GenomeNet

Database: RefSeq
Entry: NC_001326
LinkDB: NC_001326
Original site: NC_001326 
LOCUS       NC_001326              19431 bp    DNA     circular PLN 18-OCT-2006
DEFINITION  Schizosaccharomyces pombe mitochondrion, complete genome.
ACCESSION   NC_001326
VERSION     NC_001326.1  GI:11466037
DBLINK      Project: 127
            BioProject: PRJNA127
KEYWORDS    RefSeq; apocytochrome b; ATPase; cob gene; cox gene; cytochrome b;
            cytochrome oxidase; large ribosomal RNA; mitochondrial genome;
            oxidase; ribosomal DNA; ribosomal RNA; small ribosomal RNA;
            transfer RNA.
SOURCE      mitochondrion Schizosaccharomyces pombe (fission yeast)
  ORGANISM  Schizosaccharomyces pombe
            Eukaryota; Fungi; Dikarya; Ascomycota; Taphrinomycotina;
            Schizosaccharomycetes; Schizosaccharomycetales;
            Schizosaccharomycetaceae; Schizosaccharomyces.
REFERENCE   1  (bases 1 to 19431)
  AUTHORS   Schafer,B., Hansen,M. and Lang,B.F.
  TITLE     Transcription and RNA-processing in fission yeast mitochondria
  JOURNAL   RNA 11 (5), 785-795 (2005)
   PUBMED   15811919
REFERENCE   2  (bases 15954 to 16637)
  AUTHORS   Zimmer,M., Schiebner,T., Krabusch,M. and Wolf,K.
  TITLE     Nucleotide sequence of the unassigned reading frame urf a in the
            mitochondrial genome of three Schizosaccharomyces pombe strains
  JOURNAL   Nucleic Acids Res. 18 (22), 6686 (1990)
   PUBMED   2251129
REFERENCE   3  (bases 3131 to 4580)
  AUTHORS   Trinkl,H., Lang,B.F. and Wolf,K.
  TITLE     Nucleotide sequence of the gene encoding the small ribosomal RNA in
            the mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe
  JOURNAL   Nucleic Acids Res. 17 (16), 6730 (1989)
   PUBMED   2780299
REFERENCE   4  (bases 1 to 2900)
  AUTHORS   Lang,B.F., Cedergren,R. and Gray,M.W.
  TITLE     The mitochondrial genome of the fission yeast, Schizosaccharomyces
            pombe. Sequence of the large-subunit ribosomal RNA gene, comparison
            of potential secondary structure in fungal mitochondrial
            large-subunit rRNAs and evolutionary considerations
  JOURNAL   Eur. J. Biochem. 169 (3), 527-537 (1987)
   PUBMED   2446871
REFERENCE   5  (bases 9973 to 13974)
  AUTHORS   Lang,B.F., Ahne,F. and Bonen,L.
  TITLE     The mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe. The cytochrome b gene has an intron closely related to the
            first two introns in the Saccharomyces cerevisiae cox1 gene
  JOURNAL   J. Mol. Biol. 184 (3), 353-366 (1985)
   PUBMED   4046021
REFERENCE   6  (bases 4666 to 8923)
  AUTHORS   Lang,B.F.
  TITLE     The mitochondrial genome of the fission yeast Schizosaccharomyces
            pombe: highly homologous introns are inserted at the same position
            of the otherwise less conserved cox1 genes in Schizosaccharomyces
            pombe and Aspergillus nidulans
  JOURNAL   EMBO J. 3 (9), 2129-2136 (1984)
   PUBMED   6092057
REFERENCE   7  (bases 14275 to 14508; 15464 to 15629)
  AUTHORS   Lang,B.F., Ahne,F., Distler,S., Trinkl,H., Kaudewitz,F. and Wolf,K.
  JOURNAL   Unpublished
REFERENCE   8  (bases 1 to 19431)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-NOV-2000) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   9  (bases 1 to 19431)
  AUTHORS   Lang,B.F.
  TITLE     Direct Submission
  JOURNAL   Submitted (16-AUG-1990) Lang B.F., Departement de Biochemie,
            Universite de Montreal, C.P. 6128, Montreal, Quebec H3C 3J7, Canada
COMMENT     REVIEWED REFSEQ: This record has been curated by NCBI staff. The
            reference sequence was derived from X54421.
            See <X06597> for overlapping sequence ([2]).
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..19431
                     /organism="Schizosaccharomyces pombe"
                     /organelle="mitochondrion"
                     /mol_type="genomic DNA"
                     /strain="ad7-50h-."
                     /db_xref="taxon:4896"
     exon            <1..5289
                     /number=1
     gene            1..2822
                     /locus_tag="ScpofMr11"
                     /db_xref="GeneID:1669496"
     rRNA            1..2822
                     /locus_tag="ScpofMr11"
                     /product="large subunit"
                     /db_xref="GeneID:1669496"
     misc_difference 2091
                     /locus_tag="ScpofMr11"
                     /note="conflict"
                     /citation=[4]
                     /replace="g"
     gene            2857..2929
                     /locus_tag="ScpofMt13"
                     /db_xref="GeneID:1669497"
     tRNA            2857..2929
                     /locus_tag="ScpofMt13"
                     /product="tRNA-Lys"
                     /note="anticodon=uuu, lys"
                     /db_xref="GeneID:1669497"
     gene            2968..3050
                     /locus_tag="ScpofMt14"
                     /db_xref="GeneID:1669498"
     tRNA            2968..3050
                     /locus_tag="ScpofMt14"
                     /product="tRNA-Ser"
                     /note="anticodon=gcu, ser"
                     /db_xref="GeneID:1669498"
     gene            3060..3130
                     /locus_tag="ScpofMt15"
                     /db_xref="GeneID:1669499"
     tRNA            3060..3130
                     /locus_tag="ScpofMt15"
                     /product="tRNA-Asn"
                     /note="anticodon=guu, asn"
                     /db_xref="GeneID:1669499"
     gene            3131..4552
                     /locus_tag="ScpofMr12"
                     /db_xref="GeneID:1669500"
     rRNA            3131..4552
                     /locus_tag="ScpofMr12"
                     /product="small subunit"
                     /db_xref="GeneID:1669500"
     misc_difference 4102
                     /locus_tag="ScpofMr12"
                     /note="conflict"
                     /citation=[3]
                     /replace="g"
     gene            4591..4665
                     /locus_tag="ScpofMt16"
                     /db_xref="GeneID:1669501"
     tRNA            4591..4665
                     /locus_tag="ScpofMt16"
                     /product="tRNA-Met"
                     /note="anticodon=cau, met"
                     /db_xref="GeneID:1669501"
     gene            4886..8790
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /db_xref="GeneID:1669524"
     CDS             join(4886..5289,6500..6844,7926..8790)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /codon_start=1
                     /transl_table=4
                     /product="cytochrome c oxidase 1"
                     /protein_id="NP_039499.1"
                     /db_xref="GI:11466038"
                     /db_xref="UniProtKB/Swiss-Prot:P07657"
                     /db_xref="GeneID:1669524"
                     /translation="MNSWWTYVNRWIFSTNAKDIAILYLLFGLVSGIIGSVFSFIIRM
                     ELSAPGSQFLSGNGQLYNVAISAHGILMIFFFIIPALFGAFGNYLVPLMIGAPDVAYP
                     RVNNFTFWLLPPALMLLLISALTEEGPGGGWTVYPPLSSITSHSGPAIDLAILSLQLT
                     GISSTLGSVNLIATMINMRAPGLSLYQMPLFAWAIMITSILLLLTLPVLAGGLFMLFS
                     DRNLNTSFYAPEGGGDPVLYQHLFWFFGHPEVYILIMPAFGVVSHIIPSLAHKPIFGK
                     EGMLWAMLSIALLGLMVWSHHLFTVGLDVDTRAYFSAATMVIAIPTGIKIFSWLATLT
                     GGAIQWSRVPMLYAIGFLILFTIGGLTGVILSNSVLDIAFHDTYFVVAHFHYVLSMGA
                     LFGLCGAYYWSPKMFGLMYNETLASIQFWILFIGVNIVFGPQHFLGLNGMPRRIPDYP
                     EAFVGWNFVSSIGSVISILSLFLFMYVMYDQFTSNRVVKTNPYLIPSYFDDNVIFVNE
                     KLGVAQSIEWLLHSPVHEHAFNTLPTKSI"
     misc_feature    join(4898..5289,6500..6844,7926..8781)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Heme/copper-type cytochrome/quinol oxidases,
                     subunit 1 [Energy production and conversion]; Region:
                     CyoB; COG0843"
                     /db_xref="CDD:223913"
     misc_feature    join(4928..5289,6500..6844,7926..8652)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Cytochrome C oxidase subunit I.  Cytochrome c
                     oxidase (CcO), the terminal oxidase in the respiratory
                     chains of eukaryotes and most bacteria, is a multi-chain
                     transmembrane protein located in the inner membrane of
                     mitochondria and the cell membrane of...; Region:
                     Cyt_c_Oxidase_I; cd01663"
                     /db_xref="CDD:238833"
     misc_feature    order(4928..4930,5174..5176,5186..5188,5192..5194,
                     5213..5215,6546..6548,6558..6560,6612..6614,6624..6626,
                     6684..6686,6705..6707,6714..6716,6738..6740,6765..6773,
