRYEIDGKQRYTGTVGD
                     IGTSSFYPPHHMTMGEGGAVYTKDALLFRILRSLRDWGRDCVCPPGEDGFCGHRFDGQ
                     YGELPRGYDHKYVYSHFGYNLKVTDMQAAVGCAQLKKLPSFVEKRRQNFTRLKAALQG
                     IEEKLILPEPCPHSEPSWFGFLLTCREGVEREPIVRALEAHGIQTRMLFAGNLVKHPC
                     FDRLREAKSGYRVVGELSATDRIMRDTFWLGVYPGMAAEQIDYMAEVLHSVLNG"
     misc_feature    381621..382940
                     /locus_tag="Selsp_0344"
                     /note="lipopolysaccharide biosynthesis protein RfbH;
                     Provisional; Region: PRK15407"
                     /db_xref="CDD:237960"
     misc_feature    381753..382931
                     /locus_tag="Selsp_0344"
                     /note="3-amino-5-hydroxybenzoic acid synthase family
                     (AHBA_syn). AHBA_syn family belongs to pyridoxal phosphate
                     (PLP)-dependent aspartate aminotransferase superfamily
                     (fold I). The members of this CD are involved in various
                     biosynthetic pathways for secondary...; Region: AHBA_syn;
                     cd00616"
                     /db_xref="CDD:99740"
     misc_feature    order(381876..381881,382191..382193,382200..382202,
                     382275..382277,382287..382292,382752..382754)
                     /locus_tag="Selsp_0344"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99740"
     misc_feature    order(381876..381881,381975..381977,382191..382193,
                     382200..382202,382275..382277,382290..382292)
                     /locus_tag="Selsp_0344"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99740"
     misc_feature    382290..382292
                     /locus_tag="Selsp_0344"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99740"
     gene            383019..384317
                     /locus_tag="Selsp_0345"
                     /db_xref="GeneID:10496554"
     CDS             383019..384317
                     /locus_tag="Selsp_0345"
                     /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
                     InterPro IPR002201;
                     KEGG: mpt:Mpe_A2764 lipopolysaccharide
                     heptosyltransferase-1, putative;
                     PFAM: Glycosyl transferase, family 9;
                     SPTR: Heptosyltransferase family protein;
                     IMG reference gene:2504585803;
                     PFAM: Glycosyltransferase family 9 (heptosyltransferase)"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 9"
                     /protein_id="YP_004412778.1"
                     /db_xref="GI:330838198"
                     /db_xref="InterPro:IPR002201"
                     /db_xref="GeneID:10496554"
                     /translation="MKTILGTFEVFGERLSPDAPFPAQDFMRVMEPVFAAEGYRTPRT
                     AGEKMQMLVIMDAGVGDFLCFSGALREIRRLYPAAAITLMIFPPGFKLAEQCPYIDFL
                     LGNEQLPVLRHVSELFAAHAGYAAEHLLGQRFDLAFVFGHYASAYLLAYMAGAKERIG
                     HIGDFSEGGISREDCASLLTRPLEKPVHPLHMVDLCFDVLDQMLAAPVADRSLELWLT
                     KADIAGVREKLAYLGAPSAGRKLFAIGLGGSTRRKHWPSAAYAAFLRLLLAEESEAFF
                     LLLGGRDDAAEAAEVARALGEEHVLSLAGALDFRETASAVTLCSAYIGNDTSLLHIAA
                     IVGLPVLEVCCYGSDLPLDEKAIPRSYYPYRTASVIVQPARALADCAEEPRDAYGCKH
                     IEEAHCIASIEPQTVLEAYHLLLQQVKEGRREPVFVAEEA"
     misc_feature    383172..384248
                     /locus_tag="Selsp_0345"
                     /note="Glycosyltransferases catalyze the transfer of sugar
                     moieties from activated donor molecules to specific
                     acceptor molecules, forming glycosidic bonds. The acceptor
                     molecule can be a lipid, a protein, a heterocyclic
                     compound, or another carbohydrate...; Region:
                     Glycosyltransferase_GTB_type; cl10013"
                     /db_xref="CDD:263942"
     gene            384349..385155
                     /locus_tag="Selsp_0346"
                     /db_xref="GeneID:10496555"
     CDS             384349..385155
                     /locus_tag="Selsp_0346"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585804"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412779.1"
                     /db_xref="GI:330838199"
                     /db_xref="GeneID:10496555"
                     /translation="MDMPFDERIYAEMVSLFDDKMPGDVLLVQMDAVWEARFRQDHAD
                     FTFQSTSWEALFPEAWYGRFALIVLAPGIEELHEPESVLCALQDFLVEGGSVIVPFRN
                     ARHWSVFRSWLAGELRYGSNPLLAGNGRLLSFVEIQRLVKLAHYEELAVCSVVEEGDA
                     ETLRLLQVCGAANERRDLETLWWITRWSAFSWKVLRLKAHYTDAERRLLARLLHRLEN
                     GIEAAETVEALRRLLAESRIDGGYLEEFVRNTAGDADSVCDILRKEELLR"
     gene            385152..385835
                     /locus_tag="Selsp_0347"
                     /db_xref="GeneID:10496556"
     CDS             385152..385835
                     /locus_tag="Selsp_0347"
                     /note="KEGG: chy:CHY_0980 glycosyl transferase family
                     protein;
                     SPTR: Glycosyl transferase, group 2 family;
                     IMG reference gene:2504585805"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family protein"
                     /protein_id="YP_004412780.1"
                     /db_xref="GI:330838200"
                     /db_xref="GeneID:10496556"
                     /translation="MNEDAKKIAFISCVNDEEMYAECVRYLRHLDLPQGVSAELVPVH
                     GAPSMAAGYEAARRASSAQYKVYLHQDILLTEKRIIFRLWEIFREKPEVGLIGLTGCR
                     HMSPDGVWWNAKECYGSVWQIRDPEAMDLLEQRPVPDAGIEAEALDGIFLATQTDVPW
                     RDDLFTGWHFYDISASMEYRRRGMRLMIPHFEKPPCIHETGRKRLDDSWETARQVFLA
                     EYGKELQHG"
     misc_feature    385173..385811
                     /locus_tag="Selsp_0347"
                     /note="Glycosyltransferase like family; Region:
                     Glyco_tranf_2_5; pfam13712"
                     /db_xref="CDD:258010"
     gene            385851..386939
                     /locus_tag="Selsp_0348"
                     /db_xref="GeneID:10496557"
     CDS             385851..386939
                     /locus_tag="Selsp_0348"
                     /EC_number="4.2.1.45"
                     /note="COGs: COG0451 Nucleoside-diphosphate-sugar
                     epimerase;
                     InterPro IPR001509:IPR013445;
                     KEGG: csh:Closa_0495 CDP-glucose 4,6-dehydratase;
                     PFAM: NAD-dependent epimerase/dehydratase;
                     PRIAM: CDP-glucose 4,6-dehydratase;
                     SPTR: CDP-glucose 4,6-dehydratase;
                     TIGRFAM: CDP-glucose 4,6-dehydratase;
                     IMG reference gene:2504585806;
                     PFAM: NAD dependent epimerase/dehydratase family;
                     TIGRFAM: CDP-glucose 4,6-dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="CDP-glucose 4,6-dehydratase"
                     /protein_id="YP_004412781.1"
                     /db_xref="GI:330838201"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR013445"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496557"
                     /translation="MKKMTRRNDLAFYRGKRVLLTGHTGFKGIWISKLLLGAGAHLTG
                     FSLASPTVDGARLFEKLKLADSMRSIEGDVRDLASLRAAFREARPEIVVHLAAQPLVR
                     ESYRTPVETYAVNVMGTAHVLECVRESDTVRSFLNVTTDKVYENKEWEWGYREDERLM
                     GFDPYSNSKSCAELVTASYRQSFFADGGVRISTARAGNVIGGGDFSPERIVPDCIRAA
                     SEGRAVVLRNPASTRPYQHVLEPLSAYLRIAHAQASDASLAGSYNVGPADSDCVTTGD
                     LAELFCRAWGEGASWRAEEECAAPHEAGFLKLDSSRIKARLGWQPRWHIEEAIAHTVD
                     WAKSWRAGEDVGDVMEAQIAAYFEEAEA"
     misc_feature    385884..386918
                     /locus_tag="Selsp_0348"
                     /note="CDP-glucose 4,6-dehydratase; Region:
                     CDP_4_6_dhtase; TIGR02622"
                     /db_xref="CDD:233954"
     misc_feature    385884..386882
                     /locus_tag="Selsp_0348"
                     /note="CDP-D-glucose 4,6-dehydratase, extended (e) SDRs;
                     Region: CDP_GD_SDR_e; cd05252"
                     /db_xref="CDD:187562"
     misc_feature    order(385914..385916,385920..385931,385986..385994,
                     385998..386000,386064..386075,386133..386141,
                     386145..386147,386190..386192,386262..386273,
                     386343..386345,386355..386357,386436..386447,
                     386475..386477)
                     /locus_tag="Selsp_0348"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:187562"
     misc_feature    order(386079..386081,386163..386165,386172..386177,
                     386184..386189,386199..386201,386208..386213,
                     386220..386222,386229..386231,386295..386297,
                     386301..386306,386310..386324,386328..386342,
                     386349..386351,386358..386363,386370..386375,
                     386382..386387,386391..386399,386403..386405,
                     386757..386765,386769..386771,386775..386777,
                     386781..386786,386790..386795)
                     /locus_tag="Selsp_0348"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187562"
     misc_feature    order(386079..386081,386163..386165,386172..386177,
                     386184..386189,386199..386201,386208..386213,
                     386220..386222,386229..386231,386322..386324,
                     386328..386330,386334..386342,386349..386351,
                     386358..386363,386370..386375,386382..386387,
                     386391..386399,386403..386405)
                     /locus_tag="Selsp_0348"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187562"
     misc_feature    order(386145..386153,386268..386276,386343..386345,
                     386442..386444,386472..386480,386487..386489,
                     386523..386534,386541..386543,386547..386549,
                     386553..386555,386670..386672,386754..386756)
                     /locus_tag="Selsp_0348"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187562"
     misc_feature    order(386193..386195,386268..386270,386343..386345,
                     386355..386357)
                     /locus_tag="Selsp_0348"
                     /note="active site"
                     /db_xref="CDD:187562"
     gene            386936..388330
                     /locus_tag="Selsp_0349"
                     /db_xref="GeneID:10496558"
     CDS             386936..388330
                     /locus_tag="Selsp_0349"
                     /note="InterPro IPR005358;
                     KEGG: slp:Slip_1896 hypothetical protein;
                     PFAM: Uncharacterised protein family UPF0153;
                     SPTR: FliB family protein;
                     IMG reference gene:2504585807"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412782.1"
                     /db_xref="GI:330838202"
                     /db_xref="GeneID:10496558"
                     /translation="MKRQDECLEKDAARGGESDEGGGKAAESIFASAAAPRPCLQPVY
                     MRRFVCDGRRCGSLCCCAKWGVALDAATLARYEGRPELLHELKKGLERSEATGGWIMR
                     HEDGRCVFLREDGLCSLHRRFGIGAISDVCAEYPRKMHEVGDTLDRALCLSCPVAAEE
                     VLFTEEPLAFEWVEVAAPRPAYVDRMPLGTPLSAAVFRSLQLAGIALLAERRLSLDAR
                     LAALGLLLARAEAYVEQGAAEDLTRDAAAIADAAAGEAKALLAANPFDAALYLGFFQR
                     LFPALAQATEDDLPETAAYLARIRRAFGEGDGDAASGRGAVEKKSVCAALAERRRRYG
                     ERILSKHGNALENWLVNEFLIGRYPLTGGTSFLANYEVFVVLYKMLEFLLLADPALDE
                     GGVSALQVMTDATEKDVESVGQDERTKRSILAAAGWLAVRTNHFPGYIDALAEKIARL
                     LPEDRLLSLLDGNF"
     misc_feature    387083..387400
                     /locus_tag="Selsp_0349"
                     /note="Putative zinc- or iron-chelating domain; Region:
                     CxxCxxCC; pfam03692"
                     /db_xref="CDD:252103"
     gene            complement(388653..390902)
                     /locus_tag="Selsp_0350"
                     /db_xref="GeneID:10496559"
     CDS             complement(388653..390902)
                     /locus_tag="Selsp_0350"
                     /EC_number="1.17.4.1"
                     /note="InterPro IPR013344:IPR000788;
                     KEGG: ipo:Ilyop_1136 ribonucleoside-diphosphate reductase,
                     adenosylcobalamin-dependent;
                     PFAM: Ribonucleotide reductase large subunit, C-terminal;
                     PRIAM: Ribonucleoside-diphosphate reductase;
                     SPTR: Ribonucleoside-diphosphate reductase,
                     adenosylcobalamin-dependent;
                     TIGRFAM: Ribonucleoside-diphosphate reductase,
                     adenosylcobalamin-dependent;
                     IMG reference gene:2504585808;
                     PFAM: Ribonucleotide reductase, barrel domain;
                     TIGRFAM: ribonucleoside-diphosphate reductase,
                     adenosylcobalamin-dependent"
                     /codon_start=1
                     /transl_table=11
                     /product="ribonucleoside-diphosphate reductase,
                     adenosylcobalamin-dependent"
                     /protein_id="YP_004412783.1"
                     /db_xref="GI:330838203"
                     /db_xref="InterPro:IPR000788"
                     /db_xref="InterPro:IPR013344"
                     /db_xref="GeneID:10496559"
                     /translation="MEKWFDTEIGRSILQAKYYHAGETEPHEFIERVAGIFSPEVREK
                     MRAYLEDGALSPAGRTLYAAGAKGKFKSSLSNCYIMPSPTDDIESIFTVNQQIAKIFS
                     YGGGIGVNISGLRPKDSRVNNVARSSTGAVSFLKIFNTTGEVISQNGRRGAMLVALDS
                     EHPDIYEFLHMKQENEKLASMNLSILFSDAFMQAVIDDAEYELTFDVEATGEKIRRTI
                     RAAEFFDEYCQTQWDWGDPGALFKDRLNDYTLLSGYDEYKIEVTNPCGEFGGNAYNSC
                     NLMSLNLYSFIEDKFGDAPHIAEEEFRAAIQTAVRALDEVLDYGFDTQPLEENRQCIR
                     DWRSVGLGLFGVADAFVAMKLAYGSRESCDFIQGVLRTMFTEAARTSAALAKEKGAFG
                     KYDWEKTKKSPLIQRLAEEAPEVYAEIKEYGLRNGTLLSIAPTGTISLLMGVFSGGCE
                     PLYQISYERTTHKMEEGSGSFRVYAHSVSDLLDYHKLPHDLTNEDIKKRFPWVIESHD
                     VPYLHRVELQAAMQKYVDNSISSTVNLKHAATPADIRNIYLAAWKSRCKGITVFRDGC
                     KRGNILGVKEAAEQEIAYDTVRPRRRDNIARLEGVTLLRHTSCVDKMYITVNKTSDGD
                     VFELFTNTSGGCQSNIATITRLTSLALRSGVRVKDIIKQLTVSRCSACQALIRSGRKD
                     ISLSCGSAIGTALAEIYNECQKDETAKYKDKSDDKAINKECPECKRHTLRPEGNCVTC
                     TYCGWSKCE"
     misc_feature    complement(389208..390737)
                     /locus_tag="Selsp_0350"
                     /note="Class II ribonucleotide reductase, dimeric form;
                     Region: RNR_II_dimer; cd02888"
                     /db_xref="CDD:153089"
     misc_feature    complement(order(389589..389606,390069..390071,
                     390102..390104,390108..390116,390444..390446,
                     390450..390455,390585..390593,390675..390677,
                     390729..390734))
                     /locus_tag="Selsp_0350"
                     /note="active site"
                     /db_xref="CDD:153089"
     misc_feature    complement(order(390459..390467,390471..390473,
                     390480..390485,390492..390494,390501..390503,
                     390516..390518,390525..390536,390543..390545,
                     390597..390599,390606..390611,390618..390623,
                     390627..390632,390639..390644,390696..390698))
                     /locus_tag="Selsp_0350"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:153089"
     misc_feature    complement(389214..390683)
                     /locus_tag="Selsp_0350"
                     /note="Ribonucleotide reductase, barrel domain; Region:
                     Ribonuc_red_lgC; pfam02867"
                     /db_xref="CDD:251578"
     misc_feature    complement(order(390465..390473,390501..390503,
                     390516..390521,390534..390536,390540..390542,
                     390558..390560,390597..390599,390633..390635,
                     390642..390647,390651..390653))
                     /locus_tag="Selsp_0350"
                     /note="effector binding site; other site"
                     /db_xref="CDD:153089"
     misc_feature    complement(388806..389069)
                     /locus_tag="Selsp_0350"
                     /note="TSCPD domain; Region: TSCPD; pfam12637"
                     /db_xref="CDD:257182"
     gene            391213..391542
                     /locus_tag="Selsp_0351"
                     /db_xref="GeneID:10496560"
     CDS             391213..391542
                     /locus_tag="Selsp_0351"
                     /note="COGs: COG1742 conserved hypothetical protein;
                     HAMAP: Uncharacterised protein family UPF0060;
                     InterPro IPR003844;
                     KEGG: cbe:Cbei_2176 hypothetical protein;
                     PFAM: Uncharacterised protein family UPF0060;
                     SPTR: UPF0060 membrane protein SELSPUOL_02349;
                     IMG reference gene:2504585809;
                     PFAM: Uncharacterised BCR, YnfA/UPF0060 family"
                     /codon_start=1
                     /transl_table=11
                     /product="UPF0060 membrane protein ynfA"
                     /protein_id="YP_004412784.1"
                     /db_xref="GI:330838204"
                     /db_xref="InterPro:IPR003844"
                     /db_xref="GeneID:10496560"
                     /translation="MLVLKSLAYFLLAGLFEIGGGYLIWQWLRNGASLWYAFFGAVIL
                     ILYGVVPTLQPEGSFGRVYAAYGGVFIVLSLLWGWRVDGIAPDRFDIIGSAIALAGVA
                     VIMYAPR"
     misc_feature    391219..391539
                     /locus_tag="Selsp_0351"
                     /note="hypothetical protein; Provisional; Region:
                     PRK02237"
                     /db_xref="CDD:235016"
     gene            complement(391620..398354)
                     /locus_tag="Selsp_0352"
                     /db_xref="GeneID:10496561"
     CDS             complement(391620..398354)
                     /locus_tag="Selsp_0352"
                     /note="InterPro IPR005546:IPR006315;
                     KEGG: dvm:DvMF_1880 outer membrane autotransporter barrel
                     domain protein;
                     SMART: Autotransporter beta-domain;
                     SPTR: Putative outer membrane autotransporter barrel
                     domain protein;
                     TIGRFAM: Outer membrane autotransporter barrel;
                     IMG reference gene:2504585810"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane autotransporter barrel domain
                     protein"
                     /protein_id="YP_004412785.1"
                     /db_xref="GI:330838205"
                     /db_xref="InterPro:IPR005546"
                     /db_xref="InterPro:IPR006315"
                     /db_xref="GeneID:10496561"
                     /translation="MFNKKSSRHSLALFVALALGSGALLAPSTAGAADVSGQNVEIDD
                     AHAPSNNAEHPGGGAAFGTAAGFIKDEHDNGNVKDNTLTFKNLSYNKYLYGGLTFGTG
                     NVTGNKVFVDPATSPHQSISDGIFGGAANNGGNVTDNHATFNGTHLNGDLVGGMATDG
                     GTGTVKKNTATLKGGNVHGSIYGGTTGNQASGDVLENEVLIEGGIVTGTGNVYGGYTD