                     6786..6791,6795..6797,6825..6827,8017..8019,8026..8028,
                     8035..8040,8050..8052)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/III interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(4955..4957,5144..5146,5177..5179,5198..5200,
                     5207..5209,6582..6587,6603..6605,6615..6617)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="D-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(4973..4975,4985..4987,4994..4996,5006..5008,
                     5252..5257,8392..8394,8611..8613,8620..8622)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/VIIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5015..5017,5024..5029,8416..8418,8425..8430,
                     8527..8529,8581..8583)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/IV interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(5069..5071,6795..6797,7987..7989,7996..8001,
                     8074..8082,8089..8091,8098..8100,8122..8124,8146..8148,
                     8155..8157,8176..8184,8221..8223,8275..8280,8284..8286,
                     8290..8304,8491..8496,8506..8514,8539..8544)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/II interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(5087..5089,8329..8331,8341..8343,8464..8466,
                     8575..8577)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Low-spin heme (heme a) binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(5246..5248,5255..5257)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/VIIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6519..6521,6753..6764)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/VIa interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6684..6686,6705..6707,6825..6827,8017..8019,
                     8026..8028,8035..8040,8050..8052)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Dimer interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6795..6797,6810..6815,8287..8289,8299..8304,
                     8506..8508)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(6834..6836,8062..8067,8323..8325)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Binuclear center (heme a3/CuB) [ion binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(6834..6836,7927..7929,7960..7962,8062..8067,
                     8140..8142,8149..8151)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="K-pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(7990..7992,8002..8004)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/Vb interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238833"
     misc_feature    order(8065..8067,8299..8304,8506..8511)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    8080..8082
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/VIb interface; other site"
                     /db_xref="CDD:238833"
     misc_feature    8179..8181
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/VIc interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(8326..8328,8506..8511)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Electron transfer pathway; other site"
                     /db_xref="CDD:238833"
     misc_feature    order(8419..8421,8590..8592)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/VIIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     misc_feature    order(8527..8529,8539..8541)
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /note="Subunit I/VIIb interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238833"
     intron          5290..6499
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /number=1
     gene            5291..6445
                     /locus_tag="ScpofMp02"
                     /db_xref="GeneID:1669527"
     CDS             5291..6445
                     /locus_tag="ScpofMp02"
                     /note="intronic ORF"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="NP_112417.1"
                     /db_xref="GI:13591825"
                     /db_xref="UniProtKB/Swiss-Prot:P22191"
                     /db_xref="GeneID:1669527"
                     /translation="MKPQTKLSENSSRCEKVLYSEVITQLIYFLTSKKITNLGKIRLV
                     KSIRDSFLSQLENILCFFLVYRTTYSFGVCLMKRFLFNKFFNRHPFTRVKSCFSSSSP
                     SKFSFTQWLVGFTDGDGCFSISKQKIKNGKNKWSLTFKLTQNLYNYRILYFIKRNLGI
                     GSLYKESSTNTVIYRLRRREHLKKIIDIFDQFPLLTKKYWDYYLFKKAFLILEDANLN
                     SFEKNSKLEEIRIEKKSLKQYSPVNLEKYLTKSWLIGFIEAEGSFYLLQKSPVRIIHG
                     FEITQNYEQPLLAQISEFLFNSQISPKIKSKKNSLITNYSLSTSSKERMLFLSSYFEN
                     CFKGVKSLEFKIWSRSLRKNYNFEQLLRARDLIRKLKNKYSRGSQHPKDK"
     misc_feature    5621..5914
                     /locus_tag="ScpofMp02"
                     /note="LAGLIDADG endonuclease; Region: LAGLIDADG_1;
                     pfam00961"
                     /db_xref="CDD:216215"
     exon            6500..6844
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /number=2
     intron          6845..7925
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /number=2
     gene            <6845..7817
                     /locus_tag="ScpofMp03"
                     /db_xref="GeneID:1669528"
     CDS             <6845..7817
                     /locus_tag="ScpofMp03"
                     /note="intronic ORF"
                     /codon_start=2
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="NP_039501.1"
                     /db_xref="GI:11466040"
                     /db_xref="UniProtKB/Swiss-Prot:P22190"
                     /db_xref="GeneID:1669528"
                     /translation="NLIGLLTLLYAGTTWKILDKSFCFKYSKKNTRLVFIFIVKMLKQ
                     LSISAGNLLNKGTSETLRNEITTKKVSIHLPKHLKPANDSQFGHYLAGLIDGDGHFSS
                     KQQLIIAFHSLDIQLAYYIKKQIGYGIVRKIKDKNAILFIIANSKGIERVITLINNKF
                     RTTSKYNQIINNIFAHPRFKEFSKTITLGLNSNNNLNNHWLAGFSDADASFQIKILNR
                     DKKIEVRLNYQIDQKKEYLLSLIKDNLGGNIGYRKSQDTYYYGSTSFGSAKKVINYFD
                     NYHLLSSKYISYLKWRKAYLIIQENKHLTESGLSQIKKPHPYRKNIN"
     misc_feature    7113..7373
                     /locus_tag="ScpofMp03"
                     /note="LAGLIDADG endonuclease; Region: LAGLIDADG_1;
                     pfam00961"
                     /db_xref="CDD:250257"
     misc_feature    7446..7730
                     /locus_tag="ScpofMp03"
                     /note="LAGLIDADG endonuclease; Region: LAGLIDADG_1;
                     pfam00961"
                     /db_xref="CDD:250257"
     exon            7926..>8790
                     /gene="cox1"
                     /locus_tag="ScpofMp01"
                     /number=3
     gene            9818..9894
                     /locus_tag="ScpofMt17"
                     /db_xref="GeneID:1669502"
     tRNA            9818..9894
                     /locus_tag="ScpofMt17"
                     /product="tRNA-Arg"
                     /note="anticodon=ucu, arg"
                     /db_xref="GeneID:1669502"
     gene            9920..9992
                     /locus_tag="ScpofMt18"
                     /db_xref="GeneID:1669503"
     tRNA            9920..9992
                     /locus_tag="ScpofMt18"
                     /product="tRNA-Thr"
                     /note="anticodon=ugu, thr"
                     /db_xref="GeneID:1669503"
     gene            10173..13862
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /db_xref="GeneID:1669523"
     CDS             join(10173..10856,13383..13862)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /codon_start=1
                     /transl_table=4
                     /product="cytochrome b"
                     /protein_id="NP_039502.1"
                     /db_xref="GI:11466041"
                     /db_xref="UniProtKB/Swiss-Prot:P05501"
                     /db_xref="GeneID:1669523"
                     /translation="MKILKSNPFLALANNYMIDAPEPSNISYFWNFGSLLACVLVIQI
                     VIGILLACFYIPNMDLAFLSVERIVRDVNYGFLLRAFHANGASFFFIFLYLHIGRGLY
                     YGSYKYPRTMTWNIGVIIFLLTIITAFLGYCLPANQMSFWGATVITNLLSAVPFIGDD
                     LVHLLWGGFSVSNPTLNRFFSLHYLMPFVIAALSVMHLIALHTNGSSNPLGVTANMDR
                     IPMNPYYLIKDLITIFIFLIGINYMAFYNPYGFMEPDCALPADPLKTPMSIVPEWYLL
                     PFYAILRAIPNFQLGVIAMLLSILVLLLLPLLDFSAIRGNSFNPFGKFFFWTFVADFV
                     ILAWIGGSHPENVFITIGAIATIFYFSYFFILIPVYTILGNTLIDLNLSSIKR"
     misc_feature    10194..10793
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="Cytochrome b (N-terminus)/b6/petB:  Cytochrome b is
                     a subunit of cytochrome bc1, an 11-subunit mitochondrial
                     respiratory enzyme. Cytochrome b spans the mitochondrial
                     membrane with 8 transmembrane helices (A-H) in eukaryotes.
                     In plants and cyanobacteria; Region: Cytochrome_b_N;
                     cd00284"
                     /db_xref="CDD:238176"
     misc_feature    join(10200..10856,13383..13796)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="cytochrome b; Provisional; Region: CYTB; MTH00156"
                     /db_xref="CDD:214440"
     misc_feature    order(10218..10223,10272..10274,10281..10283,10764..10766,
                     10788..10790)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(10221..10226,10236..10244,10260..10265,10272..10277,
                     10284..10286,10356..10358,10401..10403,10410..10415,
                     10422..10427,10431..10436,10440..10445,10452..10454,
                     10473..10490,10500..10505,10512..10517,10524..10526,
                     10533..10538,10566..10568,10578..10598,10608..10613,
                     10635..10637,10791..10793)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(10224..10229,10233..10235,10242..10244,10305..10307,
                     10317..10319,10326..10331,10356..10361,10368..10373,
                     10380..10394,10398..10406,10413..10415,10497..10499,
                     10776..10781)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238176"
     misc_feature    order(10260..10262,10269..10274,10278..10283,10437..10439,
                     10449..10451,10458..10463,10467..10469,10509..10514,
                     10521..10526,10530..10535,10752..10754,10761..10766,
                     10773..10775,10788..10793)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="heme bH binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(10290..10292,10299..10304,10311..10316,10320..10325,
                     10332..10334,10365..10367,10407..10409,10416..10421,
                     10428..10430,10551..10556,10563..10568,10572..10577,
                     10719..10724,10731..10733)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="heme bL binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238176"
     misc_feature    order(10536..10538,10545..10550,10557..10562,10599..10601,
                     10608..10613,10623..10625,10707..10709,10716..10718)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238176"
     misc_feature    order(10794..10802,10806..10832,10839..10847,10851..10856,
                     13389..13391,13398..13403,13410..13412,13419..13424,
                     13431..13436,13440..13442,13458..13460,13467..13472,
                     13632..13637,13650..13655)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="interchain domain interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238179"
     misc_feature    order(10794..10799,10812..10814,10821..10829,10833..10835,
                     10845..10847,10854..10856,13383..13385,13392..13397,
                     13404..13406,13416..13421,13425..13433,13440..13442,
                     13455..13457,13461..13466,13470..13484,13488..13496,
                     13503..13505,13509..13520,13563..13565,13593..13595,
                     13602..13607,13611..13619,13623..13625)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="intrachain domain interface; other site"
                     /db_xref="CDD:238179"
     misc_feature    order(10833..10835,13383..13385)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="Qi binding site; other site"
                     /db_xref="CDD:238179"
     misc_feature    13473..13778
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="Cytochrome b(C-terminal)/b6/petD; Region:
                     Cytochrom_B_C; pfam00032"
                     /db_xref="CDD:249525"
     misc_feature    order(13503..13505,13509..13514,13521..13523,13530..13535,
                     13581..13583)
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /note="Qo binding site; other site"
                     /db_xref="CDD:238179"
     exon            <10173..10856
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /number=1
     intron          10857..13382
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /number=1
     gene            10857..13280
                     /locus_tag="ScpofMp05"
                     /db_xref="GeneID:1669529"
     CDS             10857..13280
                     /locus_tag="ScpofMp05"
                     /note="intronic ORF"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="NP_039503.1"
                     /db_xref="GI:11466042"
                     /db_xref="UniProtKB/Swiss-Prot:P05511"
                     /db_xref="GeneID:1669529"
                     /translation="MRRCGIYVYPHRERDILCVKIWTIHLGSWGNPMPNRACVQKVLP
                     VTKQISSDGSVQIDTVRAVLPEFQFPSHPQIGDCLSWIETFFSRSLVGFYDQGYTPGE
                     ESCTNSTIKGMSGKPTSIISNIYTTTGPAKVSNDYAVRDPGVAVDHFDQYGPLKEGRS
                     LNSAKISTQWSGSATLKSSNRSIFNIGLGYINTFLGVSNVRGFSTGSGRSKNVLNKLD
                     DLSKRSKNYPNLVIDRNLYKDFLLNRDMFLIAYNKLKSNPGMMTHGLKPDTLDGMSID
                     VIDKIIQSLKSEEFNFTPGRRILIDKASGGKRPLTIGSPRDKLVQEILRIVLEAIYEP
                     LFNTASHGFRPGRSCHSALRSIFTNFKGCTWWIEGDIKACFDSIPHDKLIALLSSKIK
                     DQRFIQLIRKALNAGYLTENRYKYDIVGTPQGSIVSPILANIYLHQLDEFIENLKSEF
                     DYKGPIARKRTSESRHLHYLMAKAKRENADSKTIRKIAIEMRNVPNKIHGIQSNKLMY
                     VRYADDWIVAVNGSYTQTKEILAKITCFCSSIGLTVSPTKTKITNSYTDKILFLGTNI
                     SHSKNVTFSRHFGILQRNSGFILLSAPMDRIAKKLRETGLMLNHKGRSVIRWLPLDVR
                     QIIGLANSIIRGYDNYYSFVHNRGRFATYVYFIIKDCVLRTLAHKLSLGTRMKVIKKF
                     GPDLSIYDYNSRDENNKPKLITQLFKPSWKVNVWGFKSDKVKLNIRTLYASHLSMANL
                     ENLQCAACQSTYKVEMHHVRQMKNLKPIKGTLDYLMAKANRKQIPLCRSCHMKLHANK
                     LTLNEDKKV"
     misc_feature    11742..12554
                     /locus_tag="ScpofMp05"
                     /note="RT_G2_intron: Reverse transcriptases (RTs) with
                     group II intron origin. RT transcribes DNA using RNA as
                     template. Proteins in this subfamily are found in
                     bacterial and mitochondrial group II introns. Their most
                     probable ancestor was a retrotransposable...; Region:
                     RT_G2_intron; cd01651"
                     /db_xref="CDD:238828"
     misc_feature    11754..12554
                     /locus_tag="ScpofMp05"
                     /note="Reverse transcriptase (RNA-dependent DNA
                     polymerase); Region: RVT_1; pfam00078"
                     /db_xref="CDD:249567"
     misc_feature    order(11964..11981,12123..12128,12387..12389,12393..12398,
                     12540..12545)
                     /locus_tag="ScpofMp05"
                     /note="putative active site [active]"
                     /db_xref="CDD:238828"
     misc_feature    order(11964..11981,12123..12125,12393..12395)
                     /locus_tag="ScpofMp05"
                     /note="putative NTP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238828"
     misc_feature    12126..12128
                     /locus_tag="ScpofMp05"
                     /note="putative nucleic acid binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238828"
     misc_feature    12609..13043
                     /locus_tag="ScpofMp05"
                     /note="Type II intron maturase; Region: Intron_maturas2;
                     pfam01348"
                     /db_xref="CDD:250552"
     misc_feature    <13086..13241
                     /locus_tag="ScpofMp05"
                     /note="HNH nucleases; HNH endonuclease signature which is
                     found in viral, prokaryotic, and eukaryotic proteins. The