                     ENSNVKGNTVTIKGGILNGIYGGYSSGTGEVSGNTVNLGDGTGAMAAGYAINGTLFGG
                     QNTTDPSKVSNNTLNVNTNAVAHNIKNFSTINFNFNAYTNTTQSLLTLNDSHGTTIER
                     LSDLKLKDVPRGSGTLIENASGLTINSYSGTLKLTAEKTETIIDKQGTTKIGYNAYQF
                     RDSTETRSEGLEVWGGRSTIGNTTTKNTVTLNGNYTGRNAYGGRTDGTGSTATGEDAT
                     NHSIENTITLDGAGSIVNNMTGGMTLSAGGKATGNRAVLKAGTVNGSLTGGSVGSSGG
                     DVTGNFVDVNGGTVHGTTYGGYASGTGKAEHNTVTLTGGTLNSDIYGGVASSGAAVKN
                     IVNITAGSAAGHDVYGGFSTHGDATGNTVNITGGSVRNVDGGRSLNGHATNNIVNIGS
                     ADAAFGGSITGIINGGSGTTYGNDYRTGNTLNVKGNVSAANISNFAEINFYFNSHVNQ
                     SNSFLTLSDAGGTTLHSLSDLKINGEHGRKGTLLKNTGGTITISDGNARLVKTNENKE
                     LVLAKSSDSKSITYEGYAFAHQTAPTTVTEGGTTNTWGGRSIGGNSTRHNKITVASGT
                     HTNIYGGWTAGSGTTAEDKDNSYENEVTLDGATTGNLYGGYTDNAAGKAEKNIVTVKS
                     GTVSTDLYGGIANKTTGTGHVKENIVNISGGTINNVYGGYSAGSGEVSGNKVTATGGT
                     GFNDVRGGYSTSGAANENKVTLGAVSTGAVTGGHGATAADGNEVTLTGTTVTGDVKGG
                     EGATTKKNIVNLNGGVTINGALKGGTGTPGAAGEENKLNVKGTNSAQSISNFQKLHFD
                     TTGATAANPLLNITGGATNLDWNTLDASGTSVNRTTLLKNTNGIHLSNYTAGTVKSKI
                     NEAGTTEYNIDVAKTGTLTTDITYQGYQFKGKTTATTEGTDTYGGRSKAGNTTTENEL
                     TVDSGSHTNIYGGWTSGAGSEAAADKQKDSTNNKATVKGAATATGNVIGGLTEVADGK
                     ATGNTVTVEKNLAANIIGGKAASGEASGNTVNLANATVNSVTGGDGTTTNNNTVNLNG
                     SAQVTGALKGGSQASGTGNTLNVKGKNNKAGSIENIQKMNFDATGLAKDDTMLEDTNA
                     AGTNVDWANLKASGTAAKPLTLLKNTHGINLTGYTGAAKSETGETTETNIDVRKTGTR
                     ITEITYEGYQFKGVTQATTVTEGAVTDTFGGRSKAGNSTRENTIEIASGTHTNVYGGW
                     TSGSGSTATDKDNSYKNTVTVKGSANVTNTLYGGYTEAAGGKATENTVTVEAGATVQN
                     IIGGKAAAEASNNTVNLANATVNSVTGGDGATTNNNIVNLKGNAQVTGALKGGSAANG
                     TGNTLNVTGTNNKAGSISGFQKLTFDTTNADANPMLQVTGGAATDVDWTNLTATGAAS
                     ETPKTLMENAAGINTNGRTGDAVKSELNTDATMETNIDVVKSGSTVTKLVYEGYTVKG
                     STKTTTYGADTWAGRSKAGNTTQDNTLTLDDASKSYTNVYGGWTSGTGTKAAADKQNN
                     SLNNTVNYTAGTLTGTLYGGYAANGEASGNTVNLGAGTSAANIYGGFGSVTKNNTINL
                     KGARVTGMVYGGSATNGTGNTLAVYKPSEVQNFAGVQNLHFHTDELTAGNTTPLLKLG
                     TTTKDIRGLNIGVDRRGDAPKLKKGDKLLLMKTAGGDLTTDDKIENKIEGKQGMARRY
                     TYEIKKENTGELTATVTQAGLGDDAKSPVETRAGLSNLVNQGADYIVESGISAAETAL
                     RADAGSSAKSDKSAQRKTAVSDNASYQLWAGVGANTMRVESGSHVDSKGWSLGVGWAR
                     EDEMKDGAKRLFSPFVEYGRGSYDSYLDNGAHGSGTIGYLGIGVLGKLTQKDGLWLEG
                     SVRGGRATSDYQLHGSSDANYDGSNTYYGIHLGIGKTVELKKDSAIDAYARYFWSHQN
                     GMSVKLSSGDDYDFASVDSHRLRLGFRYSQKDQQQGEFYTGLAWEYEFDGEARASIGG
                     DAAPSPSLKGSSYMLELGYRFSPENSRVSYDLHLNGWQGKRKGITGGASVKWAF"
     misc_feature    complement(391764..392396)
                     /locus_tag="Selsp_0352"
                     /note="Autotransporter beta-domain; Region:
                     Autotransporter; smart00869"
                     /db_xref="CDD:214872"
     gene            398572..399903
                     /locus_tag="Selsp_0353"
                     /db_xref="GeneID:10496562"
     CDS             398572..399903
                     /locus_tag="Selsp_0353"
                     /note="COGs: COG1316 Transcriptional regulator;
                     InterPro IPR004474;
                     KEGG: afn:Acfer_0288 cell envelope-related transcriptional
                     attenuator;
                     PFAM: Cell envelope-related transcriptional attenuator;
                     SPTR: Membrane bound protein LytR;
                     TIGRFAM: Cell envelope-related transcriptional attenuator;
                     IMG reference gene:2504585811;
                     PFAM: Cell envelope-related transcriptional attenuator
                     domain;
                     TIGRFAM: cell envelope-related function transcriptional
                     attenuator common domain"
                     /codon_start=1
                     /transl_table=11
                     /product="cell envelope-related transcriptional
                     attenuator"
                     /protein_id="YP_004412786.1"
                     /db_xref="GI:330838206"
                     /db_xref="InterPro:IPR004474"
                     /db_xref="GeneID:10496562"
                     /translation="MEQKRSYRRIGILVAVLLVAAVAAAAAHFFGSGLVRRTTADGMI
                     AGSSEIHVMILGVDERKDDVGRSDTLMVATVDPEKGTASLLSIPRDTRVAIEGAGYDK
                     INAAYAYGGYALTKKTLEQLLDVPMDYYILIDVHAFERIIDALDGIDIDVEKRMYYED
                     PWDDDGGLVIDIYPGMQHMTGEKAIEYVRYRDMEGDIGRIRRQQRFMRAVLQKVTSPE
                     IFAKLPEIVSEVAKSVKTDLDTGDMIKFLQIMKKVQEDGLAAEMAPGNPAWFKGVSYW
                     IPDIVEIRRMAARAAGVPFAGEAAERAESYAAKYKADMPEGFRFDDAEPQQAGAKTTG
                     EGAGASGENAAKKKEEPTKPPAPSAVAVTVVNSSGITGAGAEVAAILQAKGFVIRSVE
                     TGKRSDRAQTTITAGGRTVDLFYGMPFPCILMEGGAKDEALVNIGRDYVKR"
     misc_feature    398725..399450
                     /locus_tag="Selsp_0353"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LytR; COG1316"
                     /db_xref="CDD:224235"
     misc_feature    399640..>399792
                     /locus_tag="Selsp_0353"
                     /note="LytR cell envelope-related transcriptional
                     attenuator; Region: LytR_C; pfam13399"
                     /db_xref="CDD:257724"
     gene            400064..402076
                     /locus_tag="Selsp_0354"
                     /db_xref="GeneID:10496563"
     CDS             400064..402076
                     /locus_tag="Selsp_0354"
                     /note="COGs: COG0488 ATPase components of ABC transporter
                     with duplicated ATPase domains;
                     InterPro IPR003593:IPR003439;
                     KEGG: vpr:Vpar_0662 ABC transporter related protein;
                     PFAM: ABC transporter-like;
                     SMART: ATPase, AAA+ type, core;
                     SPTR: ABC transporter domain protein;
                     IMG reference gene:2504585812;
                     PFAM: ABC transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter related protein"
                     /protein_id="YP_004412787.1"
                     /db_xref="GI:330838207"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR017871"
                     /db_xref="GeneID:10496563"
                     /translation="MKAVGLAKSFGVKEIFHDVSFEVRRGERAGLVGANGAGKTTLMR
                     CLLGEEEADAGSVQLDDGAAIGYVEQQAAFGEGTLYEEFRRAFADVIDLGEKKRALEK
                     EIAAASSEEKLALYGRVVDEFERLGGYSFESRIRRVAFGLGFTAEDFEKDVHHFSGGQ
                     RTRICLAKALLREPDFLFLDEPTNHLDIKMIEWLEDFLSEYAGGVIIISHDRFFLDRV
                     ATHILDLSGGTVTAYAGNYSYFQKVHAERQKSLLAAYEKQQEHIKRTEEYIRRYRAGI
                     KAKQARGRESQLRRMERIVLPAEKASFSYFAFHPPAECADRVAELEDVTFAFGSRTVF
                     SHLSLLVRKGDGIAVVGPNGAGKTTLLRVLLGELAAQTGRVKIGSRVKIGYFSQQHEG
                     LNPENTLVGELNYDFGIAEDEARKYLGAFLFHGDEVFRRIGDLSGGEQARLAFLKLML
                     TGANFLVLDEPTNHLDIPAREAVEEALMAFPGTFVVVSHDRYFLDKVANTTAELAAGS
                     LREYEGNYSYYRMKKEIEEKEAAEAAEERAGGAKKAAKKSTTSAMRRAAGAASDVSPM
                     QAGTAAGAASGADASKTAEESAAARKEQEQRRLASLSDAKRTEMLARAEAEIAMAEAE
                     LKGLEFEMNRPEVQGDPEKSAEIAELYAAKEQEIEERYARWEALAD"
     misc_feature    400067..400750
                     /locus_tag="Selsp_0354"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    400076..401623
                     /locus_tag="Selsp_0354"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     misc_feature    400730..400963
                     /locus_tag="Selsp_0354"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    401021..401575
                     /locus_tag="Selsp_0354"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            402160..404343
                     /locus_tag="Selsp_0355"
                     /db_xref="GeneID:10496564"
     CDS             402160..404343
                     /locus_tag="Selsp_0355"
                     /EC_number="3.1.11.5"
                     /note="COGs: COG0507 ATP-dependent exoDNAse (exonuclease
                     V) alpha subunit - helicase superfamily I member;
                     InterPro IPR003583:IPR000606:IPR003593:IPR006345;
                     KEGG: afn:Acfer_1467 helicase, RecD/TraA family;
                     PFAM: Helicase domain, viral-like;
                     PRIAM: Exodeoxyribonuclease V;
                     SMART: ATPase, AAA+ type, core; Helix-hairpin-helix
                     DNA-binding motif, class 1;
                     SPTR: Helicase, RecD/TraA family;
                     TIGRFAM: DNA helicase, RecD/TraA type;
                     IMG reference gene:2504585813;
                     PFAM: Viral (Superfamily 1) RNA helicase;
                     TIGRFAM: helicase, putative, RecD/TraA family"
                     /codon_start=1
                     /transl_table=11
                     /product="helicase, RecD/TraA family"
                     /protein_id="YP_004412788.1"
                     /db_xref="GI:330838208"
                     /db_xref="InterPro:IPR000606"
                     /db_xref="InterPro:IPR003583"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR006345"
                     /db_xref="InterPro:IPR010994"
                     /db_xref="GeneID:10496564"
                     /translation="METLEGTAQSVVFAAPEGGFTVFRLRPSGRRGLVTVTANAPAPL
                     VGQEIALSGEWVQHPRFGEQFKAATLRVSAPTSLAGIERFLASGAIAGVGEAMAHRLV
                     QKFGKETLEIIEKKPSRLTEVAGVGKKTAAKIHASYMEKEELREIMLWLEMHGVSGAY
                     AARIFETYSSFAIEVMEKHPYRLARDIAGIGFLTADAIAKSAGIAEDSKERIEAGLGH
                     ALLTVSQQGHCCIPAPALTERAAKLLGTPTEEVREVLKEALAAERLAFEEVGAETLIY
                     PPWLYRAEKRTAQMLFFLQQKAAVLPAERAAAIVADWERAAGITLAAEQQQAVAAVLD
                     HAVFVLTGGPGTGKTTVVRGMIAVLESQGLSVLLGAPTGRAAKRLAEATGRKAETVHR
                     LLGAQGGIEADGSPVFEKDADDPLDADAIILDEVSMMDIVLMEHFLEAVPEGARVILV
                     GDVDQLPAVGPGAVLKDILRSGAVPSVRLKEVFRQSGEGTIVLNAHAINRGRMPQFAV
                     GGDFEFLEMPDEETAARRIVALCREELPREGFSALDAVQVLSPMHRTPCGVDNLNRLL
                     QAALNPPAPEKAEFRNSTLTLRVGDKVMQTKNDYTKGVFNGDIGFIREVSADGVKVRY
                     SDELTADYEPNELMMLTLAYAMSVHKSQGSEYPVIVLPLVAAHHIMLQRNLLYTAVTR
                     AKKKVVLLGSKAAVFTAVSNDRTRRRYTLLAERLAGAGGESPLLS"
     misc_feature    402169..404307
                     /locus_tag="Selsp_0355"
                     /note="helicase, putative, RecD/TraA family; Region:
                     recD_rel; TIGR01448"
                     /db_xref="CDD:233418"
     misc_feature    402427..402597
                     /locus_tag="Selsp_0355"
                     /note="Helix-hairpin-helix domain; Region: HHH_5;
                     pfam14520"
                     /db_xref="CDD:258660"
     misc_feature    402568..402849
                     /locus_tag="Selsp_0355"
                     /note="Helix-hairpin-helix containing domain; Region:
                     HHH_4; pfam14490"
                     /db_xref="CDD:258630"
     misc_feature    403195..403665
                     /locus_tag="Selsp_0355"
                     /note="AAA domain; Region: AAA_30; pfam13604"
                     /db_xref="CDD:257919"
     misc_feature    403918..404229
                     /locus_tag="Selsp_0355"
                     /note="UvrD-like helicase C-terminal domain; Region:
                     UvrD_C_2; pfam13538"
                     /db_xref="CDD:257857"
     gene            404340..405029
                     /locus_tag="Selsp_0356"
                     /db_xref="GeneID:10496565"
     CDS             404340..405029
                     /locus_tag="Selsp_0356"
                     /note="COGs: COG1040 amidophosphoribosyltransferase;
                     InterPro IPR000836;
                     KEGG: dra:DR_1389 competence protein ComF, putative;
                     PFAM: Phosphoribosyltransferase;
                     SPTR: Competence protein F;
                     IMG reference gene:2504585814;
                     PFAM: Phosphoribosyl transferase domain;
                     TIGRFAM: comF family protein"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphoribosyltransferase"
                     /protein_id="YP_004412789.1"
                     /db_xref="GI:330838209"
                     /db_xref="InterPro:IPR000836"
                     /db_xref="GeneID:10496565"
                     /translation="MRGAAWLAALADAVSSVVFPARCPACGAYCERRGGWCAPCLSRT
                     VRPHRLALSAEALAALDDAWAVGFYGGALGTLIRDLKYRGRRGVLPYIHAALAAAKLP
                     EQFLVADLAVYVPLHEAREKERGFNQAELIFAEWLKAKVIPVRPLLTRMRSTVPQYGL
                     GEKERRKNVRGAFSLSEAGKGGAGEIAGKSIVLLDDILTTGATLTSCAAVLKKAGAGS
                     VYALALASDRS"
     misc_feature    404394..405026
                     /locus_tag="Selsp_0356"
                     /note="Predicted amidophosphoribosyltransferases [General
                     function prediction only]; Region: ComFC; COG1040"
                     /db_xref="CDD:223970"
     misc_feature    404631..405011
                     /locus_tag="Selsp_0356"
                     /note="Phosphoribosyl transferase (PRT)-type I domain;
                     Region: PRTases_typeI; cd06223"
                     /db_xref="CDD:206754"
     misc_feature    order(404682..404684,404709..404711,404922..404930,
                     404934..404948)
                     /locus_tag="Selsp_0356"
                     /note="active site"
                     /db_xref="CDD:206754"
     gene            complement(405149..406930)
                     /locus_tag="Selsp_0357"
                     /db_xref="GeneID:10496566"
     CDS             complement(405149..406930)
                     /locus_tag="Selsp_0357"
                     /note="COGs: COG0441 Threonyl-tRNA synthetase;
                     InterPro IPR012947:IPR002320:IPR002314:IPR004154;
                     KEGG: tro:trd_1067 threonyl-tRNA synthetase;
                     PFAM: Aminoacyl-tRNA synthetase, class II (G/ H/ P/ S),
                     conserved domain; Threonyl/alanyl tRNA synthetase, SAD;
                     Anticodon-binding;
                     SMART: Threonyl/alanyl tRNA synthetase, SAD;
                     SPTR: Threonyl-tRNA synthetase;
                     TIGRFAM: Threonyl-tRNA synthetase, class IIa;
                     IMG reference gene:2504585815;
                     PFAM: Anticodon binding domain; Threonyl and Alanyl tRNA
                     synthetase second additional domain; tRNA synthetase class
                     II core domain (G, H, P, S and T);
                     TIGRFAM: threonyl-tRNA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="threonyl-tRNA synthetase"
                     /protein_id="YP_004412790.1"
                     /db_xref="GI:330838210"
                     /db_xref="InterPro:IPR002314"
                     /db_xref="InterPro:IPR002320"
                     /db_xref="InterPro:IPR004154"
                     /db_xref="InterPro:IPR006195"
                     /db_xref="InterPro:IPR012947"
                     /db_xref="InterPro:IPR018163"
                     /db_xref="GeneID:10496566"
                     /translation="MDKEQFLHVYRHSLAHVLAKAVIEVFGKETQYAIGPEIADGFYY
                     DFLLPRAATNDDLKTIEEKMKEILKRKEDWKREEISKKDALELFKNQKFKVELIEDLP
                     DDEILTTYRTGDDFVDLCRGPHVENSAALLSVAWQLRSMSGSYWRGDEKRDQLTRIYA
                     YAFPTKEELKAHLAFIKDAQERDHKKIGPQLDLFMFDETAPGMPYWLPRGWKLFNALL
                     EFWRGIHEAHGYQEVSAPVINNKRLWVTSGHWAHYKENMFLIPGADGDIEADDTFAIK
                     PMNCPNAIKIYQRKTRSYRDLPIRYNTVDVIHRKEKSGELNGLFRVQLFRQDDDHTFL
                     MEDQIAAEMGDIMDIADEIYSTLGMSCKAELSTRPDDFMGDIETWNVAEKELKAILDR
                     KYGEGNYEVNEGDGAFYGPKIDLKMKDALGREWQVGTLQLDFQLPQNFDLKYIAKDGS
                     HKQPVVLHRAIFGSMERFIGVLIENFKGAFPFWLSPVQVGIVPIRPEHNDYAKKVAQK
                     LFKSRVRFEVDYADKNMREKIKGFKHYKDPYILVLGDKEAEENTVSINVRGTNEQLKD
                     VPLDTFIEMCRTMNEEHSLELMTKVPE"
     misc_feature    complement(405173..406927)
                     /locus_tag="Selsp_0357"
                     /note="threonyl-tRNA synthetase; Reviewed; Region: thrS;
                     PRK12305"
                     /db_xref="CDD:237050"
     misc_feature    complement(406454..406612)
                     /locus_tag="Selsp_0357"
                     /note="Threonyl and Alanyl tRNA synthetase second
                     additional domain; Region: tRNA_SAD; pfam07973"
                     /db_xref="CDD:254556"
     misc_feature    complement(405473..406387)
                     /locus_tag="Selsp_0357"
                     /note="Threonyl-tRNA synthetase (ThrRS) class II core
                     catalytic domain. ThrRS is a homodimer. It is responsible
                     for the attachment of threonine to the 3' OH group of
                     ribose of the appropriate tRNA. This domain is primarily
                     responsible for ATP-dependent...; Region: ThrRS_core;
                     cd00771"
                     /db_xref="CDD:238394"
     misc_feature    complement(order(405530..405532,405539..405544,
                     405638..405640,405650..405655,405662..405664,
                     405950..405952,405956..405958,405965..405973,
                     405986..405994,405998..406000,406004..406006,
                     406100..406102,406160..406165,406172..406174,
                     406184..406186,406337..406339,406376..406378))
                     /locus_tag="Selsp_0357"
                     /note="active site"
                     /db_xref="CDD:238394"
     misc_feature    complement(order(405590..405592,405596..405598,
                     405743..405745,405752..405757,405878..405880,
                     405959..405964,405992..405994,406001..406003,
                     406007..406009,406046..406054,406058..406066,
                     406073..406078,406112..406114,406118..406129,
                     406151..406159,406211..406213,406217..406225,
                     406229..406231,406235..406240,406250..406255,
                     406298..406300,406307..406309,406313..406318,
                     406322..406324,406328..406330,406334..406342,
                     406346..406348,406364..406366))
                     /locus_tag="Selsp_0357"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(406217..406240)
                     /locus_tag="Selsp_0357"
                     /note="motif 1; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(405998..406009)
                     /locus_tag="Selsp_0357"
                     /note="motif 2; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(405530..405544)
                     /locus_tag="Selsp_0357"
                     /note="motif 3; other site"
                     /db_xref="CDD:238394"
     misc_feature    complement(405206..405475)
                     /locus_tag="Selsp_0357"
                     /note="ThrRS Threonyl-anticodon binding domain. ThrRS
                     belongs to class II aminoacyl-tRNA synthetases (aaRS).