                     alignment includes members of the large group of homing
                     endonucleases, yeast intron 1 protein, MutS, as well as
                     bacterial colicins, pyocins, and...; Region: HNHc;
                     cd00085"
                     /db_xref="CDD:238038"
     misc_feature    order(13119..13121,13125..13133,13155..13157,13194..13199,
                     13215..13220,13227..13229,13239..13241)
                     /locus_tag="ScpofMp05"
                     /note="active site"
                     /db_xref="CDD:238038"
     exon            13383..>13862
                     /gene="cob"
                     /locus_tag="ScpofMp04"
                     /number=2
     gene            14081..14153
                     /locus_tag="ScpofMt19"
                     /db_xref="GeneID:1669504"
     tRNA            14081..14153
                     /locus_tag="ScpofMt19"
                     /product="tRNA-Met"
                     /note="anticodon=cau, fmet"
                     /db_xref="GeneID:1669504"
     gene            14159..14230
                     /locus_tag="ScpofMt20"
                     /db_xref="GeneID:1669505"
     tRNA            14159..14230
                     /locus_tag="ScpofMt20"
                     /product="tRNA-Phe"
                     /note="anticodon=gaa, phe"
                     /db_xref="GeneID:1669505"
     gene            14238..14308
                     /locus_tag="ScpofMt21"
                     /db_xref="GeneID:1669506"
     tRNA            14238..14308
                     /locus_tag="ScpofMt21"
                     /product="tRNA-Asp"
                     /note="anticodon=guc, asp"
                     /db_xref="GeneID:1669506"
     gene            14314..14385
                     /locus_tag="ScpofMt22"
                     /db_xref="GeneID:1669507"
     tRNA            14314..14385
                     /locus_tag="ScpofMt22"
                     /product="tRNA-Gly"
                     /note="anticodon=ucc, gly"
                     /db_xref="GeneID:1669507"
     gene            14394..14476
                     /locus_tag="ScpofMt23"
                     /db_xref="GeneID:1669508"
     tRNA            14394..14476
                     /locus_tag="ScpofMt23"
                     /product="tRNA-Leu"
                     /note="anticodon=uaa, leu"
                     /db_xref="GeneID:1669508"
     gene            14492..14563
                     /locus_tag="ScpofMt24"
                     /db_xref="GeneID:1669509"
     tRNA            14492..14563
                     /locus_tag="ScpofMt24"
                     /product="tRNA-Trp"
                     /note="anticodon=cca, trp"
                     /db_xref="GeneID:1669509"
     gene            14596..14669
                     /locus_tag="ScpofMt25"
                     /db_xref="GeneID:1669510"
     tRNA            14596..14669
                     /locus_tag="ScpofMt25"
                     /product="tRNA-Leu"
                     /note="anticodon=uag, leu"
                     /db_xref="GeneID:1669510"
     gene            14756..15529
                     /locus_tag="ScpofMp06"
                     /db_xref="GeneID:1669530"
     CDS             14756..15529
                     /locus_tag="ScpofMp06"
                     /codon_start=1
                     /transl_table=4
                     /product="ATPase6"
                     /protein_id="NP_039504.1"
                     /db_xref="GI:11466043"
                     /db_xref="UniProtKB/Swiss-Prot:P21535"
                     /db_xref="GeneID:1669530"
                     /translation="MFITSPLEQFELNNYFGFYLFNYHFDFSNFGFYLGLSALIAISL
                     AIINLTPYGSGAKIVPQKFGIAMEAIYFTMLNLVENQIHSSKTVSGQSYFPFIWSLFV
                     LILFSNLLRLIPYGYATTAQLIFTLGLSISILIGATILGLQQHKAKVFGLFLPSGTPT
                     PLIPLLVLIEFVSYIARGLSLGIRLGANIIAGHLTMSILGGLIFTFMGLNLITFIIGF
                     LPITVLVAISLLEFGIAFIQAYVFAILTCGFINDSLNLH"
     misc_feature    14837..15517
                     /locus_tag="ScpofMp06"
                     /note="ATP synthase subunit 6 (eukaryotes),also subunit A
                     (prokaryotes); Region: ATP_synt_6_or_A; TIGR01131"
                     /db_xref="CDD:233283"
     gene            15550..15622
                     /locus_tag="ScpofMt26"
                     /db_xref="GeneID:1669511"
     tRNA            15550..15622
                     /locus_tag="ScpofMt26"
                     /product="tRNA-His"
                     /note="anticodon=gug, his"
                     /db_xref="GeneID:1669511"
     gene            15661..15735
                     /locus_tag="ScpofMt27"
                     /db_xref="GeneID:1669512"
     tRNA            15661..15735
                     /locus_tag="ScpofMt27"
                     /product="tRNA-Pro"
                     /note="anticodon=ugg, pro"
                     /db_xref="GeneID:1669512"
     gene            15747..15819
                     /locus_tag="ScpofMt28"
                     /db_xref="GeneID:1669513"
     tRNA            15747..15819
                     /locus_tag="ScpofMt28"
                     /product="tRNA-Gln"
                     /note="anticodon=uug, gln"
                     /db_xref="GeneID:1669513"
     gene            15954..16637
                     /locus_tag="ScpofMp07"
                     /note="unassigned reading frame a"
                     /db_xref="GeneID:1669526"
     CDS             15954..16637
                     /locus_tag="ScpofMp07"
                     /note="urf a; unassigned reading frame a"
                     /codon_start=1
                     /transl_table=4
                     /product="hypothetical protein"
                     /protein_id="NP_039505.1"
                     /db_xref="GI:11466044"
                     /db_xref="UniProtKB/Swiss-Prot:P21547"
                     /db_xref="GeneID:1669526"
                     /translation="MQKNNLKNLITTIVTNAFFNQKANFSIPLKGVIGEKRPSILIGN
                     ININFKSDSLIEVSFPYYPLLNKNYPNPSIISNIIQKALSNHLLYSSKNYSFIVNIRA
                     LPISTPYGSSLIFSKYIAIIIGSNPKIASTLWIDPKRFINLPKLQSDSIFKILGLNVP
                     KGWKGIHISLNLIKWNSLSSRGRITNIIKGSVPLTNNSNGYDESSLAIYSKMGTIQIK
                     VRLSYSSNL"
     gene            16662..16734
                     /locus_tag="ScpofMt29"
                     /db_xref="GeneID:1669514"
     tRNA            16662..16734
                     /locus_tag="ScpofMt29"
                     /product="tRNA-Ile"
                     /note="anticodon=gau, ile"
                     /db_xref="GeneID:1669514"
     gene            16914..17060
                     /locus_tag="ScpofMp08"
                     /db_xref="GeneID:1669531"
     CDS             16914..17060
                     /locus_tag="ScpofMp08"
                     /codon_start=1
                     /transl_table=4
                     /product="ATPase 8"
                     /protein_id="NP_039506.1"
                     /db_xref="GI:11466045"
                     /db_xref="UniProtKB/Swiss-Prot:P21536"
                     /db_xref="GeneID:1669531"
                     /translation="MPQLVPFYFINILSFGFLIFTVLLYISSVYVLPRYNELFISRSI
                     ISSL"
     misc_feature    16914..17057
                     /locus_tag="ScpofMp08"
                     /note="Fungal ATP synthase protein 8 (A6L); Region:
                     Fun_ATP-synt_8; pfam05933"
                     /db_xref="CDD:253464"
     gene            17082..17150
                     /locus_tag="ScpofMt30"
                     /db_xref="GeneID:1669515"
     tRNA            17082..17150
                     /locus_tag="ScpofMt30"
                     /product="tRNA-Cys"
                     /note="anticodon=gca, cys"
                     /db_xref="GeneID:1669515"
     gene            17166..17238
                     /locus_tag="ScpofMt31"
                     /db_xref="GeneID:1669516"
     tRNA            17166..17238
                     /locus_tag="ScpofMt31"
                     /product="tRNA-Val"
                     /note="anticodon=uac, val"
                     /db_xref="GeneID:1669516"
     gene            17257..17342
                     /locus_tag="ScpofMt32"
                     /db_xref="GeneID:1669517"
     tRNA            17257..17342
                     /locus_tag="ScpofMt32"
                     /product="tRNA-Tyr"
                     /note="anticodon=gua, tyr"
                     /db_xref="GeneID:1669517"
     gene            17460..17532
                     /locus_tag="ScpofMt33"
                     /db_xref="GeneID:1669518"
     tRNA            17460..17532
                     /locus_tag="ScpofMt33"
                     /product="tRNA-Arg"
                     /note="anticodon=ucg, arg"
                     /db_xref="GeneID:1669518"
     gene            17542..17613
                     /locus_tag="ScpofMt34"
                     /db_xref="GeneID:1669519"
     tRNA            17542..17613
                     /locus_tag="ScpofMt34"
                     /product="tRNA-Ile"
                     /note="anticodon=cau, ile"
                     /db_xref="GeneID:1669519"
     gene            17635..17716
                     /locus_tag="ScpofMt35"
                     /db_xref="GeneID:1669520"
     tRNA            17635..17716
                     /locus_tag="ScpofMt35"
                     /product="tRNA-Ser"
                     /note="anticodon=uga, ser"
                     /db_xref="GeneID:1669520"
     gene            17806..18030
                     /locus_tag="ScpofMp09"
                     /db_xref="GeneID:1669532"
     CDS             17806..18030
                     /locus_tag="ScpofMp09"
                     /codon_start=1
                     /transl_table=4
                     /product="ATPase 9"
                     /protein_id="NP_039507.1"
                     /db_xref="GI:11466046"
                     /db_xref="UniProtKB/Swiss-Prot:P21537"
                     /db_xref="GeneID:1669532"
                     /translation="MIQAAKYIGAGLATIGVSGAGVGIGLIFSNLISGTSRNPSVRPH
                     LFSMAILGFALTEATGLFCLMLAFLIIYAA"
     misc_feature    17806..18024
                     /locus_tag="ScpofMp09"
                     /note="ATP synthase subunit C; Region: ATP-synt_C;
                     cl00466"
                     /db_xref="CDD:260442"
     gene            18057..18129
                     /locus_tag="ScpofMt36"
                     /db_xref="GeneID:1669521"
     tRNA            18057..18129
                     /locus_tag="ScpofMt36"
                     /product="tRNA-Ala"
                     /note="anticodon=ugc, ala"
                     /db_xref="GeneID:1669521"
     gene            18130..18403
                     /gene="RnpB"
                     /locus_tag="ScpofMr38"
                     /db_xref="GeneID:4397541"
     misc_RNA        18130..18403
                     /gene="RnpB"
                     /locus_tag="ScpofMr38"
                     /product="RNase P"
                     /db_xref="GeneID:4397541"
     gene            18404..18475
                     /locus_tag="ScpofMt37"
                     /db_xref="GeneID:1669522"
     tRNA            18404..18475
                     /locus_tag="ScpofMt37"
                     /product="tRNA-Glu"
                     /note="anticodon=uuc, glu"
                     /db_xref="GeneID:1669522"
     gene            18561..19307
                     /gene="cox2"
                     /locus_tag="ScpofMp10"
                     /db_xref="GeneID:1669525"
     CDS             18561..19307
                     /gene="cox2"
                     /locus_tag="ScpofMp10"
                     /codon_start=1
                     /transl_table=4
                     /product="cytochrome c oxidase 2"
                     /protein_id="NP_039508.1"
                     /db_xref="GI:11466047"
                     /db_xref="UniProtKB/Swiss-Prot:P21534"
                     /db_xref="GeneID:1669525"
                     /translation="MLFFNSILNDAPSSWALYFQDGASPSYLGVTHLNDYLMFYLTFI
                     FIGVIYAICKAVIEYNYNSHPIAAKYTTHGSIVEFIWTLIPALILILVALPSFKLLYL
                     LDEVQKPSMTVKAIGRQWFWSYELNDFVTNENEPVSFDSYMVPEEDLEEGSLRQLEVD
                     NRLVLPIDTRIRLILTSGDVIHSWAVPSLGIKCDCIPSRLNQVSLSIDREGLFYGQCS
                     ELCGVLHSSMPIVVQGVSLEDFLAWLEENS"
     misc_feature    18591..18857
                     /gene="cox2"
                     /locus_tag="ScpofMp10"
                     /note="Cytochrome C oxidase subunit II, transmembrane
                     domain; Region: COX2_TM; pfam02790"
                     /db_xref="CDD:202397"
     misc_feature    18597..19304
                     /gene="cox2"
                     /locus_tag="ScpofMp10"
                     /note="cytochrome c oxidase subunit II; Provisional;
                     Region: COX2; MTH00154"
                     /db_xref="CDD:177211"
     misc_feature    18891..19265
                     /gene="cox2"
                     /locus_tag="ScpofMp10"
                     /note="Cytochrome C oxidase subunit II, periplasmic
                     domain; Region: COX2; pfam00116"
                     /db_xref="CDD:201014"
ORIGIN      
        1 aatgtgtaat ttgaatcaat ttctatcctt ttaaaaatac atcataaagt gtactttttt
       61 aaggatttag ttattaaagg attaattatg gattgctaac cagttaatat taagaggaag
      121 cttttaaagc ttaattcagc aattttttaa ttgttgtttc tcctaaaggt aaaccactaa
      181 aaagaaagaa cttcgggttt ttctttaaaa taaactagag gaactgaatc atcttagtac
      241 tctaaggaaa ataaaataac aatgattatt gtagtagtgg cgaacgaatc attaatagtc
      301 taacttataa aaatattaaa aaaaattttt accaaagaag agaaaaatgg gttcttcatt
      361 tttaataagt aataagtaat aaagtaaaat gggaacttaa cctgtttgaa tattggagaa
      421 ccaatctcca aagactaaat atattaactg agtgatagtg aagagtaccg taagggaaag
      481 caatgaaata gttaatctat aagcgaagat agtgaatttt aaataaatta ttatcttgta
      541 ccttttgcat aatgggtcag caagttttaa ttatttgcaa gctgaaaagc cataaagtaa
      601 ataattaaag acccgaaacc tgacgatctt accatgaaca gattttaagg atcgaaccag
      661 taatcgttgc aaagattttg gatgatttgt ggtaaggggt gaaatgctaa tcgagttagg
      721 tgatagctgg ttgtccacga aaccatttta agatgggcac ttcaaaaact aaatgaggta
      781 cagaaattta ttgccttcaa gaagtttttt cttgttaata ggggatctaa agatttacct
      841 aaggcgttaa ttaatctcgg aataaattta aaaaagtttg aagtagttag acaattggcg
      901 ataaggtcaa tagtcaaaag agaaacagct cagatcaaag atttaaagtt ccccaattta
      961 agttaagtga tttaaagata gtcttactcc ttattcaata agaatatggg cttggaaaca
     1021 gccattatct aaggagtacg taatagttca cttatccaaa aaaaataata ttttctggag
     1081 aaaggcatca aaaatttaac ggatcttaaa cttaatactt aaactttggc agtattttaa
     1141 aaatactggg tagtggaccg atctatataa agatgaagat gaacttttaa gtttattgga
     1201 tttattagat gcgagaatgc tgacataagt aacgtaaaaa aaggtcaaat tccttttcac
     1261 cgaaaactga agggttttga cttaaaaagc ttagcttaag tcaaataaag taacaatctc
     1321 taagctaata aatagtgatg agtaaatctt aacggatctt aaaataaaag ttttattgaa
     1381 tagaaatttt tattcaggaa aattatccgt tattttaatt gtaccctaaa ccgacactgg
     1441 tcagttaaga gaatatctta aggtgttgag agaactatgc ttaaggaact cggcaaatta