                     This alignment contains the anticodon binding domain,
                     which is responsible for specificity in tRNA-binding, so
                     that the activated amino acid is...; Region:
                     ThrRS_anticodon; cd00860"
                     /db_xref="CDD:238437"
     misc_feature    complement(order(405263..405265,405269..405271,
                     405299..405301,405323..405325,405341..405343,
                     405446..405451))
                     /locus_tag="Selsp_0357"
                     /note="anticodon binding site; other site"
                     /db_xref="CDD:238437"
     gene            complement(407109..407466)
                     /locus_tag="Selsp_0358"
                     /pseudo
                     /db_xref="GeneID:10496567"
     gene            complement(407469..407837)
                     /locus_tag="Selsp_0359"
                     /db_xref="GeneID:10496568"
     CDS             complement(407469..407837)
                     /locus_tag="Selsp_0359"
                     /note="InterPro IPR012650:IPR004260;
                     KEGG: lba:Lebu_1626 hypothetical protein;
                     PFAM: Pyrimidine dimer DNA glycosylase;
                     SPTR: Putative uncharacterized protein;
                     TIGRFAM: Conserved hypothetical protein CHP02328;
                     IMG reference gene:2504585817;
                     PFAM: Pyrimidine dimer DNA glycosylase;
                     TIGRFAM: conserved hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412791.1"
                     /db_xref="GI:330838211"
                     /db_xref="InterPro:IPR004260"
                     /db_xref="InterPro:IPR012650"
                     /db_xref="GeneID:10496568"
                     /translation="MRLWHEKLIHLLPKNQLLGQHRECCALRGNGWKKKHKTVDYVFT
                     YSPYHLFIYHVLVMEEMEKRGYHVSVEWKDKNYRGRTAEKYDNLNEEIIGSPIYKEHN
                     IEYLTDCIENLRDKGIHLKV"
     misc_feature    complement(407478..407837)
                     /locus_tag="Selsp_0359"
                     /note="Pyrimidine dimer DNA glycosylase; Region:
                     Pyr_excise; cl19573"
                     /db_xref="CDD:267926"
     gene            complement(408089..409405)
                     /locus_tag="Selsp_0360"
                     /db_xref="GeneID:10496569"
     CDS             complement(408089..409405)
                     /locus_tag="Selsp_0360"
                     /EC_number="5.4.3.8"
                     /note="COGs: COG0001 Glutamate-1-semialdehyde
                     aminotransferase;
                     InterPro IPR004639:IPR005814;
                     KEGG: mta:Moth_1244 glutamate-1-semialdehyde
                     2,1-aminomutase;
                     PFAM: Aminotransferase class-III;
                     PRIAM: Glutamate-1-semialdehyde 2,1-aminomutase;
                     SPTR: Glutamate-1-semialdehyde-2,1-aminomutase;
                     TIGRFAM: Tetrapyrrole biosynthesis,
                     glutamate-1-semialdehyde aminotransferase;
                     IMG reference gene:2504585818;
                     PFAM: Aminotransferase class-III;
                     TIGRFAM: glutamate-1-semialdehyde-2,1-aminomutase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate-1-semialdehyde-2,1-aminomutase"
                     /protein_id="YP_004412792.1"
                     /db_xref="GI:330838212"
                     /db_xref="InterPro:IPR004639"
                     /db_xref="InterPro:IPR005814"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496569"
                     /translation="MLNLEKSLEAFEEAKTLMPGGVNSPVRSYRNVDCNPPFIARGEG
                     AHIFDIDGNEYVDYVLSWGPLVAGHAHPAIVSALADAAARGTSYGAPTTLESDLVRLV
                     QKAYPSMQLVRMVNSGTEATMSALRLARGFTGRSKIVKFVGCYHGHSDSLLVDAGSGL
                     ATFGVPSSPGVTEGVAKDTITVPFNDTDAITRVMTEYGKDVACIIVEPVAGNMGCVLP
                     ENGYLDTLRALTEKHGALLIFDEVMCGFRASLGGAQAAYGITPDLTCLGKIIGGGLPC
                     AAYGGRRDIMEQIAPAGPVYQAGTLSGNPLAMTAGIETLKLILKEPEPGEADASRALT
                     LKTKKLVLGLESAAREAGVKIQAHQAGSMFSIFFSAGMVKDYASSAASDQEAFKVWFR
                     AMLEQGIYLAPSQFETLFLSLAHTDEDIDRTIAAAEKAFVEVKSKK"
     misc_feature    complement(408101..409396)
                     /locus_tag="Selsp_0360"
                     /note="glutamate-1-semialdehyde aminotransferase;
                     Provisional; Region: PRK00062"
                     /db_xref="CDD:234607"
     misc_feature    complement(408113..409375)
                     /locus_tag="Selsp_0360"
                     /note="Acetyl ornithine aminotransferase family. This
                     family belongs to pyridoxal phosphate (PLP)-dependent
                     aspartate aminotransferase superfamily (fold I). The major
                     groups in this CD correspond to ornithine
                     aminotransferase, acetylornithine aminotransferase;
                     Region: OAT_like; cd00610"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(408602..408604,408677..408682,
                     408686..408688,408785..408787,408962..408964,
                     408968..408973,409049..409057))
                     /locus_tag="Selsp_0360"
                     /note="inhibitor-cofactor binding pocket; inhibition site"
                     /db_xref="CDD:99735"
     misc_feature    complement(order(408602..408604,408677..408679,
                     408686..408688,408785..408787,408968..408973,
                     409049..409054))
                     /locus_tag="Selsp_0360"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99735"
     misc_feature    complement(408602..408604)
                     /locus_tag="Selsp_0360"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99735"
     gene            complement(409419..410393)
                     /locus_tag="Selsp_0361"
                     /db_xref="GeneID:10496570"
     CDS             complement(409419..410393)
                     /locus_tag="Selsp_0361"
                     /EC_number="4.2.1.24"
                     /note="COGs: COG0113 Delta-aminolevulinic acid
                     dehydratase;
                     InterPro IPR001731;
                     KEGG: vpr:Vpar_1423 delta-aminolevulinic acid dehydratase;
                     PFAM: Tetrapyrrole biosynthesis, porphobilinogen synthase;
                     PRIAM: Porphobilinogen synthase;
                     SPTR: Delta-aminolevulinic acid dehydratase;
                     IMG reference gene:2504585819;
                     PFAM: Delta-aminolevulinic acid dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="Porphobilinogen synthase"
                     /protein_id="YP_004412793.1"
                     /db_xref="GI:330838213"
                     /db_xref="InterPro:IPR001731"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:10496570"
                     /translation="MLKQTLRPRRLRRTANIRAMVRETELSVRDFVYPIFVVPGENIK
                     EEIPSMPGCFHLSVDRAVEQAKELAALGIPSVEVFGLPEYKDEIGSSAWDAKSPVQQA
                     IRAIKQAEPELAVVGDVCLCQYTSHGHCGKLCGHEVDNDATLPLLAKTAVSQAEAGAD
                     IVAPSDMMDGRIAALREALDEAGFSHVSIMSYTVKYASAYYGPFRDAADSAPSFGDRR
                     AYQMDPANAREAMKEVALDLAEGADIIMVKPALAYLDIVRRVRDAIDRPVAVYNVSGE
                     YAMVKAAAANGWIDEKRIVLETLTGMKRAGADIIITYHAIDAAKWLQS"
     misc_feature    complement(409428..410351)
                     /locus_tag="Selsp_0361"
                     /note="Porphobilinogen synthase (PBGS), which is also
                     called delta-aminolevulinic acid dehydratase (ALAD),
                     catalyzes the condensation of two 5-aminolevulinic acid
                     (ALA) molecules to form the pyrrole porphobilinogen (PBG),
                     which is the second step in the...; Region: ALAD_PBGS;
                     cd00384"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(409482..409484,409491..409493,
                     409503..409505,409557..409559,409629..409643,
                     409695..409700,409707..409709,409725..409727,
                     409734..409736,409794..409802,409887..409892,
                     409971..409976,410241..410243,410250..410252,
                     410322..410324))
                     /locus_tag="Selsp_0361"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(409455..409457,409572..409574,
                     409581..409583,409650..409652,409731..409733,
                     409743..409745,409764..409766,409779..409784,
                     409791..409793,409809..409811,409899..409901,
                     410004..410006,410028..410030,410034..410036,
                     410040..410042))
                     /locus_tag="Selsp_0361"
                     /note="active site"
                     /db_xref="CDD:238226"
     misc_feature    complement(order(409650..409652,409809..409811))
                     /locus_tag="Selsp_0361"
                     /note="Schiff base residues; other site"
                     /db_xref="CDD:238226"
     gene            complement(410387..411898)
                     /locus_tag="Selsp_0362"
                     /db_xref="GeneID:10496571"
     CDS             complement(410387..411898)
                     /locus_tag="Selsp_0362"
                     /EC_number="4.2.1.75"
                     /EC_number="2.1.1.107"
                     /note="COGs: COG0007 Uroporphyrinogen-III methylase;
                     InterPro IPR003754:IPR006366:IPR000878;
                     KEGG: pth:PTH_0973 uroporphyrinogen-III methylase and
                     uroporphyrinogen-III synthase;
                     PFAM: Tetrapyrrole biosynthesis, uroporphyrinogen III
                     synthase; Tetrapyrrole methylase;
                     PRIAM: Uroporphyrinogen-III C-methyltransferase.,
                     Uroporphyrinogen-III synthase;
                     SPTR: Uroporphyrinogen III synthase/methyltransferase;
                     TIGRFAM: Uroporphyrin-III C-methyltransferase, C-terminal;
                     IMG reference gene:2504585820;
                     PFAM: Tetrapyrrole (Corrin/Porphyrin) Methylases;
                     Uroporphyrinogen-III synthase HemD;
                     TIGRFAM: uroporphyrin-III C-methyltransferase"
                     /codon_start=1
                     /transl_table=11
                     /product="uroporphyrin-III C-methyltransferase"
                     /protein_id="YP_004412794.1"
                     /db_xref="GI:330838214"
                     /db_xref="InterPro:IPR000878"
                     /db_xref="InterPro:IPR003043"
                     /db_xref="InterPro:IPR003754"
                     /db_xref="InterPro:IPR006366"
                     /db_xref="InterPro:IPR014776"
                     /db_xref="InterPro:IPR014777"
                     /db_xref="GeneID:10496571"
                     /translation="MVYLVGAGPGDPGLLTVKAHACLKKADTVVYDYLADSRILALVP
                     EEAERIYVGKSAGNHAMKQEDISKLLVKLSREGKCVVRLKGGDPFVFGRGGEEALLLA
                     ENGLPFEIVPGVTSAIAVPAYAGIPVTHRGVAVSFAVVTGHEDPTKEASGLDWQKLAT
                     GVDTLVFLMGVGNLPAITAELMRHGRAGNTPAAVIRWGTRPEQETLITTVENAADDVA
                     RAGLKPPAIFLVGDVVRYREKLRWFDAPERRPLFGKRVLVTRARAQASKLTEGLEALG
                     AACLEVPAIRIAEPSDGGAALCAAIAHVADYDWLIFTSANGVEHFFRALDAAGKDARA
                     LARAKVAAIGPATANALAACGVRADCVPGEYRAEAVVEALKGDVRSGTRILLARAEEA
                     REVLPESLKALGAEVTVAAAYSTKQAEADGAALAKKLTSGEIDIVTFTSSSTAKNLCA
                     ILGGAEPLQHVKCVAIGPITAKTCEALGIKPAAVAKEYTIEGLIETIKEMLLC"
     misc_feature    complement(411194..411895)
                     /locus_tag="Selsp_0362"
                     /note="Uroporphyrin-III C-methyltransferase
                     (S-Adenosyl-L-methionine:uroporphyrinogen III
                     methyltransferase, SUMT); Region: SUMT; cd11642"
                     /db_xref="CDD:212501"
     misc_feature    complement(order(411218..411229,411299..411301,
                     411305..411310,411314..411316,411386..411400,
                     411470..411472,411476..411478,411539..411541,
                     411551..411556,411620..411631,411638..411646,
                     411797..411805,411872..411874))
                     /locus_tag="Selsp_0362"
                     /note="active site"
                     /db_xref="CDD:212501"
     misc_feature    complement(order(411218..411226,411305..411310,
                     411314..411316,411395..411397,411551..411556,
                     411626..411631,411638..411646,411872..411874))
                     /locus_tag="Selsp_0362"
                     /note="SAM binding site [chemical binding]; other site"
                     /db_xref="CDD:212501"
     misc_feature    complement(order(411482..411496,411506..411514,
                     411518..411520,411542..411547,411557..411559,
                     411563..411565,411569..411571,411590..411595,
                     411605..411607,411611..411616,411626..411634,
                     411638..411640,411839..411841,411845..411862))
                     /locus_tag="Selsp_0362"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:212501"
     misc_feature    complement(410408..411133)
                     /locus_tag="Selsp_0362"
                     /note="Uroporphyrinogen-III synthase (HemD) catalyzes the
                     asymmetrical cyclization of tetrapyrrole (linear) to
                     uroporphyrinogen-III, the fourth step in the biosynthesis
                     of heme. This ubiquitous enzyme is present in eukaryotes,
                     bacteria and archaea. Mutations in...; Region: HemD;
                     cd06578"
                     /db_xref="CDD:119440"
     misc_feature    complement(order(410567..410581,410654..410656,
                     410660..410662,410732..410734,410861..410863,
                     410951..410959,411119..411121))
                     /locus_tag="Selsp_0362"
                     /note="active site"
                     /db_xref="CDD:119440"
     gene            complement(411915..412850)
                     /locus_tag="Selsp_0363"
                     /db_xref="GeneID:10496572"
     CDS             complement(411915..412850)
                     /locus_tag="Selsp_0363"
                     /EC_number="2.5.1.61"
                     /note="COGs: COG0181 Porphobilinogen deaminase;
                     HAMAP: Tetrapyrrole biosynthesis, hydroxymethylbilane
                     synthase;
                     InterPro IPR000860:IPR022417:IPR022418;
                     KEGG: gsu:GSU3285 porphobilinogen deaminase;
                     PFAM: Porphobilinogen deaminase, N-terminal;
                     Porphobilinogen deaminase, C-terminal domain;
                     SPTR: Hydroxymethylbilane synthase;
                     TIGRFAM: Tetrapyrrole biosynthesis, hydroxymethylbilane
                     synthase;
                     IMG reference gene:2504585821;
                     PFAM: Porphobilinogen deaminase, C-terminal domain;
                     Porphobilinogen deaminase, dipyromethane cofactor binding
                     domain;
                     TIGRFAM: porphobilinogen deaminase"
                     /codon_start=1
                     /transl_table=11
                     /product="Porphobilinogen deaminase"
                     /protein_id="YP_004412795.1"
                     /db_xref="GI:330838215"
                     /db_xref="InterPro:IPR000860"
                     /db_xref="InterPro:IPR022417"
                     /db_xref="InterPro:IPR022418"
                     /db_xref="InterPro:IPR022419"
                     /db_xref="GeneID:10496572"
                     /translation="MKKDTIVIGTRSSKLALWQADYVEAKLRERYPELHVVQKRMTTK
                     GDRVLDAPLAKIGGKGLFTKELEQAMLAGEIDLAVHSLKDMPTELPEGLMLAAVTERF
                     DPGDAVVSPRYQTLANLPQGAKVGTSSLRRRAQLLAKRPDLEIVSLRGNVNTRLKKLE
                     EENFDAIILAVAGLKRLGFHDRITEILPREICLPAVGQGALAIEARADDEATLSLIAF
                     LDDAATRAAARAERAFLARVEGGCQVPVGVYAEAADEALEMEAVIASIDGERLYRKKK
                     AGSALDAEKIGRALAEELLAMGGKEILQELGLLQP"
     misc_feature    complement(411963..412838)
                     /locus_tag="Selsp_0363"
                     /note="porphobilinogen deaminase; Reviewed; Region: hemC;
                     PRK00072"
                     /db_xref="CDD:234612"
     misc_feature    complement(411963..412835)
                     /locus_tag="Selsp_0363"
                     /note="Hydroxymethylbilane synthase (HMBS), also known as
                     porphobilinogen deaminase (PBGD), is an intermediate
                     enzyme in the biosynthetic pathway of tetrapyrrolic ring
                     systems, such as heme, chlorophylls, and vitamin B12.
                     HMBS catalyzes the conversion of...; Region: HMBS;
                     cd00494"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(412032..412034,412038..412040,
                     412047..412049,412056..412058,412071..412073,
                     412107..412109,412113..412115,412125..412127,
                     412146..412148,412155..412160,412170..412172,
                     412179..412181,412200..412202,412254..412277,
                     412323..412328,412335..412337,412398..412400,
                     412437..412439,412449..412454,412458..412460,
                     412533..412550,412554..412559,412584..412586,
                     412590..412607,412797..412799,412812..412814))
                     /locus_tag="Selsp_0363"
                     /note="domain interfaces; other site"
                     /db_xref="CDD:238276"
     misc_feature    complement(order(412125..412127,412254..412259,
                     412266..412268,412323..412325,412332..412334,
                     412341..412349,412386..412388,412407..412409,
                     412455..412460,412464..412472,412599..412604,
                     412608..412610,412794..412796,412806..412808))
                     /locus_tag="Selsp_0363"
                     /note="active site"
                     /db_xref="CDD:238276"
     gene            complement(412810..414129)
                     /locus_tag="Selsp_0364"
                     /db_xref="GeneID:10496573"
     CDS             complement(412810..414129)
                     /locus_tag="Selsp_0364"
                     /note="COGs: COG0373 Glutamyl-tRNA reductase;
                     InterPro IPR015895:IPR015896:IPR000343:IPR006151;
                     KEGG: vpr:Vpar_1426 glutamyl-tRNA reductase;
                     PFAM: Tetrapyrrole biosynthesis, glutamyl-tRNA reductase,
                     N-terminal; Tetrapyrrole biosynthesis, glutamyl-tRNA
                     reductase, dimerisation domain; Quinate/shikimate
                     5-dehydrogenase/glutamyl-tRNA reductase;
                     SPTR: Glutamyl-tRNA reductase;
                     TIGRFAM: Tetrapyrrole biosynthesis, glutamyl-tRNA
                     reductase;
                     IMG reference gene:2504585822;
                     PFAM: Shikimate / quinate 5-dehydrogenase;
                     Glutamyl-tRNAGlu reductase, N-terminal domain;
                     Glutamyl-tRNAGlu reductase, dimerisation domain;
                     TIGRFAM: glutamyl-tRNA reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamyl-tRNA reductase"
                     /protein_id="YP_004412796.1"
                     /db_xref="GI:330838216"
                     /db_xref="InterPro:IPR000343"
                     /db_xref="InterPro:IPR006151"
                     /db_xref="InterPro:IPR015895"
                     /db_xref="InterPro:IPR015896"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR018214"
                     /db_xref="GeneID:10496573"
                     /translation="MHLIVLGLNHKTAPVDVRERFSIPKDAIRKGFQHLAEYADLLEA
                     VVLSTCNRSEIYAVTADDAHAGEAVRRFFFDLTGNDEDIEEYLYMHEDEECIRHLFRV
                     AASLDSLVLGEGQILSQVKQAYALALEGHATSTVLNTLFHRAIATGKRVRTETRIAWS
                     AVSVSYAAVELAKDIFGTLDKSSVLIFGAGKMAELTAEHLVSHGAKKLYIANRHMEKA
                     EDFAARFGGEAVPFERAMEKAEDVDVVVTSTGAPHYVVKAWETRHLMTQRKGRPLVFI
                     DIAVPRDVDPEVEEIKGVKLFNIDALEAVVDDHMEERKQEAVEASRIVEEEIVSIEKR
                     FQYLSCRPLMALLSERCERIRCREMQRAHTKLPELTEEQQRAVDHMTRMIVRKILRTP
                     MMKLNASAGTADEAFYIEAMRSLFKLDTIGETGTCEERHHRYRYAQQ"
     misc_feature    complement(412861..414129)
                     /locus_tag="Selsp_0364"
                     /note="glutamyl-tRNA reductase; Reviewed; Region: hemA;
                     PRK00045"
                     /db_xref="CDD:234592"
     misc_feature    complement(413179..414123)
                     /locus_tag="Selsp_0364"
                     /note="NADP-binding domain of glutamyl-tRNA reductase;
                     Region: NAD_bind_Glutamyl_tRNA_reduct; cd05213"
                     /db_xref="CDD:133452"
     misc_feature    complement(order(413743..413745,413755..413757,
                     413764..413766,413776..413778,413785..413787,
                     413983..413985,414073..414075))
                     /locus_tag="Selsp_0364"
                     /note="tRNA; other site"
                     /db_xref="CDD:133452"
     misc_feature    complement(order(413773..413775,413785..413787,
                     413791..413793,413806..413808,413974..413976,
                     413980..413985))
                     /locus_tag="Selsp_0364"
                     /note="putative tRNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:133452"
     misc_feature    complement(order(413551..413553,413560..413562,
                     413566..413568))
                     /locus_tag="Selsp_0364"
                     /note="putative NADP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:133452"
     misc_feature    complement(412873..413175)
                     /locus_tag="Selsp_0364"
                     /note="Glutamyl-tRNAGlu reductase, dimerization domain;
                     Region: GlutR_dimer; pfam00745"
                     /db_xref="CDD:250100"
     gene            complement(414098..414751)
                     /locus_tag="Selsp_0365"
                     /db_xref="GeneID:10496574"
     CDS             complement(414098..414751)
                     /locus_tag="Selsp_0365"
                     /note="COGs: COG1648 Siroheme synthase (precorrin-2
                     oxidase/ferrochelatase domain);
                     InterPro IPR006367:IPR019478;
                     KEGG: adg:Adeg_1261 siroheme synthase;
                     PFAM: Sirohaem synthase, dimerisation domain;
                     SPTR: Siroheme synthase;
                     TIGRFAM: Sirohaem synthase, N-terminal;
                     IMG reference gene:2504585823;
                     PFAM: Sirohaem synthase dimerisation region;
                     TIGRFAM: siroheme synthase, N-terminal domain"
                     /codon_start=1
                     /transl_table=11
                     /product="siroheme synthase"
                     /protein_id="YP_004412797.1"
                     /db_xref="GI:330838217"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="InterPro:IPR019478"
                     /db_xref="GeneID:10496574"
                     /translation="MDMYPIDLRLEGRAALVAGGGAVAHRKVAGLLAAGAAVTVVAPE
                     LVPPLAALAADGRITWLARLATAEVFASLPRALLVFCATDNRAANAAFGKAAKEAGAL
                     VNDATTPGLCDFFLPAALRDGDLLVTVSTGGASPALARTLKKRLAARLGASWGDWLER
                     LAGLREEAKERIEGSAGRETFWRAALSEHILNLVEEDRLDEAEAEIRHALDCFGTES"
     misc_feature    complement(414122..414751)
                     /locus_tag="Selsp_0365"
                     /note="Siroheme synthase (precorrin-2
                     oxidase/ferrochelatase domain) [Coenzyme metabolism];
                     Region: CysG; COG1648"
                     /db_xref="CDD:224562"
     misc_feature    complement(414398..414730)
                     /locus_tag="Selsp_0365"
                     /note="Putative NAD(P)-binding; Region: NAD_binding_7;
                     pfam13241"
                     /db_xref="CDD:257598"
     misc_feature    complement(414302..414385)
                     /locus_tag="Selsp_0365"
                     /note="Sirohaem biosynthesis protein central; Region:
                     Sirohm_synth_M; pfam14824"
                     /db_xref="CDD:258961"
     misc_feature    complement(414119..414298)
                     /locus_tag="Selsp_0365"
                     /note="Sirohaem synthase dimerization region; Region:
                     CysG_dimeriser; pfam10414"
                     /db_xref="CDD:204480"
     gene            complement(415379..416728)
                     /locus_tag="Selsp_0366"
                     /db_xref="GeneID:10496575"
     CDS             complement(415379..416728)
                     /locus_tag="Selsp_0366"
                     /EC_number="1.4.1.4"
                     /note="COGs: COG0334 Glutamate dehydrogenase/leucine
                     dehydrogenase;
                     InterPro IPR006096:IPR006097;
                     KEGG: cpf:CPF_1770 glutamate dehydrogenase;
                     PFAM: Glutamate/phenylalanine/leucine/valine
                     dehydrogenase, C-terminal;
                     Glutamate/phenylalanine/leucine/valine dehydrogenase,
                     dimerisation domain;
                     PRIAM: Glutamate dehydrogenase (NADP(+));
                     SMART: Glutamate/phenylalanine/leucine/valine
                     dehydrogenase, C-terminal;
                     SPTR: Glutamate dehydrogenase, NADP-specific;
                     IMG reference gene:2504585824;
                     PFAM: Glutamate/Leucine/Phenylalanine/Valine
                     dehydrogenase; Glu/Leu/Phe/Val dehydrogenase, dimerisation
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Glutamate dehydrogenase (NADP(+))"
                     /protein_id="YP_004412798.1"
                     /db_xref="GI:330838218"
                     /db_xref="InterPro:IPR006095"
                     /db_xref="InterPro:IPR006096"
                     /db_xref="InterPro:IPR006097"
                     /db_xref="InterPro:IPR014362"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496575"
                     /translation="MTEMQQYVEDILASIEKKDPQEKEYHNVVKEVLTSIVPVLEQHP
                     EYKKHKILERMVEPERVVMFRVPWENDKGEVQVNRGYRVQANSAVGTYKGGLRFHPSV
                     TLSILKFLAFEQTFKNSLTGLPIGGAKGGSDFDPKGKSDNEVMRFCQSFMTELYRHIG
                     SMVDTPAGDIGVGGREIGYLYGQYKRIVNSFDSAVLTGKGLGYGGSLARTEATGYGLL
                     YFMKEMLEDNGKSLEGKTVVVSGSGNVATYAIEKAIEFGAKPVTCSDSNGYVYDPEGI
                     DLALVKEIKEVRRGRIKEYVEKRPNAEYHEGCRGVWTVKCDIALPCATQSELDIEGVK
                     ALVANGVMAVGEGANMPTTLDATEYLLEKGVLFAPAKAANAGGVAVSALEMSQNSERL
                     HWTFEEVDNRLKGIMKNIYQNSKKNAEKYGMKGNLIAGANITAFLHVADTMVAQGIV"
     misc_feature    complement(415382..416725)
                     /locus_tag="Selsp_0366"
                     /note="glutamate dehydrogenase; Provisional; Region:
                     PRK09414"
                     /db_xref="CDD:181834"
     misc_feature    complement(416165..416557)
                     /locus_tag="Selsp_0366"
                     /note="Glu/Leu/Phe/Val dehydrogenase, dimerization domain;
                     Region: ELFV_dehydrog_N; pfam02812"
                     /db_xref="CDD:251546"
     misc_feature    complement(415385..416140)
                     /locus_tag="Selsp_0366"
                     /note="NAD(P) binding domain of glutamate dehydrogenase,
                     subgroup 2; Region: NAD_bind_2_Glu_DH; cd05313"
                     /db_xref="CDD:133455"
     misc_feature    complement(order(415682..415690,415757..415762,
                     415931..415936,415994..416002))
                     /locus_tag="Selsp_0366"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133455"
     gene            417002..417205
                     /locus_tag="Selsp_0367"
                     /db_xref="GeneID:10496576"
     CDS             417002..417205
                     /locus_tag="Selsp_0367"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585825"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412799.1"
                     /db_xref="GI:330838219"
                     /db_xref="GeneID:10496576"
                     /translation="MNVLGKGAPLLLHKGMTGKKGLAKRSFFATMKENCMAADARVLE
                     ESRQKERVFGASFWSFLAKHSWG"
     gene            417210..418049
                     /locus_tag="Selsp_0368"
                     /db_xref="GeneID:10496577"
     CDS             417210..418049
                     /locus_tag="Selsp_0368"
                     /EC_number="5.1.1.7"
                     /note="COGs: COG0253 Diaminopimelate epimerase;
                     InterPro IPR001653;
                     KEGG: mta:Moth_0888 diaminopimelate epimerase;
                     PFAM: Diaminopimelate epimerase;
                     PRIAM: Diaminopimelate epimerase;
                     SPTR: Diaminopimelate epimerase;
                     TIGRFAM: Diaminopimelate epimerase;
                     IMG reference gene:2504585826;
                     PFAM: Diaminopimelate epimerase;
                     TIGRFAM: diaminopimelate epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="diaminopimelate epimerase"
                     /protein_id="YP_004412800.1"
                     /db_xref="GI:330838220"
                     /db_xref="InterPro:IPR001653"
                     /db_xref="InterPro:IPR018510"
                     /db_xref="GeneID:10496577"
                     /translation="MAFSFTKWQGCGNDFVLVNGFREQLPDDLAALSRRVCDRHYGIG
                     ADGLILVLPSQQADFRMRIFNADGTEAEMCGNGIRCFAGVVHAEGLSGEAEFTVETGA
                     GILVPRLQLAGSRLTGVRVDMGEPILEGERIPVLGFGASRVIEQPIEAEGETFSMTCV
                     SMGNPHCVIFVEDAQDVPMEKFGPLLERHEKFPKKTNVEFAEIKDASHIRMRVWERGA
                     AVTLACGTGSCATLVAAALTGRTKREAEVQLDGGRLQIEWAENHHVYMTGPAEKVFAG
                     RYE"
     misc_feature    417210..418046
                     /locus_tag="Selsp_0368"
                     /note="diaminopimelate epimerase; Provisional; Region:
                     dapF; PRK00450"
                     /db_xref="CDD:234768"
     misc_feature    417222..417593
                     /locus_tag="Selsp_0368"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     misc_feature    417681..418028
                     /locus_tag="Selsp_0368"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     pfam01678"
                     /db_xref="CDD:250792"
     gene            complement(418109..419014)
                     /locus_tag="Selsp_0369"
                     /db_xref="GeneID:10496578"
     CDS             complement(418109..419014)
                     /locus_tag="Selsp_0369"
                     /note="KEGG: tde:TDE0948 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585827;
                     PFAM: Putative transposase, YhgA-like"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412801.1"
                     /db_xref="GI:330838221"
                     /db_xref="InterPro:IPR006842"
                     /db_xref="GeneID:10496578"
                     /translation="MRNTKRTYKDSLFRDIFNNAERLPEIYEALLDHKTTPDDITLAT
                     IDETLFTGVKNDIGFIVGNQHVLLVEHQSTINANMPLRLLMYLVEIYRRYVDKDAIYK
                     KELIPLPAPKFYVFYNGLAEMPDIWALHLSDAFGGHDSDLELEVKVFNINDKPNRPIL
                     EKCHALKSYSVFVAKVRECIKNGSSLEIAVGNAVQYCVAHDYLGEYFRQKQAKEVFDM
                     LNFVWNQERALEVRAEEAMEKGLRLGRQEGLSQGLSQGVLETTTASIRNVMKSMDFPI
                     EKAMDILQIPEEERAKYTALVLGKH"
     misc_feature    complement(<418610..418987)
                     /locus_tag="Selsp_0369"
                     /note="Putative transposase, YhgA-like; Region:
                     Transposase_31; pfam04754"
                     /db_xref="CDD:252779"
     misc_feature    complement(418136..>418819)
                     /locus_tag="Selsp_0369"
                     /note="conserved hypothetical protein (putative
                     transposase or invertase); Region: T_den_put_tspse;
                     TIGR01784"
                     /db_xref="CDD:130844"
     gene            complement(419081..420451)
                     /locus_tag="Selsp_0370"
                     /db_xref="GeneID:10496579"
     CDS             complement(419081..420451)
                     /locus_tag="Selsp_0370"
                     /note="COGs: COG2252 Permease;
                     InterPro IPR006043;
                     KEGG: afn:Acfer_0613 xanthine/uracil/vitamin C permease;
                     PFAM: Xanthine/uracil/vitamin C permease;
                     SPTR: Purine transporter, AzgA family;
                     IMG reference gene:2504585828;
                     PFAM: Permease family"
                     /codon_start=1
                     /transl_table=11
                     /product="Xanthine/uracil/vitamin C permease"
                     /protein_id="YP_004412802.1"
                     /db_xref="GI:330838222"
                     /db_xref="InterPro:IPR006043"
                     /db_xref="GeneID:10496579"
                     /translation="MEKMLENVFHLKENRTTVQTELLAGLTTFMTMAYILAVNPLILS
                     AAGMDAGAVFTATALASGISCVLMASFANLPFALSSAMGLNAFFAYTVVGQMGYSWQL
                     ALTAVLVEGLIFIALSVTNVREALFNAIPLTLKSAVTVGIGFFITFIGLQNAHVVVAG
                     PKLVALFSFPKAMAEGTFHSEGITVLLALFGILLTAVLVIKNLKGHILIGIFATWGLG
                     IVLELLGVYIPDPARGYFSLMPTGIVAPPVSLAPTFLQFDFHAILSLDFIVVIFAFLF
                     VDLFDTLGTLIGCASRADMLDEKGRLPRVKGALLADACGTSLGACLGTSTISTYVESS
                     AGIVEGGRTGLTAVTTAIFFLVALFFSPLFLAVPGFATAPALVIVGFLMMQQVAKIPW
                     SDITEAIPSFICIAVMPFAYSIAEGIAFGIISYTLLHVASGKFRNVTWLMYVLTVLFI
                     LKYAWL"
     misc_feature    complement(419084..420451)
                     /locus_tag="Selsp_0370"
                     /note="Xanthine/uracil/vitamin C permease [Nucleotide
                     transport and    metabolism]; Region: COG2252"
                     /db_xref="CDD:225161"
     gene            420654..421028
                     /locus_tag="Selsp_0371"
                     /db_xref="GeneID:10496580"
     CDS             420654..421028
                     /locus_tag="Selsp_0371"
                     /note="COGs: COG3189 conserved hypothetical protein;
                     InterPro IPR007438;
                     KEGG: tva:TVAG_003130 hypothetical protein;
                     PFAM: Protein of unknown function DUF488;
                     SPTR: Transcriptional regulator, MarR family;
                     IMG reference gene:2504585829;
                     PFAM: Protein of unknown function, DUF488"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412803.1"
                     /db_xref="GI:330838223"
                     /db_xref="InterPro:IPR007438"
                     /db_xref="GeneID:10496580"
                     /translation="MAYELQMKRIYEEPAPTDGRRILVDRLWPRGMKKERAALSEWAK
                     EVTPSPELRKLYHSGEMNFDLFGKAYLEELKKSPEAAAFAAKCRDWLQESPVTLVYAN
                     KNAVENHVLVLRQWLLDAMGQG"
     misc_feature    420663..421004
                     /locus_tag="Selsp_0371"
                     /note="Protein of unknown function, DUF488; Region:
                     DUF488; cl01246"
                     /db_xref="CDD:260852"
     gene            complement(421207..422250)
                     /locus_tag="Selsp_0372"
                     /db_xref="GeneID:10496581"
     CDS             complement(421207..422250)
                     /locus_tag="Selsp_0372"
                     /note="COGs: COG2008 Threonine aldolase;
                     InterPro IPR001597;
                     KEGG: bad:BAD_0527 low specificity-threonine aldolase;
                     PFAM: Aromatic amino acid beta-eliminating lyase/threonine
                     aldolase;
                     SPTR: Low specificity L-threonine aldolase;
                     IMG reference gene:2504585830;
                     PFAM: Beta-eliminating lyase"
                     /codon_start=1
                     /transl_table=11
                     /product="aromatic amino acid beta-eliminating
                     lyase/threonine aldolase"
                     /protein_id="YP_004412804.1"
                     /db_xref="GI:330838224"
                     /db_xref="InterPro:IPR001597"
                     /db_xref="InterPro:IPR015421"
                     /db_xref="InterPro:IPR015422"
                     /db_xref="InterPro:IPR015424"
                     /db_xref="GeneID:10496581"
                     /translation="MSSTKQKLSFASDYMEGAHPEILRRLLETNMEQTAGYGLDAYSE
                     SARKKIRAACQADDAEIFFLIGGTQANAVVIDALLRSYQGVIAAETGHISVHEAGAIE
                     FGGHKVLTLAHQAGKITAAQIESALTAYREDANREHMVMPGMVYLSQPTEYGALYSLA
                     ELEAISAVCRAGGIPLYLDGARLAYALACPANDVTLADIARLADVFYIGGTKCGALFG
                     EAVVFPKRNTVPHFFSIVKQHGALLAKSRIAGLQFDTLFTSHLYEKGGETALLAADRI
                     RSALREKDYSLAYDAPTNQIFLVLDEAQKARLSKQVEMGFWENLADGKTVMRIATSWA
                     TQDEDVDRLIALL"
     misc_feature    complement(421210..422229)
                     /locus_tag="Selsp_0372"
                     /note="Aspartate aminotransferase (AAT) superfamily (fold
                     type I) of pyridoxal phosphate (PLP)-dependent enzymes.