     1501 gctctgttac ttcggtataa agagtgttca ttattttatg aactcaataa agagaaccct
     1561 acaactgttt acttaaaaca cagcacattg ccaaaattaa aaaattatag tataatgtgt
     1621 gaggtctgct caatgtccta tggttaacaa tacgaacttt aacgagtttt acggaaccca
     1681 ggataaatag cggctttaac tctgagggtc ctaaggtagc gaaattcctt gtccgataaa
     1741 tacggtcccg catgaatgac ttaatgatag ggttgctgtc tcaagcacag actcagtgaa
     1801 attgtaattg ctgtgaagat acagtgttcc ctcagctaga cggaaagacc ctggcagctt
     1861 tacgatagtt aattattgat taaagaaaaa atcatccaaa aggtgatctc ttctttctcg
     1921 ctttatctat ttttgttcag tatagaggtt agtcgtttag acaaaaatga gatatcctcc
     1981 ttaaataata aagatcttta aagtttaaac ttgacattaa ttaattgatc gtttctgtgg
     2041 ggcgcaggcc tcataaaaaa taactgaggt atcctagatc tatataattt atctagaaat
     2101 caaagtatcc agaaacattt tttaagtgtt tcttaattaa agatacatga cgcatataag
     2161 cataaatagg ttaaactgaa agactaacaa gtcgcacaga tatgtaaata gggttaaatg
     2221 atccacattg aaacactaat ttagtgtttg tatggaaaac aatgtgctca atgagcgaag
     2281 ttacgccagg gataacaggt taatagagag ctaaagtaca aatcaaattc tctgtttgac
     2341 acctcgatgt cgactcaacc tatctccggt tgtagcagat tggaagggtt agactgttcg
     2401 tctatttaaa aggttacgtg agttgggtta aatccgtcgt aagacaggat ggttcctatc
     2461 tactgaggga aaaataagca aattaaaatt tatcttttgt acgcaaggat ttagataatt
     2521 caatctctag tttaactatt gttacttaaa taaaagtact ttattcaaaa gttaaaaatt
     2581 aagtagcacg gtagtaaagc caaattgaac aaattaaaaa ctgaaagcat ctcaagtttg
     2641 aaatttattt aaagagctta tattaagaaa gtagaaaact ttccaaaagg acatccttag
     2701 gatgtacaaa tccttatttt agtaaatcat tgtttagata gatttagtta attttttaac
     2761 caaagggatt atctctttgc taatttttta aataactgga aattgcctaa ttacacaatt
     2821 ttttttacca tttttttgat gagggtattg tttaaagggg atgtagctca atggttagag
     2881 ctttcgcctt ttaagcgata ggataagggt tcaaatccct tcagacccat aaataaaaga
     2941 actaacttct cataaaagtg agttaaagga aaaatagttc taattggtaa gaaggatact
     3001 tgctacgtat ctggtgaata accttgtgag ttcgagtctc actttttccg taaatatttg
     3061 ttgttgtagc tcaatggtag agcaagtcac tgttaatgac ctgatagtgg ttcgattcca
     3121 ctcaataacg ataaaaatat atataatgag tttgatgtta gctcggttat aacgctatct
     3181 agagatttta acacatgcaa atcgaacgaa tcaacaaaaa caatacatcc tttaggggat
     3241 gtttgtgttt ttttgtgacg tggtgaacag gtgagtaaaa gggaagaacg gaccttaaat
     3301 ttcggctaaa ttccgaataa acacactctt ttggagtgtt gtgaaagaag tgaaaacttt
     3361 gatttaagac tggcttctta cgattaaagt agttggagag gtaaaagctt aacaagctca
     3421 aatcgtaatc atgacactaa gtggtgctct gatcacattg gctctgagac aacagccaag
     3481 atgaacattt agttcatcca gcagtggaga atattagtca atgatcgaaa gattgaacta
     3541 gtcatctaga agagtgaaac ttttagttat agctccttaa attaagaaaa tttgattctt
     3601 aattttatgt aattcttgcc aatttccgtg ccagcagcag cggttatacg gatagaataa
     3661 gcgtttaaca taataaaaag gcctaaaaag tatgtagatg gaaaaaaaca aatctttttc
     3721 tagagtaata aagatgtttg tagtattgtc aaataaggga tcaaatccga caatcttgat
     3781 gagactgctt aagtaaaaac tacttacaat taattactga cattgagata cgaaggctta
     3841 gatcgcgaaa gagattagat acctctgtag tctaagctgt aaacgattat tgctctccca
     3901 atctttttga ttgggtttag tgaagacggt aagcaatatg cctggggagt actttcgcaa
     3961 gattgaaacc caaaacatta gacggtcttg gaaatccgca gtgaatcatg ttatttaatt
     4021 agataatccg ctaaaaatct tacctttcct taaaacaatt agttttaatt gttgggtatt
     4081 gcatggctgt ctttagttaa tctcgtaaga tgaggttaat tcccattaat taacgaaagc
     4141 cttcaaagaa tttgtttttc tttgtgttag tgataagcta actttttaga gggttaagac
     4201 aagtcaatat gatccttatg gaaagggcta tagacgtgat ataaaatcta atccaataat
     4261 ttttaatatc gaaagattga agtattatta taatggttag gagatttatt cagatttaaa
     4321 tctgtaattt gatttaatga aggaggaatt gcgagtaatc actaatcatt acgtagtggt
     4381 gaaatttatc tctgagatgt actaactact cgtcaagcgc tgaaagtatt aatctcttga
     4441 agaagacatt catttgtttt cccaaggtgt tgtgcaatta gtgttaagtc gaaataaggt
     4501 aaccgtagtg gaagttgcgg ttgaactaat taattcaggt taaccccccc ccaaaaaata
     4561 aaatacatcc atatcaaaaa gatgttaatt gttggtatag tttaattggt taaaataatc
     4621 tcctcatgtg agattgatct ataggttcga gcccttttac caacttttcc ttaaccacat
     4681 ctgtttaagt caaaaaatct taaatggtag gaaaccttta aacaaagttt aaaaaagtta
     4741 ttaaataatc ttaatgatct tttcatctac cctaaaaata ttgaatcctt ttaaaatagt
     4801 ttaataaatt agcttttgga tgaaaactaa aaattttttt ttaacttaaa cttatttaga
     4861 aattaataat ttagtcttga gtttaatgaa ctcttggtgg acttatgtta atagatggat
     4921 attctcaact aatgctaagg atattgccat actatattta ttattcggat tggtatctgg
     4981 gataattgga tctgtattct cttttataat tagaatggaa ctatcagctc caggatctca
     5041 attcctttct ggaaatggtc aattatacaa tgttgcaatc tcagcacatg gtatacttat
     5101 gatttttttc ttcattattc ctgctttatt tggtgcattt ggtaattatt tagtacctct
     5161 tatgataggt gctccagatg ttgcttaccc tagagtaaat aatttcacat tctggttact
     5221 acctcctgct ctaatgctat tattaatttc tgcattaaca gaagaaggac ctggtggtgg
     5281 ttggacggtt ttaaagccgc agacaaaatt gtctgaaaac tcttctcgat gcgaaaaagt
     5341 cctctactcg gaagtaatta ctcagttaat ttatttttta actagtaaaa agattactaa
     5401 cttggggaaa attcgcctgg ttaaatccat cagagactcg tttctatcac aattagaaaa
     5461 tattttatgt ttctttttgg tttatagaac aacatactct ttcggagtgt gtttaatgaa
     5521 gaggttctta tttaataaat tttttaatag acatcctttt acaagggtaa aaagctgttt
     5581 ttcatcatct tcaccatcaa aattctcttt tactcaatgg ttagtaggat ttactgatgg
     5641 tgatggttgt tttagtattt caaaacaaaa aataaaaaat ggcaaaaata aatggtctct
     5701 tacttttaaa ttaacacaaa atctttataa ttatagaatt ttatatttta ttaagagaaa
     5761 tttaggtatt ggttcacttt ataaagaatc ttcaactaat acagtaatat atagattaag
     5821 aagaagagag catcttaaaa agattataga tatttttgat caattccctc ttttaactaa
     5881 aaaatattgg gattattatt tgtttaaaaa agcattctta attttagagg acgctaatct
     5941 aaattctttt gaaaaaaata gtaaactaga agagatcaga atagagaaaa agtctttaaa
     6001 acaatattct ccagttaatt tagaaaaata tttaacaaag tcttggttaa ttggatttat
     6061 tgaagcagaa gggagctttt atttactaca aaaaagccct gtaagaataa ttcatgggtt
     6121 tgagattact caaaattatg aacaacccct acttgctcag atttcagagt tcctatttaa
     6181 ttctcaaatc tcaccaaaaa taaaatcaaa aaaaaattcc ttaattacaa attattcctt
     6241 atcaactagt tcaaaagaaa gaatgttatt tctttcatct tattttgaaa attgttttaa
     6301 aggagtaaaa tcattagaat ttaaaatttg gtctagatct ttacgtaaaa attataattt
     6361 tgaacagctt ttaagagcta gagatttaat tagaaaatta aaaaataaat attcccgagg
     6421 atcacaacat ccaaaggata aataaaataa gttcaaggta tagtccgatc aagattgaga
     6481 aatcttgtta actaaaatga tatccaccac tatcaagtat cacttctcat agtggtccag
     6541 ctattgatct agctatttta agtttacaat taactggtat ttcatcaaca ttaggatcag
     6601 taaatttaat agcgacaatg attaatatga gagctccagg attaagttta tatcaaatgc
     6661 cattatttgc atgggctata atgattacat caattctatt actgcttact ttaccagttt
     6721 tagcaggtgg attatttatg ttattctcag atagaaattt aaatacttca ttctatgctc
     6781 ctgaaggtgg tggtgaccct gtactttacc aacatttatt ctggttcttt ggtcatccag
     6841 aggtcaattt aataggcctc ttaacgttgc tatatgctgg aactacttga aaaatactag
     6901 ataagagttt ttgttttaaa tactccaaga aaaacaccag attagtgttt atttttatag
     6961 taaaaatgtt aaaacaatta agtatatcag caggtaacct tttgaataag ggaacctcag
     7021 agactttacg caacgaaatc acaacaaaaa aagtttctat tcatctccct aaacacttaa
     7081 aaccagctaa tgattctcaa tttggtcact atttagcagg tttaattgat ggtgatggtc
     7141 attttagtag taaacaacaa ttaattattg cttttcactc tttagatata caattagctt
     7201 attatattaa aaaacaaata ggttatggta ttgtacgtaa aattaaagat aaaaatgcta
     7261 ttctttttat aatagctaac tctaaaggaa ttgaaagagt aataacttta attaataata
     7321 aatttagaac tactagtaaa tataatcaga ttattaataa tatatttgct catcctagat
     7381 ttaaagaatt tagtaaaact attactttag gtttaaattc aaataataat ttaaataatc
     7441 attggctagc tggattctca gatgctgatg ctagttttca gattaaaatt ttaaataggg