                     PLP combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine intermediate, which
                     depending on the reaction, is the...; Region: AAT_I;
                     cl18945"
                     /db_xref="CDD:267298"
     misc_feature    complement(421342..422223)
                     /locus_tag="Selsp_0372"
                     /note="Beta-eliminating lyase; Region: Beta_elim_lyase;
                     pfam01212"
                     /db_xref="CDD:250447"
     misc_feature    complement(order(421615..421617,421624..421626,
                     421705..421707,421714..421716,421807..421809,
                     422038..422040,422047..422052))
                     /locus_tag="Selsp_0372"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(421615..421617)
                     /locus_tag="Selsp_0372"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            complement(422292..422804)
                     /locus_tag="Selsp_0373"
                     /db_xref="GeneID:10496582"
     CDS             complement(422292..422804)
                     /locus_tag="Selsp_0373"
                     /note="InterPro IPR011576;
                     KEGG: bpb:bpr_I2719 pyridoxamine 5'-phosphate oxidase
                     family protein;
                     PFAM: Pyridoxamine 5'-phosphate oxidase-like, FMN-binding
                     domain;
                     SPTR: Pyridoxamine 5'-phosphate oxidase family protein;
                     IMG reference gene:2504585831;
                     PFAM: Pyridoxamine 5'-phosphate oxidase"
                     /codon_start=1
                     /transl_table=11
                     /product="pyridoxamine 5'-phosphate oxidase-related
                     FMN-binding protein"
                     /protein_id="YP_004412805.1"
                     /db_xref="GI:330838225"
                     /db_xref="InterPro:IPR009002"
                     /db_xref="InterPro:IPR011576"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="GeneID:10496582"
                     /translation="MNYEAAAEFWVEKDKDAVKMPPDELRKELDTFLKDEKVCTLAVA
                     DGDFVRCTPLTYTYREGRFYIFSEGGLKFRALAKNKNVALEVHAEYHGPGSAKSVQVT
                     GEALVIGADDESFVARADAAGMNGASLKKMGLILIVVTARKLEYLNSELRKRGYCPRQ
                     CLDLSDASLA"
     misc_feature    complement(422466..422729)
                     /locus_tag="Selsp_0373"
                     /note="Pyridoxamine 5'-phosphate oxidase; Region:
                     Pyridox_ox_2; pfam12900"
                     /db_xref="CDD:257388"
     gene            423296..423371
                     /locus_tag="Selsp_R0010"
                     /db_xref="GeneID:10496583"
     tRNA            423296..423371
                     /locus_tag="Selsp_R0010"
                     /product="tRNA-Thr"
                     /note="IMG reference gene:2504585832"
                     /db_xref="GeneID:10496583"
     gene            423497..424441
                     /locus_tag="Selsp_0374"
                     /db_xref="GeneID:10496584"
     CDS             423497..424441
                     /locus_tag="Selsp_0374"
                     /note="COGs: COG2070 Dioxygenase related to 2-nitropropane
                     dioxygenase;
                     InterPro IPR004136;
                     KEGG: hmo:HM1_0231 2-nitropropane dioxygenase;
                     PFAM: 2-nitropropane dioxygenase, NPD;
                     SPTR: Enoyl-(Acyl-carrier-protein) reductase II;
                     IMG reference gene:2504585833;
                     PFAM: 2-nitropropane dioxygenase;
                     TIGRFAM: putative enoyl-(acyl-carrier-protein) reductase
                     II"
                     /codon_start=1
                     /transl_table=11
                     /product="2-nitropropane dioxygenase NPD"
                     /protein_id="YP_004412806.1"
                     /db_xref="GI:330838226"
                     /db_xref="InterPro:IPR004136"
                     /db_xref="InterPro:IPR013785"
                     /db_xref="GeneID:10496584"
                     /translation="MAKSITEVLGIKYPIIQGAMAWIADAELVAAVSNAGGAGVIAAG
                     GRSTEWVEQEIKKTRELTDKPFGVNVMLMAPNKDEIVEVICREKPAFVTLGAGNPVPF
                     LEKFKSAGVKTVPVVPNVKLAKRIEAAGADAIVVEGMEAGGHIGVLTTMALMTQVIPE
                     VGIPVVMAGGIADGRGLAAALLMGAAGVQMGTRFLVAEECNVHPKMKEKLLEAVDTDT
                     IVTGLSIGGAVRGIKNKFSQDFVALEFSGKATKEELIERATGTNKLAAVDGDVENGMM
                     QAGQSLLPLKKIEPVKAIIEGIVKEARETLANAGKIEI"
     misc_feature    423509..424417
                     /locus_tag="Selsp_0374"
                     /note="putative enoyl-[acyl-carrier-protein] reductase II;
                     Region: enACPred_II; TIGR03151"
                     /db_xref="CDD:132195"
     misc_feature    423527..424192
                     /locus_tag="Selsp_0374"
                     /note="2-Nitropropane dioxygenase (NPD), one of the
                     nitroalkane oxidizing enzyme families, catalyzes oxidative
                     denitrification of nitroalkanes to their corresponding
                     carbonyl compounds and nitrites. NDP is a member of the
                     NAD(P)H-dependent flavin oxidoreductase...; Region:
                     NPD_like; cd04730"
                     /db_xref="CDD:240081"
     misc_feature    order(423551..423556,423707..423709,423779..423781,
                     423842..423844,423905..423907,423917..423922,
                     423998..424006,424061..424072)
                     /locus_tag="Selsp_0374"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:240081"
     misc_feature    423923..423928
                     /locus_tag="Selsp_0374"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:240081"
     misc_feature    423926..423928
                     /locus_tag="Selsp_0374"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:240081"
     gene            complement(424767..425111)
                     /locus_tag="Selsp_0375"
                     /db_xref="GeneID:10496585"
     CDS             complement(424767..425111)
                     /locus_tag="Selsp_0375"
                     /note="COGs: COG4679 Phage-related protein;
                     InterPro IPR009241;
                     KEGG: bpb:bpr_I0707 hypothetical protein;
                     PFAM: Protein of unknown function DUF891;
                     SPTR: Toxin-antitoxin system, toxin component, RelE
                     family;
                     manually curated;
                     IMG reference gene:2504585834;
                     PFAM: Phage derived protein Gp49-like (DUF891)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412807.1"
                     /db_xref="GI:330838227"
                     /db_xref="InterPro:IPR009241"
                     /db_xref="GeneID:10496585"
                     /translation="MHVIFYETENGTAPAKDFIFSLDPKLKAKVLYVIDKLESRGSNL
                     RLPDSKELSDGIFELRAISGNNIARVLYFFIVGNTAVLTNGFIKKTRKTPPNQILLAK
                     KYRDDYKRRNPV"
     misc_feature    complement(424803..425063)
                     /locus_tag="Selsp_0375"
                     /note="Phage derived protein Gp49-like (DUF891); Region:
                     Gp49; pfam05973"
                     /db_xref="CDD:253485"
     gene            425353..425937
                     /locus_tag="Selsp_0376"
                     /db_xref="GeneID:10496586"
     CDS             425353..425937
                     /locus_tag="Selsp_0376"
                     /note="COGs: COG4463 Transcriptional repressor of class
                     III stress genes;
                     InterPro IPR008463;
                     KEGG: ppm:PPSC2_c4814 transcriptional repressor;
                     PFAM: Firmicute transcriptional repressor of class III
                     stress genes;
                     SPTR: Transcriptional regulator CtsR;
                     IMG reference gene:2504585835;
                     PFAM: Firmicute transcriptional repressor of class III
                     stress genes (CtsR)"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional repressor, CtsR"
                     /protein_id="YP_004412808.1"
                     /db_xref="GI:330838228"
                     /db_xref="InterPro:IPR008463"
                     /db_xref="GeneID:10496586"
                     /translation="MCEDGGLNLSVLPQIPSVAVHIWQFFSAVRAGRQFFLSVLRQGD
                     TMSSNIADLIEEYILRQLAAQQDGKVELRRTEIADKISCAPSQISYVLNTRFTQEKGF
                     TVESRRGLGGFIRIVQVPLQNLVYQDMLEKLTEESEPELVQSMVRYLAQHGMISTREA
                     ALVMQSVTTAYEKLEPKDRLKFIRSLLLTLEKFS"
     misc_feature    425497..425922
                     /locus_tag="Selsp_0376"
                     /note="Firmicute transcriptional repressor of class III
                     stress genes (CtsR); Region: CtsR; cl01850"
                     /db_xref="CDD:261095"
     gene            425950..426582
                     /locus_tag="Selsp_0377"
                     /db_xref="GeneID:10496587"
     CDS             425950..426582
                     /locus_tag="Selsp_0377"
                     /note="COGs: COG3880 Uncharacterized protein with
                     conserved CXXC pairs;
                     InterPro IPR001943;
                     KEGG: tmt:Tmath_1959 UvrB/UvrC protein;
                     PFAM: UvrB/UvrC protein;
                     SPTR: Modulator of CtsR repression McsA;
                     IMG reference gene:2504585836;
                     PFAM: UvrB/uvrC motif"
                     /codon_start=1
                     /transl_table=11
                     /product="UvrB/UvrC protein"
                     /protein_id="YP_004412809.1"
                     /db_xref="GI:330838229"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="GeneID:10496587"
                     /translation="MLCDDCKKNEARVHFVVLKNDGTTEMHLCRDCAARYSKTMAGMS
                     GEDYSINDFIRGVIQRMPDPSANAEEQESEQEEKPTEEEASFTCPNCGMSYRDFAQQG
                     KIGCSVCYDTFREELTPLLLRIHGAGNHRGKIPKRAGGTLALKQRIDLLRARQERAVA
                     KEEYERAAEYRDEIRALAVQLAAQEREKAQEYASAPSSAEDRKEDEGGEA"
     misc_feature    425950..426480
                     /locus_tag="Selsp_0377"
                     /note="Modulator of heat shock repressor CtsR, McsA
                     [Signal transduction    mechanisms]; Region: COG3880"
                     /db_xref="CDD:226397"
     misc_feature    426382..426480
                     /locus_tag="Selsp_0377"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     gene            426582..427649
                     /locus_tag="Selsp_0378"
                     /db_xref="GeneID:10496588"
     CDS             426582..427649
                     /locus_tag="Selsp_0378"
                     /note="COGs: COG3869 Arginine kinase;
                     InterPro IPR022414;
                     KEGG: gym:GYMC10_5781 ATP:guanido phosphotransferase;
                     PFAM: ATP:guanido phosphotransferase, catalytic domain;
                     SPTR: ATP:guanido phosphotransferase domain protein;
                     IMG reference gene:2504585837;
                     PFAM: ATP:guanido phosphotransferase, C-terminal catalytic
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP:guanido phosphotransferase, catalytic domain
                     protein"
                     /protein_id="YP_004412810.1"
                     /db_xref="GI:330838230"
                     /db_xref="InterPro:IPR000749"
                     /db_xref="InterPro:IPR014746"
                     /db_xref="InterPro:IPR022414"
                     /db_xref="GeneID:10496588"
                     /translation="MAKQELFTGSHLAWLAADGTDSDVVLASRVCLSRNLHEVPFPNR
                     ADLVRLAETEERIAAVLGDVEEALEEPFDRIELAKSTALEQNVLWEKHLVSRQLLKNP
                     AHRSAYISNDRSMSILVNGENHLRIQAMAAGFDLKSPYDRASRVDDVFEAKLDFAFDE
                     KLGYLTSCPTDLGTGLRASVMLHLPGLVYTENIGNILNISPQIGLSMSAMYGEGAESA
                     GNLFAVANKLSLGLTERELCDNLRISVGEIVEQERRARKALLLYEKDRIEDEVWRAYG
                     VLHYARALGDAETLAILSRVRLGVDLGFIEGLASSVFGDILIASRANYLCALAGNENM
                     SKNEIDRKRAEVVRRILETAA"
     misc_feature    426591..427631
                     /locus_tag="Selsp_0378"
                     /note="ATP:guanido phosphotransferase; Provisional;
                     Region: PRK01059"
                     /db_xref="CDD:234894"
     misc_feature    426645..427346
                     /locus_tag="Selsp_0378"
                     /note="Phosphagen (guanidino) kinases found in bacteria;
                     Region: bacterial_phosphagen_kinase; cd07930"
                     /db_xref="CDD:153077"
     misc_feature    order(426660..426662,426666..426668,426672..426674,
                     426855..426857,426933..426935,426957..426959,
                     427110..427112,427116..427124,427203..427205,
                     427209..427211,427215..427220,427248..427250)
                     /locus_tag="Selsp_0378"
                     /note="ADP binding site [chemical binding]; other site"
                     /db_xref="CDD:153077"
     misc_feature    order(426945..426947,427083..427085,427221..427226)
                     /locus_tag="Selsp_0378"
                     /note="phosphagen binding site; other site"
                     /db_xref="CDD:153077"
     misc_feature    order(427194..427238,427242..427259)
                     /locus_tag="Selsp_0378"
                     /note="substrate specificity loop; other site"
                     /db_xref="CDD:153077"
     gene            427764..430280
                     /locus_tag="Selsp_0379"
                     /db_xref="GeneID:10496589"
     CDS             427764..430280
                     /locus_tag="Selsp_0379"
                     /note="COGs: COG0542 ATPase with chaperone activity
                     ATP-binding subunit;
                     InterProIPR003959:IPR001943:IPR013093:IPR003593:IPR
                     004176:IPR019489;
                     KEGG: adg:Adeg_1948 ATPase AAA-2 domain protein;
                     PFAM: ATPase, AAA-2; ATPase, AAA-type, core; UvrB/UvrC
                     protein; Clp, N-terminal; Clp ATPase, C-terminal;
                     SMART: ATPase, AAA+ type, core;
                     SPTR: Negative regulator of genetic competence ClpC/MecB;
                     IMG reference gene:2504585838;
                     PFAM: AAA domain (Cdc48 subfamily); Clp amino terminal
                     domain; C-terminal, D2-small domain, of ClpB protein;
                     ATPase family associated with various cellular activities
                     (AAA); UvrB/uvrC motif"
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA-2 domain protein"
                     /protein_id="YP_004412811.1"
                     /db_xref="GI:330838231"
                     /db_xref="InterPro:IPR001270"
                     /db_xref="InterPro:IPR001943"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR003959"
                     /db_xref="InterPro:IPR004176"
                     /db_xref="InterPro:IPR013093"
                     /db_xref="InterPro:IPR018368"
                     /db_xref="InterPro:IPR019489"
                     /db_xref="InterPro:IPR023150"
                     /db_xref="GeneID:10496589"
                     /translation="MTNRFTGRALKVLEFAQYEAQELEQNFIGTEHILLGLLHEGEGI
                     AARALRSLGLDFGHVRTRVEDMLGGREMEERRASYYTDRAKRVMELAVEEARSFGHNY
                     IGTEHILLGLIRENEGVAAHVLISLGADLDIVRATVIDMLGGTHESAELPAPDRRRRA
                     APAQGEAAAGTPLLDKYGRDINRMAREGKLDPVIGREKEIERIVQILSRRTKNNPILI
                     GEPGVGKTAVAEGLAARIATGAVPRLLQQKRIVSLPMAGLVAGAKYRGEFEERLKGII
                     DEVMKSGNVILFIDEMHTLIGAGAAEGSLDAANILKPPLSRGEVQIIGATTLKEYKKY
                     FEKDSALERRFQSILVEEPTTEEAEKILHGLRPKYEAFHHAKIRDEALKAAVRLSHRY
                     IPDRCLPDKAIDLMDEAASKSRMKTVVLPTSIKRLEERLKKLGIEKDTAIKLQDYERA
                     AALRDEESALKEDLVAAKERWQEREMKEVTVTADDIADAVGLWTGIPVKDIAAKESER
                     LLHLEQILTAHVVGQEEAVTAVAKAVRRARAGLKDPKRPIGSFLFLGSTGVGKTELAR
                     ALAESLFGTEEAIVRFDMSEYMEKHTVSKLVGAPPGYVGYEEGGQLTEAVRRHPYSII
                     LLDEVEKAHPDLFNVLLQVLDDGRLTDAQGRTVDCKNTVIIMTSNAGADYLKQSTSLG
                     FTAGVQTLGDAYEKGKSRVFEEVKRVFRPEFLNRVDEMLVFRPLGKEELTKIVDIMLR
                     EVEARLSEKGMALEVSPAAKSKLVESGTDFKYGARPLKRAIRKLVEDEIAERLLKGDF
                     GRGDTIYVKKVGDRLDFVRKQPKDAAKAKKEKALRAGAAQ"
     misc_feature    427773..430217
                     /locus_tag="Selsp_0379"
                     /note="ATP-binding subunits of Clp protease and DnaK/DnaJ
                     chaperones [Posttranslational modification, protein
                     turnover, chaperones]; Region: clpA; COG0542"
                     /db_xref="CDD:223616"
     misc_feature    427809..427967
                     /locus_tag="Selsp_0379"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    428034..428192
                     /locus_tag="Selsp_0379"
                     /note="Clp amino terminal domain; Region: Clp_N;
                     pfam02861"
                     /db_xref="CDD:251573"
     misc_feature    428343..428822
                     /locus_tag="Selsp_0379"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    428418..428441
                     /locus_tag="Selsp_0379"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(428421..428444,428631..428633,428742..428744)
                     /locus_tag="Selsp_0379"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    428619..428636
                     /locus_tag="Selsp_0379"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    428793..428795
                     /locus_tag="Selsp_0379"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    429045..429152
                     /locus_tag="Selsp_0379"
                     /note="UvrB/uvrC motif; Region: UVR; pfam02151"
                     /db_xref="CDD:251123"
     misc_feature    429324..429770
                     /locus_tag="Selsp_0379"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    429426..429449
                     /locus_tag="Selsp_0379"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    order(429429..429452,429642..429644,429768..429770)
                     /locus_tag="Selsp_0379"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    429630..429647
                     /locus_tag="Selsp_0379"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    429939..430181
                     /locus_tag="Selsp_0379"
                     /note="C-terminal, D2-small domain, of ClpB protein;
                     Region: ClpB_D2-small; pfam10431"
                     /db_xref="CDD:255983"
     gene            430261..430410
                     /locus_tag="Selsp_0380"
                     /db_xref="GeneID:10496590"
     CDS             430261..430410
                     /locus_tag="Selsp_0380"
                     /note="IMG reference gene:2504585839"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412812.1"
                     /db_xref="GI:330838232"
                     /db_xref="GeneID:10496590"
                     /translation="MRAQRNKLAPGGAASAWNMLVNAAWAPLWLVRSLLRFLRRSLMK
                     RGKAE"
     gene            430413..431786
                     /locus_tag="Selsp_0381"
                     /db_xref="GeneID:10496591"
     CDS             430413..431786
                     /locus_tag="Selsp_0381"
                     /note="COGs: COG1066 ATP-dependent serine protease;
                     InterPro IPR003593:IPR004504;
                     KEGG: sth:STH3128 DNA repair protein RadA;
                     SMART: ATPase, AAA+ type, core;
                     SPTR: DNA repair protein radA;
                     TIGRFAM: DNA repair protein RadA;
                     IMG reference gene:2504585840;
                     PFAM: KaiC; Lon protease (S16) C-terminal proteolytic
                     domain;
                     TIGRFAM: DNA repair protein RadA"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA repair protein RadA"
                     /protein_id="YP_004412813.1"
                     /db_xref="GI:330838233"
                     /db_xref="InterPro:IPR004504"
                     /db_xref="InterPro:IPR008269"
                     /db_xref="InterPro:IPR014774"
                     /db_xref="InterPro:IPR020568"
                     /db_xref="InterPro:IPR020588"
                     /db_xref="GeneID:10496591"
                     /translation="MAKKKKTAFVCQACGYDTSKWVGKCPGCGAWNTLVEETIAPESA
                     EGGLRLGLSDGARPVAVGDVAVEDMPRFLTGSGELDRVLGGGVIPGSMVLIVGDPGVG
                     KSSLTLRVAAEIARGGKRVLYVTGEESTRQVRMRADRLGAIADDLFVVSETNLERITV
                     HIETVKPELLVIDSIQTIFRPDVTSAPGSVSQVRECSVELLRLAKTHGIAAFVVGHVT
                     KDGTLAGPRVLEHIVDTVLYFEGERNAQFRILRAVKNRFGSTNELGLFEMRDTGLADV
                     PDASKLFLSDREPDSGTVVVPTVEGTRPLLVEIQSLVAETPYMPPRRTADSVDVKRIQ
                     LLLAVLEKRVKLPIGACDVYVKVAGGIKIDEPAADLGLCVAMASSFANRLVRPKAIVF
                     GEVGLSGEIRAVSQADVRLKEAAKLGFRAAVLPQKNAERLKSIKGIDLFGAATLAEAL
                     RLAMPRE"
     misc_feature    430413..431780
                     /locus_tag="Selsp_0381"
                     /note="DNA repair protein RadA; Provisional; Region:
                     PRK11823"
                     /db_xref="CDD:236994"
     misc_feature    430437..431549
                     /locus_tag="Selsp_0381"
                     /note="Sms (bacterial radA) DNA repair protein. This
                     protein is not related to archael radA any more than is to
                     other RecA-like NTPases. Sms has a role in recombination
                     and recombinational repair and is responsible for the
                     stabilization or processing of...; Region: Sms; cd01121"
                     /db_xref="CDD:238541"
     misc_feature    430701..430724
                     /locus_tag="Selsp_0381"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238541"
     misc_feature    order(430704..430706,430716..430724,430779..430781,
                     430785..430787,430929..430934)
                     /locus_tag="Selsp_0381"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238541"
     misc_feature    430920..430931
                     /locus_tag="Selsp_0381"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238541"