     7501 acaaaaaaat agaagttcga ttgaactatc aaatagatca aaaaaaagag tatcttttga
     7561 gtttaattaa agataattta ggtggtaata taggctatcg aaaaagtcaa gatacttatt
     7621 attatggttc tactagtttt ggttcagcta aaaaagttat taattatttt gataattatc
     7681 atttgctatc ttctaaatat attagctatt taaaatgaag aaaagcttat cttattattc
     7741 aagaaaataa acatttaaca gaatcaggac tttctcaaat aaaaaaacct catccctatc
     7801 ggaagaatat taattagatt tgttgagatt taaaataaag tcctaacaag ggtataaagc
     7861 ttttgagtgt taaaaagaat aaatcacctt ttgggtgatt ttttttcatt aaccaaaatt
     7921 tattgttata ttttaattat gccagctttc ggtgttgtta gtcacattat tcctagttta
     7981 gctcataaac ctattttcgg taaagaaggt atgctttggg ctatgttaag tattgcttta
     8041 ttaggattaa tggtatggtc tcatcactta ttcacagttg gtttagatgt tgatactaga
     8101 gcttatttca gtgctgcaac tatggttatt gcaattccaa caggtattaa aatcttcagt
     8161 tggttagcta ctttaacagg tggtgcaata caatggtcaa gagtacctat gttatatgct
     8221 attggtttct taatcttatt cacaattggt ggattaacag gtgttatatt aagtaattca
     8281 gtattagata tcgctttcca tgatacttat ttcgttgtag ctcacttcca ttacgttctg
     8341 tcaatgggtg cattatttgg tctttgtggt gcatactatt ggagtccaaa aatgtttgga
     8401 ttaatgtaca atgaaactct agcttcaatc caattctgga ttttattcat aggtgttaat
     8461 attgtattcg gtcctcaaca tttcttagga ttaaatggta tgcctagaag aataccagat
     8521 tatccagagg catttgtggg atggaatttt gtatcaagta ttggttcagt aatttctatt
     8581 ctttcattat tcctatttat gtatgttatg tatgatcaat ttacatcaaa tagagtggtt
     8641 aaaacaaatc cttatttaat ccctagctat tttgatgata atgtaatctt cgtaaatgaa
     8701 aaattagggg tagctcaatc aatagaatgg ttactacatt caccagtaca cgaacacgca
     8761 tttaatacat tacctacaaa aagtatttaa tttaaaatct taacccccct tttattttat
     8821 aaactttatt ccaatttaaa aattggagag ggagattgaa ggataattta gctatcctat
     8881 tcaaaattgt atctttataa tttttttatt ccttatatgt gagagaacac tattgagata
     8941 aactaattta gcttaaacat gaatctttct actaaatttc aaggacatcc ttatcatatt
     9001 gtaagtgcgt caccttggcc atttttctta tctgtagtat tattctttaa ctgtttagca
     9061 gctacattat atttacatgg atacaaacat tcatcagtat tctttggaat cagtttctta
     9121 ggtttattag caactatgta tttatggttt agagatatgt caactgaagc taatattcat
     9181 ggtgcacata caaaagcagt aacaaaagga ttaaaaatag gatttatgtt attcctaatt
     9241 tctgaaactt tcttatttgc ttctattttc tgggctttct tccatagttc attatcacct
     9301 acttttgaat taggtgcagt atggccacca gtaggaatag cagataaaac aatagatcca
     9361 ttagaagtcc ctctattaaa tacagtaatt ttattaactt ctggtgctag tttaacttat
     9421 gctcattatt cattaattgc tagaaataga gaaaatgctt taaaaggttt atatatgact
     9481 atcgctttat cattcttatt cttaggaggt caagcttatg aatactggaa tgctccattc
     9541 actatttcag attctgttta tggtgctagt ttctattttg ctactggtct tcatggtatt
     9601 catattattg ttggtacaat tctacttctt gttgctactt ataatattta tacttaccac
     9661 ttaactaata ctcatcataa tggatttgaa tgtggtattt attattggca tttctgtgat
     9721 gttgtttggt tattccttta tttaactatt tatatttggg gtagctaagg cttacttcaa
     9781 tttttccccc ctttttatat cttatttctc taaaatagtc tgtatagctc aatggtagag
     9841 catctcactt ctaatgagtc gatctaagtt cgattcttag tacagattcc acacctagaa
     9901 ggtgtgtatt ttttttttag ctaatttaac tcaattggta gagtgcgtac cttgtaagta
     9961 cgaagttaga ggttcaattc ctctaattag caatcccttt cccatatttt tggtataaga
    10021 ggatctcaga tagtatctaa cctatcttat cttttattat ccaatatcct tttaataaga
    10081 tttggatctt ttttcccaat tccttcaaat ttttgactat ttatcgataa tgattgttca
    10141 atttagaagg gataatttca aatttaattt ttatgaaaat tttaaaatct aatccttttt
    10201 tagctttggc taataattat atgattgatg ctcctgaacc ttcaaatatt tcatacttct
    10261 ggaattttgg ttctctttta gcttgtgtat tagttattca aattgtaatc ggtatacttt
    10321 tagcttgttt ttatattcct aatatggatt tagctttcct ttcagttgaa agaattgtta
    10381 gagatgtaaa ttatggtttc ttattaagag ctttccatgc aaatggtgct agtttcttct
    10441 ttatcttctt atacttacac ataggtagag gtttatatta tggttcttat aaatatccaa
    10501 gaacaatgac atggaatatt ggtgttatta tcttcttatt aactattatt actgcctttt
    10561 taggttactg tttaccagct aatcaaatgt cattctgggg tgcaactgtt attactaatt
    10621 tattatcagc tgttcctttc attggtgatg atttagttca tctattatgg ggtggattta
    10681 gtgtatctaa tcctacttta aatagattct tctcacttca ctatttaatg ccttttgtta
    10741 ttgctgcttt atcagtaatg catttaattg ctctacatac taatggttca tcaaatccat
    10801 taggtgtaac agctaatatg gacagaatcc caatgaaccc gtattatctg ataaaattgc
    10861 gccgttgtgg tatatatgtg taccctcata gagaaaggga tatcttgtgt gtaaagatat
    10921 gaacaataca cttaggtagc tggggaaacc caatgccgaa cagagcatgt gtacagaagg
    10981 tccttcctgt aacgaaacag ataagttcag atggatcagt tcaaatagat acggttagag
    11041 ctgtattgcc cgaattccaa ttcccatctc accctcagat aggtgattgt cttagctgaa
    11101 tagagacatt cttctctaga tctttggttg gcttttatga ccaaggatac acaccaggag
    11161 aagagagttg taccaatagt acaattaagg gaatgagtgg aaaacctacg tctatcatct
    11221 caaacatata tacaactacg ggtcccgcta aggtcagtaa tgactatgcg gtcagagatc
    11281 ctggagtagc tgttgatcat tttgatcaat acggtccttt gaaagaggga agaagtttga
    11341 actctgcaaa gatttcaaca cagtgaagtg gatcagctac attaaagtct tccaatagat
    11401 caatatttaa tattggttta ggatacatta atactttttt aggggtatct aatgtaagag
    11461 gatttagtac aggatcagga cgatcaaaaa atgtactaaa taaactagac gatttatcta
    11521 aacgatcaaa aaattatcct aatcttgtaa ttgatagaaa tctctacaaa gatttcctat
    11581 taaatcgaga tatgttcctt attgcttata ataaattaaa atctaatcct ggtatgatga
    11641 ctcatggtct taaaccggat actttagatg gaatgtctat agatgttatt gataaaatta
    11701 tccaaagcct taaatctgaa gaatttaact tcactcctgg tagacgtatc ttaattgata
    11761 aagccagtgg tggaaaaaga ccattaacaa ttggtagtcc tcgagacaaa ttagttcaag
    11821 aaattcttag aatagtcctt gaggctatct atgaaccatt atttaatact gcttctcatg
    11881 gatttagacc aggtcgaagt tgtcattctg ctcttagatc tattttcact aattttaaag
    11941 gttgtacttg gtggattgaa ggagatatta aagcttgttt tgattctatc cctcatgata
    12001 aattaattgc tctattatct tctaaaatta aagatcaacg atttattcaa ttaattcgta
    12061 aagctttaaa tgctggatat ctaactgaaa atagatataa atacgatatt gttggaactc
    12121 ctcaaggttc tatagttagt cctatcttag caaatatcta ccttcatcaa ttggatgaat
    12181 ttattgaaaa cctaaaatca gaatttgatt acaaaggtcc aatagctcgt aaaagaactt
    12241 ctgaatctag acatcttcat tatctaatgg caaaagccaa aagagaaaat gctgattcaa
    12301 aaacaattag aaaaatagcg attgaaatgc gtaatgttcc taataagata catggtattc
    12361 aatctaataa actaatgtat gttcgatacg ctgatgattg gatagttgca gttaatggaa
    12421 gttatactca aactaaagag attttagcta aaattacctg tttctgttca tcaattggac
    12481 taacagtatc tccaactaag actaaaataa ctaattcata tacggataaa atacttttcc
    12541 ttggtactaa tattagccat tctaaaaatg ttacctttag tagacatttt ggtatacttc
    12601 aaagaaattc tgggtttatt ttactttctg ctcctatgga tcgaattgca aaaaaactta
    12661 gagaaactgg acttatgctt aatcataaag gtagatctgt tattagatgg ttacctcttg
    12721 atgtacgaca aattattggt ttagcgaatt ctattattag aggttacgat aattattatt
    12781 cttttgttca taatagagga agatttgcta cttacgttta cttcataatt aaagactgtg
    12841 ttcttcgaac attagctcat aaattatcat taggtactag aatgaaagta attaaaaaat
    12901 ttggtcctga cctttctatc tatgattaca actctagaga tgaaaataat aaaccaaaat
    12961 taattaccca attatttaaa ccttcttgga aagttaatgt ttggggattt aaatctgaca
    13021 aagttaaatt gaacattaga acactttatg cttctcactt atcaatggct aacttagaaa
    13081 atctacagtg tgctgcttgt caaagtactt ataaagtgga aatgcatcat gttagacaga
    13141 tgaaaaatct taaaccaatc aaaggtactt tagattactt aatggcaaaa gcaaacagaa
    13201 aacaaattcc attatgtaga tcttgtcaca tgaaacttca tgctaataag ttaactctta
    13261 atgaggataa aaaagtttag atatcttaaa tgtagtggag agccgtataa ttacgaaagt
    13321 atcccgtacg gttcggtgac gagccgtgtc aaccctgcaa agggaatgcg tcttagttca
    13381 atgatttgat aacaatattt atcttcttaa tcggtataaa ttatatggca ttctataatc
    13441 catatggatt tatggaacca gattgtgctt taccagcgga tcctctaaaa actccaatgt