     misc_feature    <431487..431696
                     /locus_tag="Selsp_0381"
                     /note="Subunit ChlI of Mg-chelatase; Region: ChlI;
                     pfam13541"
                     /db_xref="CDD:257860"
     gene            complement(431853..433217)
                     /locus_tag="Selsp_0382"
                     /db_xref="GeneID:10496592"
     CDS             complement(431853..433217)
                     /locus_tag="Selsp_0382"
                     /note="COGs: COG1115 Na+/alanine symporter;
                     InterPro IPR001463;
                     KEGG: hmo:HM1_1545 sodium:alanine symporter;
                     PFAM: Sodium:alanine symporter;
                     SPTR: Amino acid carrier protein;
                     TIGRFAM: Sodium:alanine symporter;
                     IMG reference gene:2504585841;
                     PFAM: Sodium:alanine symporter family;
                     TIGRFAM: amino acid carrier protein"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid carrier protein"
                     /protein_id="YP_004412814.1"
                     /db_xref="GI:330838234"
                     /db_xref="InterPro:IPR001463"
                     /db_xref="GeneID:10496592"
                     /translation="MENLIPLLNSIDSVLWGPPLITLLVGTGIFLTVRLRLLQVVHLP
                     LALSLIFRARNRGEGDVSSFKALCVALAATVGTGNIVGVATAVKAGGPGAIFWMWMAA
                     FFGMATKYAEGLLAIKYRTTDSHGDIAGGPMFYIEKGLGRAWRPMAIFFACACVLVAF
                     FGIGTFPQVNAIVDSVEISFGVPRWATDFAITALIAAITLGGLKSIARVAAAIVPFMA
                     LSYIALSLILIVMNIDALPHAVALILQSAFTGEAAVGGFAGSTIMMAMQNGIARGVFS
                     NESGLGSAPIASAASKTKRPAEQGLISMTGTFIDTIIICTMTGLALVLTGVWSGDTAG
                     AAMTSAAFSANYGTIGSHLLTIALVLFAFTTILGWNYYGERAIIYLFERKGVLPYRLI
                     FIALVASGAFLKLEAIWILADIVNGLMAIPNLIALLLLSGVIVRETKLYMEYVKRHSR
                     IKHS"
     misc_feature    complement(431895..433217)
                     /locus_tag="Selsp_0382"
                     /note="Na+/alanine symporter [Amino acid transport and
                     metabolism]; Region: AlsT; COG1115"
                     /db_xref="CDD:224040"
     misc_feature    complement(431865..433031)
                     /locus_tag="Selsp_0382"
                     /note="Amino acid transporters [Amino acid transport and
                     metabolism]; Region: PotE; COG0531"
                     /db_xref="CDD:223605"
     gene            complement(433389..433772)
                     /locus_tag="Selsp_0383"
                     /db_xref="GeneID:10496593"
     CDS             complement(433389..433772)
                     /locus_tag="Selsp_0383"
                     /EC_number="4.1.1.11"
                     /note="COGs: COG0853 Aspartate 1-decarboxylase;
                     InterPro IPR003190;
                     KEGG: pth:PTH_0222 aspartate alpha-decarboxylase;
                     PFAM: Aspartate decarboxylase;
                     PRIAM: Aspartate 1-decarboxylase;
                     SPTR: Aspartate 1-decarboxylase;
                     TIGRFAM: Aspartate decarboxylase;
                     IMG reference gene:2504585842;
                     PFAM: Aspartate decarboxylase;
                     TIGRFAM: L-aspartate-alpha-decarboxylase"
                     /codon_start=1
                     /transl_table=11
                     /product="aspartate 1-decarboxylase"
                     /protein_id="YP_004412815.1"
                     /db_xref="GI:330838235"
                     /db_xref="InterPro:IPR003190"
                     /db_xref="InterPro:IPR009010"
                     /db_xref="GeneID:10496593"
                     /translation="MLLNLMKSKIHCATVTEANLAYMGSITIDEALMEAAHILPHERV
                     QVVNNNNGARLETYVIKGARGSGVVCLNGAAARCVQPGDIVIIMSYAMMTEEEARAHT
                     PIVVMLDERNQQREVRGAEEHGTIA"
     misc_feature    complement(433437..433769)
                     /locus_tag="Selsp_0383"
                     /note="Aspartate alpha-decarboxylase or L-aspartate
                     1-decarboxylase, a pyruvoyl group-dependent  decarboxylase
                     in beta-alanine production; Region: Asp_decarbox; cd06919"
                     /db_xref="CDD:132994"
     misc_feature    complement(order(433470..433472,433497..433505,
                     433515..433517,433539..433544,433548..433553,
                     433599..433613,433617..433619,433626..433628,
                     433632..433634,433644..433649,433656..433658,
                     433662..433664,433704..433715,433737..433742,
                     433746..433748,433752..433769))
                     /locus_tag="Selsp_0383"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:132994"
     misc_feature    complement(order(433599..433601,433698..433703,
                     433740..433742,433746..433748))
                     /locus_tag="Selsp_0383"
                     /note="active site"
                     /db_xref="CDD:132994"
     gene            complement(433763..434623)
                     /locus_tag="Selsp_0384"
                     /db_xref="GeneID:10496594"
     CDS             complement(433763..434623)
                     /locus_tag="Selsp_0384"
                     /EC_number="6.3.2.1"
                     /note="COGs: COG0414 Panthothenate synthetase;
                     InterPro IPR003721:IPR004821;
                     KEGG: pth:PTH_0221 pantoate--beta-alanine ligase;
                     PFAM: Pantoate-beta-alanine ligase;
                     SPTR: Pantothenate synthetase;
                     TIGRFAM: Pantoate-beta-alanine ligase;
                     Cytidyltransferase-related;
                     IMG reference gene:2504585843;
                     PFAM: Pantoate-beta-alanine ligase;
                     TIGRFAM: pantoate--beta-alanine ligase;
                     cytidyltransferase-related domain"
                     /codon_start=1
                     /transl_table=11
                     /product="pantoate/beta-alanine ligase"
                     /protein_id="YP_004412816.1"
                     /db_xref="GI:330838236"
                     /db_xref="InterPro:IPR003721"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="GeneID:10496594"
                     /translation="MKILTTPKELQSYAQSVKNAKETIALVPTMGALHAGHLSLVEAA
                     RKSTDRVIVSIFVNPVQFGPNEDFAAYPRTFEADVEKLDAAGVDAVFHPAPEAMYPAG
                     YATYVEVTGTLTEKLCGAKRPGHFRGVATVVLKLLLLSHADRAFFGQKDAQQVAVLRR
                     MAADLGVTAEIVMAPIVREASGLALSSRNTYLSPDERTAALVLSRSLREARDVYETGE
                     KRTKVLKEITAVELSKEPLAKIDYVELYSFPELEEIERIHAPALLAVAVYIGKTRLID
                     NIILGEETCC"
     misc_feature    complement(433790..434623)
                     /locus_tag="Selsp_0384"
                     /note="Pantoate-beta-alanine ligase; Region: PanC;
                     cd00560"
                     /db_xref="CDD:185673"
     misc_feature    complement(order(434060..434071,434093..434101,
                     434162..434164,434171..434176,434180..434185,
                     434225..434230,434237..434239,434411..434413,
                     434441..434443,434450..434452,434504..434506,
                     434513..434518,434522..434524,434531..434542))
                     /locus_tag="Selsp_0384"
                     /note="active site"
                     /db_xref="CDD:185673"
     misc_feature    complement(order(434069..434074,434093..434098,
                     434162..434164,434171..434176,434180..434185,
                     434225..434230,434441..434443,434504..434506,
                     434513..434515,434522..434524,434534..434542))
                     /locus_tag="Selsp_0384"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:185673"
     misc_feature    complement(order(434162..434164,434216..434218,
                     434225..434230,434441..434443,434450..434452,
                     434534..434536,434540..434542))
                     /locus_tag="Selsp_0384"
                     /note="pantoate-binding site; other site"
                     /db_xref="CDD:185673"
     misc_feature    complement(434513..434524)
                     /locus_tag="Selsp_0384"
                     /note="HXXH motif; other site"
                     /db_xref="CDD:185673"
     gene            complement(434645..435595)
                     /locus_tag="Selsp_0385"
                     /db_xref="GeneID:10496595"
     CDS             complement(434645..435595)
                     /locus_tag="Selsp_0385"
                     /note="COGs: COG0385 Na+-dependent transporter;
                     InterPro IPR002657;
                     KEGG: afn:Acfer_0775 bile acid:sodium symporter;
                     PFAM: Bile acid:sodium symporter;
                     SPTR: Sodium/bile acid transporter family protein;
                     IMG reference gene:2504585844;
                     PFAM: Sodium Bile acid symporter family;
                     TIGRFAM: bile acid transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Bile acid:sodium symporter"
                     /protein_id="YP_004412817.1"
                     /db_xref="GI:330838237"
                     /db_xref="InterPro:IPR002657"
                     /db_xref="GeneID:10496595"
                     /translation="MQNIGRFIVKNMVWLVVLVGAAGAVFPASLSWIAPQVPLLLGIV
                     MFGMGMTIEFKDFRHLVHHPWDVGIGVLAQFTIMPLVAYLLTQAFSLPPALAVGVILV
                     GTCPGGTASNVITYLAKGDVALSVTMTMATTLLAPFVTPFLTLLLAGEEIAVNAPAMM
                     LSIAEMVLLPVLLGAALNHFFRRRVAYALMVLPLISALLVALLVGVVVSMSAPRLAEV
                     GTLVALAVVLHNGFGLALGYALAGLLGLSAPKRRAIGIEVGMQNSGMAASLALLYFNP
                     AAAIPAALFSVWHNISGSLAANWFTRHDANESKISADVSL"
     misc_feature    complement(434657..435586)
                     /locus_tag="Selsp_0385"
                     /note="Predicted Na+-dependent transporter [General
                     function prediction only]; Region: COG0385"
                     /db_xref="CDD:223462"
     gene            436036..436956
                     /locus_tag="Selsp_0386"
                     /db_xref="GeneID:10496596"
     CDS             436036..436956
                     /locus_tag="Selsp_0386"
                     /note="KEGG: vpr:Vpar_0646 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585845"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412818.1"
                     /db_xref="GI:330838238"
                     /db_xref="GeneID:10496596"
                     /translation="MFLKKIMSTALCAALFVTQVGMASAAEETVQGKLAAVETETWGA
                     EQTGAFLDRINHLEKDYLGKHNKGSMLDRVNIVYDDIYDNTTGPGLLTQLNAVEWGLM
                     HEVSPKAVDKRVTEMEMAVAGKTSAGTYKKRIQDLGTAAFGGYSVPLEQVTVPKNTVI
                     KIALTQEVNAKNLKAGDTIRYKVAEDVVQGGMLVFAKGQPGVGTVKKVTQARNFGRDA
                     QIDVDFHTTKAMDGTEVKTFVGEESKQEMKSYAMAAGASVAGMLLLGPIGIIGGAFVK
                     GKNIELPEGTELFIQTQDETVLYAIPTTEK"
     gene            436968..438521
                     /locus_tag="Selsp_0387"
                     /db_xref="GeneID:10496597"
     CDS             436968..438521
                     /locus_tag="Selsp_0387"
                     /note="KEGG: afn:Acfer_1656 hypothetical protein;
                     SPTR: Putative Tat pathway protein;
                     IMG reference gene:2504585846"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412819.1"
                     /db_xref="GI:330838239"
                     /db_xref="InterPro:IPR006311"
                     /db_xref="GeneID:10496597"
                     /translation="MKMMVRRVFPRKSALLAAVFAASCLPSAAFAEYHSSTDTAADVL
                     DYIENERRAARENRLSEAQEQLVRDTAAMQAHLRQPMEDHLKPLPTAFEGDELFYDQV
                     TGEFFARGSVKITEIDNRRVLSDEIKGNALTQDVAVENEAHIVQVTPDMAQVDVRGWK
                     LSYNYGTGIGKIEDASGKVNHQYVSGKRIEVYPDKVIIHEGRATKCHAKTPDYSVSAE
                     RIEIYPNDKIVFYNSDFWLKKTRVGHRDKYTADIRPDHKDMPPFPSVRYTKSDGLIIE
                     QDFALPVAERLDFIPTLLVSTKEGVHGRAELRYGGRYGTLSLQYGYWQDNDDRWIRRE
                     PSLHYELGYHFKDAPIGWGIEADHGRWYNDGIKSTHTYGKIGVYHDPIPLGRGALLSF
                     AADYSVTKESYDRSRITGFSWSATLVKKFSDRLAAYGKYSYAQVYAGNSLFYYDVADY
                     HRALYTGFSYQLTERDRFVCGTAYDIDRRTLGDVDYYWYHDMHCVQLVTRYRAKRDSW
                     SVRLNFTPW"
     misc_feature    437241..>437948
                     /locus_tag="Selsp_0387"
                     /note="Organic solvent tolerance protein OstA [Cell
                     envelope biogenesis, outer membrane]; Region: Imp;
                     COG1452"
                     /db_xref="CDD:224369"
     gene            438538..439545
                     /locus_tag="Selsp_0388"
                     /db_xref="GeneID:10496598"
     CDS             438538..439545
                     /locus_tag="Selsp_0388"
                     /note="COGs: COG2870 ADP-heptose synthase bifunctional
                     sugar kinase/adenylyltransferase;
                     InterPro IPR011611;
                     KEGG: aar:Acear_0222 PfkB domain protein;
                     PFAM: Carbohydrate/purine kinase;
                     SPTR: D-beta-D-heptose 7-phosphate kinase/D-beta-D-heptose
                     1-phosphate adenosyltransferase;
                     IMG reference gene:2504585847;
                     PFAM: pfkB family carbohydrate kinase;
                     TIGRFAM: rfaE bifunctional protein, domain I"
                     /codon_start=1
                     /transl_table=11
                     /product="PfkB domain protein"
                     /protein_id="YP_004412820.1"
                     /db_xref="GI:330838240"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="GeneID:10496598"
                     /translation="MAASINDLASAVGCLKGTRVLVLGDMVADIYLDGRISRISREAP
                     VLVLEEMGERVVAGGAANVAHNAATLGGAVCAFGILGKDAGGAGIAAVLSRAGVDTAG
                     LLATSERPTISKTRVIAGGRATVSQQIVRIDKESREPLSSVLAEELEERLLTALAHVD
                     AVVLSDYGSGTITQGIRERLLAACRERGVPTIVDSRYGVRSFSGVDYVKQNDAELAAA
                     FERHLDTEEALEEAARELVAELGAKGALITRGEKGMMLFLADGARHEIPVSDKSEVYD
                     VSGAGDTCVAAFILALAGGASPLAATQLSNIASGIAVRKFGTATVSAAELTRKVRELS
                     G"
     misc_feature    438580..>439533
                     /locus_tag="Selsp_0388"
                     /note="ADP-heptose synthase, bifunctional sugar
                     kinase/adenylyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaE; COG2870"
                     /db_xref="CDD:225425"
     misc_feature    438592..439521
                     /locus_tag="Selsp_0388"
                     /note="RfaE encodes a bifunctional ADP-heptose synthase
                     involved in the biosynthesis of the lipopolysaccharide
                     (LPS) core precursor ADP-L-glycero-D-manno-heptose. LPS
                     plays an important role in maintaining the structural
                     integrity of the bacterial outer...; Region: RfaE_like;
                     cd01172"
                     /db_xref="CDD:238577"
     misc_feature    order(438610..438612,438616..438618,438709..438714,
                     438721..438723,438778..438780,438784..438786,
                     439372..439374,439378..439383)
                     /locus_tag="Selsp_0388"
                     /note="putative ribose interaction site [chemical
                     binding]; other site"
                     /db_xref="CDD:238577"
     misc_feature    order(439168..439170,439177..439179,439279..439281,
                     439285..439287,439342..439344,439348..439350,
                     439456..439458,439462..439464,439474..439476)
                     /locus_tag="Selsp_0388"
                     /note="putative ADP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238577"
     gene            439564..440028
                     /locus_tag="Selsp_0389"
                     /db_xref="GeneID:10496599"
     CDS             439564..440028
                     /locus_tag="Selsp_0389"
                     /note="COGs: COG2870 ADP-heptose synthase bifunctional
                     sugar kinase/adenylyltransferase;
                     InterPro IPR004821:IPR004820:IPR011914;
                     KEGG: fnu:FN0930 glycerol-3-phosphate
                     cytidylyltransferase;
                     PFAM: Cytidylyltransferase;
                     SPTR: Protein RfaE, domain II;
                     TIGRFAM: RfaE bifunctional protein, domain II;
                     Cytidyltransferase-related;
                     IMG reference gene:2504585848;
                     PFAM: Cytidylyltransferase;
                     TIGRFAM: rfaE bifunctional protein, domain II;
                     cytidyltransferase-related domain"
                     /codon_start=1
                     /transl_table=11
                     /product="rfaE bifunctional protein"
                     /protein_id="YP_004412821.1"
                     /db_xref="GI:330838241"
                     /db_xref="InterPro:IPR004820"
                     /db_xref="InterPro:IPR004821"
                     /db_xref="InterPro:IPR011914"
                     /db_xref="InterPro:IPR014729"
                     /db_xref="GeneID:10496599"
                     /translation="MLIPKERIEDFCATLREAGQRVVFTNGCFDILHAGHVRYLEAAR
                     ALGDCLVLGLNTDASVRRLKGETRPVNTELDRAAVVGALVAVDYVVLFDEPTAEMLIE
                     KVRPAVYAKGGDYTRETLPEAKIVEKYGGEVHFIDLVPGCSTTKIIEKIHQR"
     misc_feature    439600..440016
                     /locus_tag="Selsp_0389"
                     /note="nucleotidyl transferase superfamily; Region:
                     nt_trans; cl00015"
                     /db_xref="CDD:260139"
     misc_feature    <439615..440022
                     /locus_tag="Selsp_0389"
                     /note="ADP-heptose synthase, bifunctional sugar
                     kinase/adenylyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaE; COG2870"
                     /db_xref="CDD:225425"
     misc_feature    order(439660..439671,439987..439998)
                     /locus_tag="Selsp_0389"
                     /note="active site"
                     /db_xref="CDD:173912"
     misc_feature    order(439660..439662,439669..439671,439990..439992)
                     /locus_tag="Selsp_0389"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173912"
     misc_feature    439660..439671
                     /locus_tag="Selsp_0389"
                     /note="HIGH motif; other site"
                     /db_xref="CDD:173912"
     misc_feature    439987..439998
                     /locus_tag="Selsp_0389"
                     /note="KMSKS motif; other site"
                     /db_xref="CDD:173912"
     gene            440062..441084
                     /locus_tag="Selsp_0390"
                     /db_xref="GeneID:10496600"
     CDS             440062..441084
                     /locus_tag="Selsp_0390"
                     /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
                     InterPro IPR002201;
                     KEGG: hor:Hore_18890 3-deoxy-D-manno-octulosonic-acid
                     transferase domain protein;
                     PFAM: Glycosyl transferase, family 9;
                     SPTR: Putative lipopolysaccharide heptosyltransferase-1;
                     IMG reference gene:2504585849;
                     PFAM: Glycosyltransferase family 9 (heptosyltransferase);
                     TIGRFAM: lipopolysaccharide heptosyltransferase I;
                     lipopolysaccharide heptosyltransferase II"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 9"
                     /protein_id="YP_004412822.1"
                     /db_xref="GI:330838242"
                     /db_xref="InterPro:IPR002201"
                     /db_xref="GeneID:10496600"
                     /translation="MKNILVVKLSAIGDVIHALPVSYAIKETFPDAHLTWVVEPTAYD
                     ILAGNPFIDNIILFEKKRFRTVRGFLEEFRPFRHELRARRYDAALDLQGLFKSAAIVA
                     QSGAELRLGTANMREGSAYVSHSIKGAHASGHIVERYLDVARALGCRVDEVHFPVAVS
                     PAEAASADALLAAEGVREDHRFAVLAIGANWPNKRWPVKYFAVLADWLYGEKLIPVLV
                     GGGRLDESLVGDIEALTEVPPVNLVGRTSLKELAHIFKRADLVLGGDTGPVHLAAGLG
                     TKTVMLMGPTDANRNGPYGQQENAMEIPRSCKACWKRRCPKGLDCLAILSVEEVKGKI
                     REVLAR"
     misc_feature    440068..441069
                     /locus_tag="Selsp_0390"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    order(440614..440619,440713..440715,440812..440817,
                     440851..440853,440860..440865,440872..440874)
                     /locus_tag="Selsp_0390"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            441149..442264
                     /locus_tag="Selsp_0391"
                     /db_xref="GeneID:10496601"
     CDS             441149..442264
                     /locus_tag="Selsp_0391"
                     /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
                     InterPro IPR002201;
                     KEGG: afn:Acfer_1650 glycosyl transferase family 9;
                     PFAM: Glycosyl transferase, family 9;
                     SPTR: Heptosyltransferase family protein;
                     IMG reference gene:2504585850;
                     PFAM: Glycosyltransferase family 9 (heptosyltransferase);
                     TIGRFAM: lipopolysaccharide heptosyltransferase II"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 9"
                     /protein_id="YP_004412823.1"
                     /db_xref="GI:330838243"
                     /db_xref="InterPro:IPR002201"
                     /db_xref="GeneID:10496601"
                     /translation="MQQKNYDNILVINLMHIGDLMLVTPVLRTLRMNFPKARITLLAD
                     KKLADLVVCNKHIDGCLLLDKKGADNHPLAFLRFIRRVRREHFDLVINLHRNERASAL
                     AAFSGAGRIVGYAKPIFSAFFDKVMENKKAVKHQIHSHFDVLEEAVGIERIDDAGLEM
                     WLPEGAEESAAKLWQDAFPAGGKVIALNIGASWKTKRWIDDYFAQTADYFLEKGYGVA
                     FFGGPMDEELVCACRAKMRHGDHVMLRTFTGRVTLAELAALLKKCALFITTDSGPMHV
                     GVAMNVPIVTMFGASPVPGFYPYDAKDILLKTPESCHPCGKHECPRAGAENMACMKNI
                     PVKEVLRYAEELLYEYENKVGNIPAHDGQYCCKVVEL"
     misc_feature    441170..442168
                     /locus_tag="Selsp_0391"
                     /note="Lipopolysaccharide heptosyltransferase is involved
                     in the biosynthesis of lipooligosaccharide (LOS).
                     Lipopolysaccharide (LPS) is a major component of the outer
                     membrane of gram-negative bacteria. LPS
                     heptosyltransferase transfers heptose molecules from...;
                     Region: GT1_LPS_heptosyltransferase; cd03789"
                     /db_xref="CDD:99964"
     misc_feature    order(441707..441712,441806..441808,441914..441919,
                     441953..441955,441962..441967,441974..441976)
                     /locus_tag="Selsp_0391"
                     /note="putative active site [active]"
                     /db_xref="CDD:99964"
     gene            442296..443294
                     /locus_tag="Selsp_0392"
                     /db_xref="GeneID:10496602"
     CDS             442296..443294
                     /locus_tag="Selsp_0392"
                     /note="COGs: COG2870 ADP-heptose synthase bifunctional
                     sugar kinase/adenylyltransferase;
                     InterPro IPR011611:IPR011913;
                     KEGG: afn:Acfer_1654 RfaE bifunctional protein;
                     PFAM: Carbohydrate/purine kinase;
                     SPTR: Protein RfaE, domain I;
                     TIGRFAM: RfaE bifunctional protein, domain I;
                     IMG reference gene:2504585851;
                     PFAM: pfkB family carbohydrate kinase;
                     TIGRFAM: rfaE bifunctional protein, domain I"
                     /codon_start=1
                     /transl_table=11
                     /product="rfaE bifunctional protein"
                     /protein_id="YP_004412824.1"
                     /db_xref="GI:330838244"
                     /db_xref="InterPro:IPR002173"
                     /db_xref="InterPro:IPR011611"
                     /db_xref="InterPro:IPR011913"
                     /db_xref="GeneID:10496602"
                     /translation="MDIEKMLTLVEERLSRCKILVTGDVMLDKYYYGEVTRISPEAPV
                     PINHITRQKETLGGAANVAHNLALLGCDTLLAGFVGEDYHCRSLKEKLVENGIDHAGL
                     VPTNRPTTTKMRIIGGHQQMMRLDFESTEPLEKIYIDKFLAFVRCKLAESIDAIVVSD
                     YAKGTCSEVTTTAIIEAAHAHGVPVIIDPKGANWTKYRGADYITPNVKEINEILIDPI
                     KNTNAEVLKAAHYIMRKYRIKNVLVTRSESGVTLVREGEEVHIPTRAQEVFDVSGAGD
                     TVIAVLAAGLAGGLKGRDAAFLANLAASVVVRKLGTYAVSREELKEELRKLPREEA"
     misc_feature    442314..>443261
                     /locus_tag="Selsp_0392"
                     /note="ADP-heptose synthase, bifunctional sugar
                     kinase/adenylyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaE; COG2870"
                     /db_xref="CDD:225425"
     misc_feature    442347..443261
                     /locus_tag="Selsp_0392"
                     /note="RfaE encodes a bifunctional ADP-heptose synthase
                     involved in the biosynthesis of the lipopolysaccharide
                     (LPS) core precursor ADP-L-glycero-D-manno-heptose. LPS
                     plays an important role in maintaining the structural
                     integrity of the bacterial outer...; Region: RfaE_like;
                     cd01172"
                     /db_xref="CDD:238577"
     misc_feature    order(442365..442367,442371..442373,442464..442469,
                     442476..442478,442533..442535,442539..442541,
                     443112..443114,443118..443123)
                     /locus_tag="Selsp_0392"
                     /note="putative ribose interaction site [chemical
                     binding]; other site"
                     /db_xref="CDD:238577"
     misc_feature    order(442911..442913,442920..442922,443025..443027,
                     443031..443033,443085..443087,443091..443093,
                     443196..443198,443202..443204,443214..443216)
                     /locus_tag="Selsp_0392"
                     /note="putative ADP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238577"
     gene            443349..444320
                     /locus_tag="Selsp_0393"
                     /db_xref="GeneID:10496603"
     CDS             443349..444320
                     /locus_tag="Selsp_0393"
                     /EC_number="5.1.3.20"
                     /note="COGs: COG0451 Nucleoside-diphosphate-sugar
                     epimerase;
                     HAMAP: ADP-L-glycero-D-manno-heptose-6-epimerase;
                     InterPro IPR011912:IPR001509;
                     KEGG: vpr:Vpar_0757
                     ADP-L-glycero-D-manno-heptose-6-epimerase;
                     PFAM: NAD-dependent epimerase/dehydratase;
                     PRIAM: ADP-glyceromanno-heptose 6-epimerase;
                     SPTR: ADP-glyceromanno-heptose 6-epimerase;
                     TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase;
                     IMG reference gene:2504585852;
                     PFAM: NAD dependent epimerase/dehydratase family;
                     TIGRFAM: ADP-L-glycero-D-manno-heptose-6-epimerase"
                     /codon_start=1
                     /transl_table=11
                     /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
                     /protein_id="YP_004412825.1"
                     /db_xref="GI:330838245"
                     /db_xref="InterPro:IPR001509"
                     /db_xref="InterPro:IPR011912"
                     /db_xref="InterPro:IPR016040"
                     /db_xref="GeneID:10496603"
                     /translation="MIIVTGGAGFIGSNIVKELNRKGRNDILIVDDLKDGENYKNLRG
                     LHFIDYRHKDDFLESIEDDEFGGSDIDAVFHEGACSDTMEYDVNYMMKVNYEYSKTLL
                     HFCLLHRVPFLYASSASTYGAGRHGFTENDAAEDALNPYAYSKLAFDRYVRQVMRESR
                     SPIVGLRYFNVFGPQEQHKGKMASIFYQLYRQLKETGEARLFRGTDGFDDGEQRRDFI
                     YVKDVVKVNFWFWENKGPSGIYNCGTGKAHTYNEAADAVIAALGKGYIGYRDFPEVLK
                     GKYQSFTEADPKQLLKAGYDGGFHDFRAAVKEYVDFLEDGGYFRYEE"
     misc_feature    443349..444278
                     /locus_tag="Selsp_0393"
                     /note="ADP-L-glycero-D-mannoheptose 6-epimerase (GME),
                     extended (e) SDRs; Region: ADP_GME_SDR_e; cd05248"
                     /db_xref="CDD:187559"
     misc_feature    443352..444278
                     /locus_tag="Selsp_0393"
                     /note="ADP-L-glycero-D-manno-heptose-6-epimerase; Region:
                     heptose_epim; TIGR02197"
                     /db_xref="CDD:233775"
     misc_feature    order(443361..443366,443373..443381,443436..443444,
                     443460..443462,443505..443507,443574..443582,
                     443586..443588,443613..443615,443625..443627,
                     443637..443639,443691..443699,443769..443771,
                     443781..443783,443850..443855,443859..443861,
                     443880..443885)
                     /locus_tag="Selsp_0393"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187559"
     misc_feature    order(443445..443450,443454..443459,443463..443465,
                     443472..443477,443481..443498,443502..443504,
                     443601..443612,443619..443621,443631..443633,
                     443643..443645,443742..443744,443754..443768,
                     443775..443777,443787..443789,443796..443801,
                     443808..443810)
                     /locus_tag="Selsp_0393"
                     /note="homopentamer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:187559"
     misc_feature    order(443592..443594,443856..443858,443889..443897,
                     443901..443903,443910..443912,443991..443993,
                     444096..444098)
                     /locus_tag="Selsp_0393"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:187559"
     misc_feature    order(443628..443630,443697..443699,443769..443771,
                     443781..443783)
                     /locus_tag="Selsp_0393"
                     /note="active site"
                     /db_xref="CDD:187559"
     gene            444310..444828
                     /locus_tag="Selsp_0394"
                     /db_xref="GeneID:10496604"
     CDS             444310..444828
                     /locus_tag="Selsp_0394"
                     /note="COGs: COG0241 Histidinol phosphatase and related
                     phosphatase;
                     InterPro IPR006543:IPR013954:IPR006549;
                     KEGG: dma:DMR_02160 D,D-heptose 1,7-bisphosphate
                     phosphatase;
                     SPTR: ATP-dependent Clp protease, ATP-binding subunit
                     ClpA;
                     TIGRFAM: HAD-superfamily hydrolase, subfamily IIIA;
                     Histidinol-phosphate phosphatase;
                     IMG reference gene:2504585853;
                     PFAM: Polynucleotide kinase 3 phosphatase;
                     TIGRFAM: haloacid dehalogenase superfamily, subfamily IA,
                     variant 1 with third motif having Dx(3-4)D or Dx(3-4)E;
                     HAD-superfamily hydrolase, subfamily IIIA; D,D-heptose
                     1,7-bisphosphate phosphatase; histidinol-phosphate
                     phosphatase family domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase, HAD-superfamily, subfamily IIIA"
                     /protein_id="YP_004412826.1"
                     /db_xref="GI:330838246"
                     /db_xref="InterPro:IPR006543"
                     /db_xref="InterPro:IPR006549"
                     /db_xref="InterPro:IPR013954"
                     /db_xref="GeneID:10496604"
                     /translation="MKNKGVPAVFFDRDGTLNVDIHYLHRPEDFIWTPDTPAAIRRLN
                     ECGILTIVVTNQSGVARGYYPEEDVRRLHDWMNEELKKEGAHLDALFYCPHHIDGKIP
                     EYTKNCSCRKPATGMIDAACAKYDIDRTRAVLIGDSESDMECARHAGVRGVRYEGGSL
                     LDVVERVLGMLG"
     misc_feature    444331..444768
                     /locus_tag="Selsp_0394"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    444337..444762
                     /locus_tag="Selsp_0394"
                     /note="Polynucleotide kinase 3 phosphatase; Region: PNK3P;
                     pfam08645"
                     /db_xref="CDD:254946"
     misc_feature    order(444343..444351,444469..444474)
                     /locus_tag="Selsp_0394"
                     /note="active site"
                     /db_xref="CDD:119389"
     misc_feature    444343..444360
                     /locus_tag="Selsp_0394"
                     /note="motif I; other site"
                     /db_xref="CDD:119389"
     misc_feature    444469..444471
                     /locus_tag="Selsp_0394"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            444910..446085
                     /locus_tag="Selsp_0395"
                     /db_xref="GeneID:10496605"
     CDS             444910..446085
                     /locus_tag="Selsp_0395"
                     /note="COGs: COG0438 Glycosyltransferase;
                     InterPro IPR001296;
                     KEGG: vfi:VF_0149 glycosyltransferase;
                     PFAM: Glycosyl transferase, group 1;
                     SPTR: Putative glycosyl transferase, group 1;
                     IMG reference gene:2504585854;
                     PFAM: Glycosyl transferases group 1"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase group 1"
                     /protein_id="YP_004412827.1"
                     /db_xref="GI:330838247"
                     /db_xref="InterPro:IPR001296"
                     /db_xref="GeneID:10496605"
                     /translation="MRLLLANFSKMVGDTGGAAKVHCSFANEMKRRGHDVAMVFCDDK
                     IGKPFFPVDDGIELCNLQHYEDTDVVFPKYLKVKRELVRAFSTRRGRAVNNGFVKTYL
                     LAPTKRVLESFKPDIVICWQTLASKIFLCDLETKIPVITMSHGDPEDIFHTYPQEEIP
                     ALGKSTACQVLLPSFVEAIKKRFPNMKTVTIGNVVPQYEEAADLGCEKEQYKIIFIGR
                     LVKNHKRPHLLIEAFARLADDFPDWIVEIWGGGAKKSYQKSLETLIQRAGLEQRVFLK
                     GTTHDVASVLQKGDLFVCPSAYEGFSLALTEAMSMGLPAIGYKDSISVNELIQDGITG
                     FLAEDGVDGMVQSMKMLMANQDLRVRMGMAARESMRQYEASVIWDEWESLLDECRKY"
     misc_feature    444916..446058
                     /locus_tag="Selsp_0395"
                     /note="This family is most closely related to the GT1
                     family of glycosyltransferases. AmSD in Erwinia amylovora
                     has been shown to be involved in the biosynthesis of
                     amylovoran, the acidic exopolysaccharide acting as a
                     virulence factor. This enzyme may be...; Region:
                     GT1_amsD_like; cd03820"
                     /db_xref="CDD:99990"
     misc_feature    order(444958..444960,445555..445563,445753..445755,
                     445819..445821)
                     /locus_tag="Selsp_0395"
                     /note="putative ADP-binding pocket [chemical binding];
                     other site"
                     /db_xref="CDD:99990"
     misc_feature    445078..446079
                     /locus_tag="Selsp_0395"
                     /note="Glycosyltransferase [Cell envelope biogenesis,
                     outer membrane]; Region: RfaG; COG0438"
                     /db_xref="CDD:223515"
     gene            complement(446175..447212)
                     /locus_tag="Selsp_0396"
                     /db_xref="GeneID:10496606"
     CDS             complement(446175..447212)
                     /locus_tag="Selsp_0396"
                     /note="COGs: COG4641 conserved hypothetical protein;
                     KEGG: gym:GYMC10_1460 hypothetical protein;
                     SPTR: Maturation of the outermost layer of the spore;
                     IMG reference gene:2504585855"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412828.1"
                     /db_xref="GI:330838248"
                     /db_xref="GeneID:10496606"
                     /translation="MKILILAPPYLSHSSGVSSAFQKIGYRTQLFYCNEFYLDCSYWE
                     RKLYKLGYKAAKKRYEYTQCSRLRFCYDNFQPDYILVLSGLYLDECLLSYLESLHIPK
                     FLWTWDGINRFPFFSKIIPHFSHIFCFESKDVPFIQKTYSISSTYCPLGYDENAYFFE
                     ETIKDIDISFVGIPLPNRTTILDATAKYSQEHHLTMLIAGPWYDRKYFWKKWQYQKRH
                     PKLFPYLLNHRISSNETANIYRRSKICLNIGAIEHLGLNPRTFEILATGSFQLTDHIY
                     KKDIDDGILQADSTISFLDEYDLLEKIEYYLYHEELRRELAQKGYKDAVPHTSIRSFV
                     QSRICPEMDKF"
     misc_feature    complement(446226..447107)
                     /locus_tag="Selsp_0396"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4641"
                     /db_xref="CDD:226988"
     misc_feature    complement(446247..446483)
                     /locus_tag="Selsp_0396"
                     /note="Glycosyl transferases group 1; Region:
                     Glyco_trans_1_2; pfam13524"
                     /db_xref="CDD:257844"
     gene            complement(447225..448262)
                     /locus_tag="Selsp_0397"
                     /db_xref="GeneID:10496607"
     CDS             complement(447225..448262)
                     /locus_tag="Selsp_0397"
                     /note="COGs: COG0859 ADP-heptose:LPS heptosyltransferase;
                     InterPro IPR002201;
                     KEGG: pay:PAU_04357 putative LPS biosynthesis enzyme
                     (lipopolysaccharide core biosynthesi protein rfaq);
                     PFAM: Glycosyl transferase, family 9;
                     SPTR: Putative ADP-heptose--LPS heptosyltransferase II;
                     IMG reference gene:2504585856;
                     PFAM: Glycosyltransferase family 9 (heptosyltransferase)"
                     /codon_start=1
                     /transl_table=11
                     /product="glycosyl transferase family 9"
                     /protein_id="YP_004412829.1"
                     /db_xref="GI:330838249"
                     /db_xref="InterPro:IPR002201"
                     /db_xref="GeneID:10496607"
                     /translation="MKINLNNMRLLVEGTPGMGDLIMLTPALRELKNQFPGCEITIMS
                     HPGNLKMVDRLPYVSRVCPIDKSVTGILKTARLLHQQDIIIFTTWQSLYARMLKFLRV
                     SFCAGVCKEKYLKRKYFHLVLPHLDSYGTQYRPQSIANQLGQALGMQLSINAHYDVST
                     PTEEEWQSVKTKLHQLGRSLNEEKPYIVFAPVGRTAQSIPSSLVMAAIEHLQKNYPYE
                     IVLSHDHPLSYLQSLKQQEGTNNIYDLSGCLSLRELIALLDRAQLVIATDSGPMHIAC
                     ARKTPSIALFTTDVPSRWAGPFCHPISMHMTCSSTCNAEVARTCLEKKCLTKITPNMI
                     CSTINQVICSI"
     misc_feature    complement(447297..448241)
                     /locus_tag="Selsp_0397"
                     /note="ADP-heptose:LPS heptosyltransferase [Cell envelope
                     biogenesis, outer membrane]; Region: RfaF; COG0859"
                     /db_xref="CDD:223928"
     gene            complement(448285..449247)
                     /locus_tag="Selsp_0398"
                     /db_xref="GeneID:10496608"
     CDS             complement(448285..449247)
                     /locus_tag="Selsp_0398"
                     /note="KEGG: tbd:Tbd_1883 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585857"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412830.1"
                     /db_xref="GI:330838250"
                     /db_xref="GeneID:10496608"
                     /translation="MKFLIVSPRQTSGGAIVLHLLCKLLMDRGHDAKIFYTAFKRKYP
                     ISYATFLFDHICFLRHDIPRRLKAQLFPKAKFTKKPRYNGYAYFPVKGCQQKYLPTID
                     DETIVIYPEIVYGNPLRAKKTIYWLLFFNPYKGDANAYAKDALIFTYHELFNDEILNP
                     SGRKLHLQALDEDMWKQTNFGERSGCCYIVHKGHDRADLPKQFDGPVIDKLSKHEIAE
                     ILNQKKYCYCYDMYTSYSLIAAMCGCIPIVMLEEGKTRTDCIGKEEEGYGIAWGNTPE
                     AIEYALATREKMFEQIHKMHKENDDAVDSFLVECKRYFYPEQDI"
     gene            complement(449391..449987)
                     /locus_tag="Selsp_0399"
                     /db_xref="GeneID:10496609"
     CDS             complement(449391..449987)
                     /locus_tag="Selsp_0399"
                     /note="SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585858"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412831.1"
                     /db_xref="GI:330838251"
                     /db_xref="GeneID:10496609"
                     /translation="MNLGAIWLILCALVLIRYCWKYNENDPERRFFGIFLVVLLAFLF
                     YIVQSLLFIPFVAVAFVAIMPAYVTYMLKSILTKDITLLPLLFFVISALISAIVLQPA
                     SLYDNPSETVISGEALLQTYINQTQVYEIHFSQPITLESLIPNTFTSIAIGFSLLILE
                     KSFKEFFNINGKFFINIGEHIKYEWTLFKWKRSKRKFL"
     gene            450414..452378
                     /locus_tag="Selsp_0400"
                     /db_xref="GeneID:10496610"
     CDS             450414..452378
                     /locus_tag="Selsp_0400"
                     /note="COGs: COG1368 Phosphoglycerol transferase and
                     related protein alkaline phosphatase superfamily;
                     InterPro IPR000917;
                     KEGG: vpr:Vpar_0015 sulfatase;
                     PFAM: Sulfatase;
                     SPTR: Putative arylsulfatase;
                     IMG reference gene:2504585859;
                     PFAM: Sulfatase"
                     /codon_start=1
                     /transl_table=11
                     /product="sulfatase"
                     /protein_id="YP_004412832.1"
                     /db_xref="GI:330838252"
                     /db_xref="InterPro:IPR000917"
                     /db_xref="InterPro:IPR017849"
                     /db_xref="InterPro:IPR017850"
                     /db_xref="GeneID:10496610"
                     /translation="MRLEQFFANLQKDLKVFLFLLFVICLYRAYFMAYMSEAIAPNTS
                     MGEVFLALWLGFRISLKSAGAIALLVFAFCSLPELVLPRLRLDRLRLWIGTAGSALLA
                     IFFQARFPYYEVFHATFGREVVQGMHEDTQTIFSMLVESYALPTRLLAAVVLTAISYF
                     LLRRLLRTETMPLPNCLNRWALGVGLFLFIPIFFIFIRFGGSFNYEHSINWENASVTK
                     DPFLNECILDDIQAMYRVRDFYLNMQKDGGVSFIDVSRAEEYMGFLGGDMNRREGLEA
                     SLTRTARGARLPKPKHIFIILGETYAQWPMLPEYADLHGADGIKSLIAEDRAFYTQSF
                     MPNGTFTLVAITGLVTGLSDVGMDLNYQPKSFREVYLTSMAPQFQRLGYRVEFWYGGY
                     PEWDSIKKLSLAQGFDAFYGAPDYNAPQQNVWGTTDGHLFEALYDHLAEEEPTVHLIM
                     TISNHPPYDIDLAAEGIDTAELESALQGRTEQPKQLALEVGHYRYMDKVVTDFVRRTM
                     AAYPDSIFVITGDHSIRMDPTAQPTLFEHESVPFVLYGNGVTKDILPKDAVGGHTAIV
                     PTLIELIAPEGFSYASIARSMTEGTKYAFNSDCWISREAMGNVDDDRMELLPGIASPQ
                     DDLATEREAALYEVAAMRTLSRILIGDMEQ"
     misc_feature    450414..452324
                     /locus_tag="Selsp_0400"
                     /note="Phosphoglycerol transferase and related proteins,
                     alkaline phosphatase superfamily [Cell envelope
                     biogenesis, outer membrane]; Region: MdoB; COG1368"
                     /db_xref="CDD:224287"
     misc_feature    451284..452129
                     /locus_tag="Selsp_0400"
                     /note="Sulfatase; Region: Sulfatase; cl19157"
                     /db_xref="CDD:267510"
     gene            452391..453296
                     /locus_tag="Selsp_0401"
                     /db_xref="GeneID:10496611"
     CDS             452391..453296
                     /locus_tag="Selsp_0401"
                     /note="KEGG: bba:Bd1672 putative
                     N-acetylglucosaminyltransferase;
                     SPTR: Beta-1,4-N-acetylglucosaminyltransferase;