    13501 ctattgttcc agaatggtat ttattacctt tctatgctat tttaagagct atacctaact
    13561 tccaattagg agttatagca atgttattat caatcttagt attactatta ttaccattat
    13621 tagatttctc agctattaga ggtaatagtt ttaacccatt tggtaaattc ttcttctgga
    13681 catttgttgc cgattttgta attcttgcat ggattggtgg atcacatcca gaaaacgtct
    13741 ttatcacaat cggtgctatt gctacaatct tctattttag ctacttcttt attttaatac
    13801 cagtatatac tatattaggt aatacattaa ttgatttaaa tttaagctca attaaacgat
    13861 aatctcttcc ccctttacac tatataaaaa tatcttattt aaacagtata atatttaata
    13921 aaaagctcat caaaaggtat gaataaaagt tttttacata gattaggtaa taaaacattc
    13981 tttgggtgtt agtagtgatt agaagaagtt gatcttttag ggatttattt ttatcagaat
    14041 ttttacggtc aatttttatc taattaaatg tgaataagtt tgcgatttaa tgtaattggt
    14101 taacatctct gactcatgat cagtgtatta aggttcaagt ccttaggtcg cactttatgc
    14161 tctgataact taacggttaa agtgcagtat tgaagctgct gagatattgg ttcgattcca
    14221 tttcagagca aataaaagaa tctgtagctt aaagtaaagt atcgccttgt cacggtgatg
    14281 gatgcccact cgtactgggt cagattcgtt taagcagata taagtcaatt ggcagacctt
    14341 ctgatttcca cttagattat gttcgttcga atcggactat ctgcattaaa taagcctaaa
    14401 tgctggaatt tggtagacag aacaaactta agatttgtcg ctttcgagcg tgttggttcg
    14461 agtccaactt taggtataac taaaaaaaaa aaagagtata gtttaattgg taaaacttct
    14521 gattccaaat tagacattgt tcgttcaagt cggactgctc ttgatttttt attctttgat
    14581 ctgttaggga agtatgcaga tgtgatgaaa ttggtaaaca tgtttacctt aggagtaaaa
    14641 tcttgaaggt tcgaatcctt ccatctgtag gataaaaaat ctctaaaaga tttttcttag
    14701 ttaaaatctt aattgattac taaaaatact ctacaaaatt tttatatttt tttaaatgtt
    14761 tattacaagt cctttagaac aattcgaatt aaataattat ttcggtttct atctttttaa
    14821 ttaccatttt gatttctcta attttggttt ctatttaggt ttaagtgcat taattgctat
    14881 ttcattagca ataataaatt taacaccata tggatcagga gctaaaatag tacctcaaaa
    14941 atttggtata gcaatggaag ctatttattt tactatgtta aatttagttg aaaatcaaat
    15001 tcatagttca aaaactgtat caggacaaag ctatttccca ttcatttgga gtttatttgt
    15061 tttaatctta ttttctaatt tacttaggtt aattccttat ggttatgcta ctactgctca
    15121 attaatcttt actttaggtt taagtatttc tattttaatt ggtgctacta ttttaggatt
    15181 acaacaacat aaagctaaag tctttggatt attcttacct tctggtactc ctactccttt
    15241 aattcctctt ttagttttaa ttgaattcgt ttcttatatt gctagaggtt taagtttagg
    15301 tattcgatta ggtgctaata ttatagcagg tcatttaaca atgtcaattt taggaggttt
    15361 aatctttact ttcatgggat taaatcttat tacttttatt attggtttct tacctattac
    15421 agttttagtc gctatctctt tattagaatt tggtattgct tttattcaag cttatgtatt
    15481 cgctatttta acttgtggat tcattaatga tagtttaaac cttcactaat tttctccccc
    15541 tatttttatg gtgattgtaa ttcaatggta gaatgcttat ttgtggcata agaagttctt
    15601 ggttcgattc caagtaatca cccaatcaaa attatataac tctctttaaa aagtgtttaa
    15661 cggatagaaa catgtattgg ttcatgtact tgctttgggt gtgagaattt gttagttcga
    15721 atctaaccta tccgataata agtgattggg ttgttgacta ataggtaagt ccctgaaatt
    15781 tgacttcagt ctatgtaagt tcgaatctta ccatcccatt acttaaacat ctttaagatg
    15841 ttcctaaacc atccaaaaaa aaaacacttt attagtggga tggtctcttt tttatttaag
    15901 tatttccaaa atcaattagg aaccaattag ggtttcttaa atttctaatc aaaatgcaaa
    15961 aaaataattt aaaaaattta attactacta ttgtaactaa tgcttttttt aatcaaaaag
    16021 ctaatttttc aatacctctt aaaggtgtta ttggagaaaa aagaccatca atcttaatag
    16081 gaaatattaa tataaatttt aaaagtgatt ctttaattga agtatctttc ccttattatc
    16141 ctttacttaa taaaaattat ccaaatcctt caattataag taatattata caaaaagctc
    16201 tttcaaatca tcttttatat tcatctaaaa attactcttt tattgttaat attagagctc
    16261 ttcctatttc aactccttat ggaagtagtt taatcttttc aaaatatata gcaataataa
    16321 taggatcaaa tccaaaaata gcttctacat tatggataga tcctaaacga tttattaatt
    16381 tacccaaatt acaaagtgat tctatattta aaattttagg attaaatgta ccaaaaggat
    16441 ggaaaggtat tcatatctca ttaaatttaa ttaaatgaaa tagtctatca tcaagaggac
    16501 gaataactaa tataattaaa ggtagtgtac cattaacaaa taattctaat ggatatgatg
    16561 aaagttcttt agctatttat tctaaaatgg gtactattca aattaaggtt agattgtctt
    16621 attcttcaaa tctttaattg tttccccctt caatcattta aagttcttta acttaaaagg
    16681 tcagagtgca gacttgataa gtctgtggta ttggttcgat tccaataaga actagccaaa
    16741 taaattaatc cattacaata taattaatac cctttaaaag ttgtatggaa tttttcaatg
    16801 aagtaaaata actcccaaat ctttattttt ctttaaacct ttagtaacta tcaatttaaa
    16861 agtgaaaaag ataaaaaata aagaaaccct atagggttac tcaaatcatt aatatgccac
    16921 aattagtacc attctatttt attaatattt tatcttttgg ttttttaatc tttactgttt
    16981 tattatatat ttcatcagta tatgtattac caagatataa tgaattattt atctcaagat
    17041 ctattataag ttctttataa tttaacccct ccaaaagtat tgataatgtt cagtggtctg
    17101 aaattgaatt tgcaaaattt gatatatgag ttcaattctc atcattatct tttaccatat
    17161 ttattaggag aatagcttaa ttggtagagc acttacctta caagtaagat tataagggtt
    17221 caaatccctt ttctcctatt tcatctctaa aaaaaagggg agaattctta tgttggtttt
    17281 aagaggtgag ttgtagcctc attaggtcaa tcctatcgca ggttcgattc ctgctctcct
    17341 cattactcaa aagggagtaa aatcccctct ctcatctttt ttagttttaa ttaataataa
    17401 aatggcatcc ataactaatt tagtattgta aaagggaaaa tattttctta atatttattg
    17461 cacttttagc ttaattggtt agagtaacaa tcttcgaaat tgttagtata ggttcaaatc
    17521 ctataaagtg ttaatgaggt aaggattata gcttaacggt taaagcagag agctcataac
    17581 tcttgtatat tggttcgatt ccagtttgtc ctaatttatt tttcctcttt aattggaagg
    17641 gtgtccgagt ggtttaagga gcgatatttg agctattgtg atttattcat cgcaggttcg
    17701 aatcctgccc ctttcgaaag tctacagata aaaaaaatca catttctttt tgttagaata
    17761 gtaaactcta gctgtagaga gttaaattca tctaaatttt aaaatatgat acaagctgca
    17821 aaatacattg gtgctggttt agctacaatt ggtgttagtg gtgctggtgt tggtattgga
    17881 ttaatcttca gtaacttaat ctcaggtact tcaagaaacc catcagttcg acctcactta
    17941 ttctcaatgg ctatcctagg attcgcctta acagaagcta caggtttatt ctgtttaatg
    18001 ttagcgttct taattatcta cgctgcttaa tttccccctt taaaaaagag aatactgggg
    18061 atttaattta attggttaga atattgtgtt tgcaccacaa aaatctggtt tcgagtacca
    18121 gaatctccat tttccccctc caaaacattt tatttgaatg tttttaaact agaatctgtt
    18181 tgaagagaat ttgaataatt ctttggaaag tttggatcac tcataacatt agaatagtat
    18241 ttgtttaaag tggttaataa aaaagaaacc caagagggta agtctactaa tattaaagaa
    18301 agaagaattc agaattaaat tctgaaagtg ttaaaatagt agttcatttt taatttttag
    18361 taatttcaaa tataacagaa tccatcttat aagattccta gttggctcta ttgtctaatg
    18421 gttaagacct tacatcttca ttgtaaatat cttggttcga ttccaagtag ggctacttaa
    18481 ataataattt tgaaactatt acttttcgga tattatctta tttgttctca atttattatt
    18541 attaactcaa tgtgctctct atgttatttt ttaactctat attaaatgat gccccttcta
    18601 gctgggctct ttatttccaa gatggtgcat ctcctagtta tttaggtgta acacacttaa
    18661 atgattatct tatgttctat ctaactttca tctttatcgg tgtaatctat gctatctgta
    18721 aagctgttat agaatataat tacaatagcc atcctattgc tgcaaaatat acaactcatg
    18781 gttcaattgt tgaattcatt tggactttaa ttccagcttt aatcttaatt ttagttgctt
    18841 taccatcatt caaactttta tacttattag atgaagtaca aaaaccaagt atgactgtta
    18901 aggcaattgg aagacaatgg ttctggagtt atgaattaaa cgattttgtt actaatgaaa
    18961 atgaaccagt ttcatttgat agttatatgg taccagaaga agatttagaa gaaggtagtc
    19021 taagacaatt agaagtagat aatcgattag ttctacctat agatacacga ataagattaa
    19081 tcttaacaag tggtgatgtt atccatagtt gggctgttcc ttctttaggt ataaaatgtg
    19141 attgtatccc tagtagatta aatcaagttt ctttatctat tgatagagaa ggtttattct
    19201 acggacaatg tagtgaactt tgtggtgtac ttcattcatc tatgcctatt gttgttcaag
    19261 gtgtatctct tgaagatttc ttagcttggt tagaagaaaa ttcataacct cccccctaaa
    19321 gtgtttatta aatgatgaac tcaaatagag aataatcaag ttaaataata gtaagataag
    19381 tactaaatta gattttataa aattccaaag tataaatatt tttatatatg t
//
DBGET integrated database retrieval system