                     IMG reference gene:2504585860;
                     PFAM: Glycosyltransferase family 17"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412833.1"
                     /db_xref="GI:330838253"
                     /db_xref="InterPro:IPR006813"
                     /db_xref="GeneID:10496611"
                     /translation="MAIYDCFTFYNEYELLEWRLKMLYDVVDLFVIVEGNRTFQNKPK
                     EFNFPKYEKLFAPYEKKIRYVAIEEEMPYDSDWSIEIFQRNYIKNALVDCKDDDIILL
                     SDVDEFAAPELLQQVEDGLGEVHIFSTFERVAEREGLRGLSRNTRCFLRSVPYMGKRS
                     SIREFLRYSPVVCEQAMYNFFINYRRDSNWCGLILAEYGQIVDMQKLRSRRNQFPLVY
                     GGWHFSSLGGLKMIRNKINSTSDGMCNPIYGLPEEEQNQVIEDALEKGYIWWRDEYLK
                     KCTLEDMDIPWIEWFAKKYPYMYHG"
     misc_feature    <452397..>452762
                     /locus_tag="Selsp_0401"
                     /note="Glycosyltransferase family 17; Region:
                     Glyco_transf_17; pfam04724"
                     /db_xref="CDD:252763"
     gene            453418..454320
                     /locus_tag="Selsp_0402"
                     /db_xref="GeneID:10496612"
     CDS             453418..454320
                     /locus_tag="Selsp_0402"
                     /note="COGs: COG2990 conserved hypothetical protein;
                     InterPro IPR007488;
                     KEGG: afn:Acfer_1658 protein of unknown function DUF535;
                     PFAM: Protein of unknown function DUF535;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585861;
                     PFAM: Protein of unknown function (DUF535)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412834.1"
                     /db_xref="GI:330838254"
                     /db_xref="InterPro:IPR007488"
                     /db_xref="GeneID:10496612"
                     /translation="MQSFWSLGKKIYNMSNPREARRCVVFCARAMANRSRMRQIDDFF
                     HQDAVLQQVADVCPFVYEQPTRAFFYNKSTFEERAALVEAHIGFLCDVLDEHVLLALY
                     RHEQMLLWRGESCMEKELAAFLLFEPGQRKEGLLSVMLRLGESALYQIIFWLNKAPDG
                     EMAMWIGAMQGPNMENAKDVVKQVTKACHAYRTKNLILYMAQAVARSLGLKHIYAVSN
                     EGYYANNHIRRDRKLKTDFGTFWEEAGGQVLADARFYELPLVETRKTMEEVPTRKRAV
                     YRRRFAFLDDVDAQIAENMGKILR"
     misc_feature    453469..454296
                     /locus_tag="Selsp_0402"
                     /note="Protein of unknown function (DUF535); Region:
                     DUF535; cl01128"
                     /db_xref="CDD:260800"
     gene            454343..455428
                     /locus_tag="Selsp_0403"
                     /db_xref="GeneID:10496613"
     CDS             454343..455428
                     /locus_tag="Selsp_0403"
                     /note="COGs: COG4637 ATPase;
                     InterPro IPR003395;
                     KEGG: dak:DaAHT2_2162 SMC domain protein;
                     PFAM: RecF/RecN/SMC;
                     SPTR: Putative RecF/RecN/SMC N domain protein;
                     IMG reference gene:2504585862"
                     /codon_start=1
                     /transl_table=11
                     /product="SMC domain protein"
                     /protein_id="YP_004412835.1"
                     /db_xref="GI:330838255"
                     /db_xref="GeneID:10496613"
                     /translation="MNQFQLTRLKVLGFKSIQETEIEFGMLNVLIGSNGSGKTNLISL
                     FSLLQAMIEGRLQSYVAKKGGPDTFLHWGRKRTEALSAAFYFGNNGYGFSLEATADNR
                     LMIGDEVFYWTKSDERSIGCGNMESVWREGTHTGIDRYVKPILEKQKWRVYHFHDTSD
                     TALVKQIHGINDNIELATDARNLAAFLYRLQKTEEKSYYRIVSVVQMAAPYFDDFILR
                     ENPLNPKSIDLEWRAKGSDLPFMASQLSDGTLRFICLAVLLLQPTYLQPETILIDEPE
                     LGLHPYAIQLLASLIKKASRKKQIIVSTQSVELLNEFQANDIIVVEHKDATSTFRRLN
                     SEALSFWIAEDYTLGDLWKRNIFGGRP"
     misc_feature    454355..455344
                     /locus_tag="Selsp_0403"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG4637"
                     /db_xref="CDD:226984"
     misc_feature    454358..>454489
                     /locus_tag="Selsp_0403"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    454436..454459
                     /locus_tag="Selsp_0403"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(454445..454450,454454..454462)
                     /locus_tag="Selsp_0403"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    <455006..455314
                     /locus_tag="Selsp_0403"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cd00267"
                     /db_xref="CDD:213179"
     misc_feature    455063..455074
                     /locus_tag="Selsp_0403"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    455075..455104
                     /locus_tag="Selsp_0403"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    455147..455164
                     /locus_tag="Selsp_0403"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    455171..455182
                     /locus_tag="Selsp_0403"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    455243..455263
                     /locus_tag="Selsp_0403"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            455430..456059
                     /locus_tag="Selsp_0404"
                     /db_xref="GeneID:10496614"
     CDS             455430..456059
                     /locus_tag="Selsp_0404"
                     /note="KEGG: plu:plu3301 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585863"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412836.1"
                     /db_xref="GI:330838256"
                     /db_xref="GeneID:10496614"
                     /translation="MVRIKIYCEGLSEETFIKNILVPSFVEKQIYLTAIPCDGVSKYS
                     RIRKDIRDLCREDTRAIVTTMLDYYGLPAETPGYREAPKDDVYRMVEFVERKIAEDIS
                     EENFYPNLLLHEYETLLFSNVDAFSFCDLNHQQMESLREISRCFPTPEHINNSPNTAP
                     SKRILKICEDYDKVPDGYKIAENIGLHVMREKCCHFDAWLCYLENLQNC"
     misc_feature    455454..456047
                     /locus_tag="Selsp_0404"
                     /note="Domain of unknown function (DUF4276); Region:
                     DUF4276; pfam14103"
                     /db_xref="CDD:258322"
     gene            456218..456538
                     /locus_tag="Selsp_0405"
                     /db_xref="GeneID:10496615"
     CDS             456218..456538
                     /locus_tag="Selsp_0405"
                     /note="InterPro IPR010235;
                     KEGG: afn:Acfer_0872 nucleotidyltransferase substrate
                     binding protein, HI0074 family;
                     PFAM: Nucleotidyltransferase substrate binding protein,
                     HI0074;
                     SPTR: Putative toxin-antitoxin system, antitoxin
                     component;
                     TIGRFAM: Nucleotidyltransferase substrate binding protein,
                     HI0074;
                     manually curated;
                     IMG reference gene:2504585864;
                     PFAM: Nucleotidyltransferase substrate binding protein
                     like;
                     TIGRFAM: nucleotidyltransferase substrate binding protein,
                     HI0074 family"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase substrate binding
                     protein, HI0074 family"
                     /protein_id="YP_004412837.1"
                     /db_xref="GI:330838257"
                     /db_xref="InterPro:IPR010235"
                     /db_xref="GeneID:10496615"
                     /translation="MNLYLDATIQLFEFCFELAWKLMKTVLSYEGIEVSSPRASIREG
                     WKQGLVQEAEAWLDMLEKRKLSAHTYNEQTAQVIYVAVKGKYFAMLAALEGEVAARWE
                     EDER"
     misc_feature    456221..456496
                     /locus_tag="Selsp_0405"
                     /note="Nucleotidyltransferase substrate binding protein
                     like; Region: NTase_sub_bind; pfam08780"
                     /db_xref="CDD:255033"
     gene            456843..458330
                     /locus_tag="Selsp_0406"
                     /db_xref="GeneID:10496616"
     CDS             456843..458330
                     /locus_tag="Selsp_0406"
                     /note="COGs: COG2865 transcriptional regulator protein;
                     InterPro IPR007421;
                     KEGG: cjk:jk0129 putative DNA-binding protein;
                     PFAM: ATPase, AAA-4;
                     SPTR: Putative DNA-binding protein;
                     IMG reference gene:2504585865;
                     PFAM: Divergent AAA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="putative transcriptional regulator"
                     /protein_id="YP_004412838.1"
                     /db_xref="GI:330838258"
                     /db_xref="InterPro:IPR007421"
                     /db_xref="GeneID:10496616"
                     /translation="MIIEDLVGLTRWVLQKKTETQMLEVKAAHEGCPRHLYDTLSSFS
                     NQDGGGTLLFGIDEEQDFALVGVYDLHDLQKKVGEQCLQMEPPVRAVFTVAEVDGLDV
                     CSAEIPGLDLSERPCYYKGKGRVKGSYVRVGDADYCMSEYELYSFEAFRKHLHDDERS
                     VARARSEDLRLEATEAYWQEKCRERPGFAQIPRERAYELLNVLRDGKPTLAALLNFGI
                     YPQGFLTQFCITAVVVPGKEVGATDENDARFLDNKRIEGTLAEMLAEALVFCRRNMKT
                     QVSIDKGTGRRCDRTEYPVAAIREAVLNALIHRDYSIYTEGAPIQIYMFTDRLEIHSP
                     GSLYGRMTVEQLGKAKLDLRNPALAVMAEMIIEAENRYSGIPTMYREMHAFGLPEPQF
                     ENRRDEFVVTFFNQRESESVRESFSLGEQDLLAFCKVPRTRAEIAAFLGIATVGYVQR
                     RYIRPLLASGALRMTLPETPRSSKQKYYHEAPRGQAEGSDWEVFR"
     misc_feature    456882..458231
                     /locus_tag="Selsp_0406"
                     /note="Predicted transcriptional regulator containing an
                     HTH domain and an uncharacterized domain shared with the
                     mammalian protein Schlafen [Transcription]; Region:
                     COG2865"
                     /db_xref="CDD:225420"
     misc_feature    456897..457262
                     /locus_tag="Selsp_0406"
                     /note="Divergent AAA domain; Region: AAA_4; pfam04326"
                     /db_xref="CDD:252528"
     misc_feature    457791..458051
                     /locus_tag="Selsp_0406"
                     /note="ATP-dependent DNA helicase recG C-terminal; Region:
                     HATPase_c_4; pfam13749"
                     /db_xref="CDD:258042"
     gene            458327..458671
                     /locus_tag="Selsp_0407"
                     /db_xref="GeneID:10496617"
     CDS             458327..458671
                     /locus_tag="Selsp_0407"
                     /note="InterPro IPR002934;
                     KEGG: ere:EUBREC_2415 putative nucleotidyltransferase;
                     PFAM: Nucleotidyl transferase domain;
                     SPTR: Putative toxin-antitoxin system, toxin component;
                     manually curated;
                     IMG reference gene:2504585866;
                     PFAM: Nucleotidyltransferase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase beta domain protein region"
                     /protein_id="YP_004412839.1"
                     /db_xref="GI:330838259"
                     /db_xref="InterPro:IPR002934"
                     /db_xref="GeneID:10496617"
                     /translation="MNLPNPIREGIVRLARKYGLSRVVLFGSRARGDNWERSDVDLAV
                     AGGDVVRFSLDVDEELPTLLMFDVVNLDGPVQPELLEEIQRDGVLLYEKGREFPQSAT
                     ESQGDRGEEASL"
     misc_feature    458339..458596
                     /locus_tag="Selsp_0407"
                     /note="Nucleotidyltransferase (NT) domain of
                     Staphylococcus aureus kanamycin nucleotidyltransferase,
                     and similar proteins; Region: NT_KNTase_like; cd05403"
                     /db_xref="CDD:143393"
     misc_feature    order(458402..458410,458417..458419,458438..458443,
                     458447..458449,458519..458521,458525..458527)
                     /locus_tag="Selsp_0407"
                     /note="active site"
                     /db_xref="CDD:143393"
     misc_feature    order(458402..458410,458417..458419,458438..458443,
                     458447..458449)
                     /locus_tag="Selsp_0407"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:143393"
     misc_feature    order(458441..458443,458447..458449,458525..458527)
                     /locus_tag="Selsp_0407"
                     /note="metal binding triad [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143393"
     misc_feature    order(458519..458521,458525..458527)
                     /locus_tag="Selsp_0407"
                     /note="antibiotic binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:143393"
     gene            458598..458987
                     /locus_tag="Selsp_0408"
                     /db_xref="GeneID:10496618"
     CDS             458598..458987
                     /locus_tag="Selsp_0408"
                     /note="InterPro IPR010235;
                     KEGG: ere:EUBREC_2414 nucleotidyltransferase;
                     PFAM: Nucleotidyltransferase substrate binding protein,
                     HI0074;
                     SPTR: Putative toxin-antitoxin system, antitoxin
                     component;
                     TIGRFAM: Nucleotidyltransferase substrate binding protein,
                     HI0074;
                     manually curated;
                     IMG reference gene:2504585867;
                     PFAM: Nucleotidyltransferase substrate binding protein
                     like;
                     TIGRFAM: nucleotidyltransferase substrate binding protein,
                     HI0074 family"
                     /codon_start=1
                     /transl_table=11
                     /product="nucleotidyltransferase substrate binding
                     protein, HI0074 family"
                     /protein_id="YP_004412840.1"
                     /db_xref="GI:330838260"
                     /db_xref="InterPro:IPR010235"
                     /db_xref="GeneID:10496618"
                     /translation="MKKAENFLKALQNLKEIEGKKPPYDTIATAGMVSLFEICFEQAW
                     KAMKEQLEASGYGEHKSGSPKSVIKLAYQARMVKDEELWLAALQARNNVAHSYSEPIA
                     LSIIRDSQEKFIAMFEQLAEDLRERWL"
     misc_feature    458601..458975
                     /locus_tag="Selsp_0408"
                     /note="Nucleotidyltransferase substrate binding protein
                     like; Region: NTase_sub_bind; cl17552"
                     /db_xref="CDD:266744"
     gene            459086..460321
                     /locus_tag="Selsp_0409"
                     /db_xref="GeneID:10496619"
     CDS             459086..460321
                     /locus_tag="Selsp_0409"
                     /note="COGs: COG3177 conserved hypothetical protein;
                     InterPro IPR003812;
                     KEGG: ele:Elen_3019 filamentation induced by cAMP protein
                     Fic;
                     PFAM: Filamentation induced by cAMP/death on
                     curing-related;
                     SPTR: Putative bacterial regulatory protein;
                     IMG reference gene:2504585868;
                     PFAM: Fic/DOC family"
                     /codon_start=1
                     /transl_table=11
                     /product="filamentation induced by cAMP protein Fic"
                     /protein_id="YP_004412841.1"
                     /db_xref="GI:330838261"
                     /db_xref="InterPro:IPR003812"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="GeneID:10496619"
                     /translation="MAYKSLKKIYYKKTEDVEAVYQARCQSEAAYHFDIWIKQYKHKT
                     SYPAFLCLTQEMFLLMERIYKSYEVFLYLVNTVPHVILRQFSLLCIVDEVKSTNDIEG
                     VRSTRREIKEILDGGIRKSHRLESIVQKYRGLLSKEKIAFETSHDIRKFYDEFAHEEV
                     IRDDPRNELDGEIFRKDSVDIASPTERTVHQGIFPEARIIEEMEKALAVLHDEKIPVL
                     IRTAVFHYFFAYIHPFYDGNGRTVRFITAYFLGKHLHPLATVRLSVIFKKHQKRYYKL
                     FEETDSELNRAEMTLFVEEFIRFIAESIDDTVRILERKKEQVERYRQQIEEMNLEDAL
                     TKDLYYILLQAALFYGQGITIQELEKVLKRSRATIQKRLDKIPQKDLVKTRKRAIYYK
                     INMLLFKKEKADGGKVNRA"
     misc_feature    459359..460258
                     /locus_tag="Selsp_0409"
                     /note="Fic family protein [Function unknown]; Region:
                     COG3177"
                     /db_xref="CDD:225718"
     misc_feature    <459668..459835
                     /locus_tag="Selsp_0409"
                     /note="Fic/DOC family; Region: Fic; pfam02661"
                     /db_xref="CDD:251453"
     gene            460347..460853
                     /locus_tag="Selsp_0410"
                     /db_xref="GeneID:10496620"
     CDS             460347..460853
                     /locus_tag="Selsp_0410"
                     /note="COGs: COG1853 Conserved protein/domain typically
                     associated with flavoprotein oxygenase DIM6/NTAB family;
                     KEGG: cdl:CDR20291_2028 hypothetical protein;
                     SPTR: Putative uncharacterized protein;
                     IMG reference gene:2504585869;
                     PFAM: Flavin reductase like domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_004412842.1"
                     /db_xref="GI:330838262"
                     /db_xref="InterPro:IPR002563"
                     /db_xref="InterPro:IPR009002"
                     /db_xref="InterPro:IPR012349"
                     /db_xref="GeneID:10496620"
                     /translation="MAFKEIQPQDLQDNVFTLIGKDWFVVCGEKDGKANAMTASWGGM
                     GVLWGKSVVFIFIRPQRYTKEFVDGADGFTLSVLDESKRKVLNYLGTVSGRDEAKIEK
                     VGLTPLSEGGFTYFSEARLALLCRKLYAQEMKPECFIERECDAKWYPEKDYHTMYVAE
                     IEKVLVRD"
     misc_feature    460416..460850
                     /locus_tag="Selsp_0410"
                     /note="Conserved protein/domain typically associated with
                     flavoprotein oxygenases, DIM6/NTAB family [General
                     function prediction only]; Region: COG1853"
                     /db_xref="CDD:224766"
     gene            460872..461600
                     /locus_tag="Selsp_0411"
                     /db_xref="GeneID:10496621"
     CDS             460872..461600
                     /locus_tag="Selsp_0411"
                     /note="COGs: COG0664 cAMP-binding protein - catabolite
                     gene activator and regulatory subunit of cAMP-dependent
                     protein kinase;
                     InterPro IPR000595;
                     KEGG: dds:Ddes_1827 transcriptional regulator, Crp/Fnr
                     family;
                     PFAM: Cyclic nucleotide-binding domain;
                     SMART: Cyclic nucleotide-binding domain;
                     SPTR: Cyclic nucleotide binding domain protein;
                     IMG reference gene:2504585870;
                     PFAM: Cyclic nucleotide-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator, Crp/Fnr family"
                     /protein_id="YP_004412843.1"
                     /db_xref="GI:330838263"
                     /db_xref="InterPro:IPR000595"
                     /db_xref="InterPro:IPR011991"
                     /db_xref="InterPro:IPR012318"
                     /db_xref="InterPro:IPR014710"
                     /db_xref="InterPro:IPR018490"
                     /db_xref="GeneID:10496621"
                     /translation="MRQEIKEQLKGTSLARGMTDDDVEALLASSQVRLVHYKKGEIIF
                     HEGDVPERLFLLVSGAVRILKDTYSGRQIFLGEIRKPGVMFGEVYLFIERHAYDMFTQ
                     ALAATELLEISSRMLTQGAAEDDFGEADDPERAQRVRLQGLLQRNLLRDFARKAYQMN
                     NMLKVLASGSLRGKIARYLMLQPQQAEGKICLPESRESTAIYLAVSRPALSRELSAMQ
                     KEGILAVESRTIHILDREKLEEYL"
     misc_feature    460896..461579
                     /locus_tag="Selsp_0411"
                     /note="cAMP-binding proteins - catabolite gene activator
                     and regulatory subunit of cAMP-dependent protein kinases
                     [Signal transduction mechanisms]; Region: Crp; COG0664"
                     /db_xref="CDD:223736"
     misc_feature    460911..461210
                     /locus_tag="Selsp_0411"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    order(461127..461132,461154..461162)
                     /locus_tag="Selsp_0411"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    461391..461594
                     /locus_tag="Selsp_0411"
                     /note="Crp-like helix-turn-helix domain; Region:
                     HTH_Crp_2; pfam13545"
                     /db_xref="CDD:257864"
     gene            461906..463186
                     /locus_tag="Selsp_0412"
                     /db_xref="GeneID:10496622"
     CDS             461906..463186
                     /locus_tag="Selsp_0412"
                     /note="COGs: COG1055 Na+/H+ antiporter NhaD and related
                     arsenite permease;
                     InterPro IPR004680;
                     KEGG: dae:Dtox_3120 citrate transporter;
                     PFAM: Divalent ion symporter;
                     SPTR: Arsenic transporter family protein;
                     IMG reference gene:2504585871;
                     PFAM: Citrate transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="Citrate transport