GenomeNet

Database: RefSeq
Entry: NC_001641
LinkDB: NC_001641
Original site: NC_001641 
LOCUS       NC_001641               4615 bp    RNA     linear   VRL 20-JUL-2012
DEFINITION  Saccharomyces cerevisiae virus L-BC (La), complete genome.
ACCESSION   NC_001641
VERSION     NC_001641.1
DBLINK      Project: 14643
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae virus L-BC (La)
  ORGANISM  Saccharomyces cerevisiae virus L-BC (La)
            Viruses; dsRNA viruses; Totiviridae; Totivirus.
REFERENCE   1  (bases 1 to 4615)
  AUTHORS   Park,C.M., Lopinski,J.D., Masuda,J., Tzeng,T.H. and Bruenn,J.A.
  TITLE     A second double-stranded RNA virus from yeast
  JOURNAL   Virology 216 (2), 451-454 (1996)
   PUBMED   8607277
REFERENCE   2  (bases 1 to 4615)
  AUTHORS   Bruenn,J.A.
  TITLE     A closely related group of RNA-dependent RNA polymerases from
            double-stranded RNA viruses
  JOURNAL   Nucleic Acids Res. 21 (24), 5667-5669 (1993)
   PUBMED   8284213
REFERENCE   3  (bases 1 to 4615)
  AUTHORS   Bruenn,J.A.
  TITLE     Direct Submission
  JOURNAL   Submitted (25-AUG-1993) Jeremy A. Bruenn, Biological Sciences,
            State University of New York at Buffalo, SUNY/Buffalo, Buffalo, NY
            14260, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to U01060.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4615
                     /organism="Saccharomyces cerevisiae virus L-BC (La)"
                     /mol_type="genomic RNA"
                     /host="Saccharomyces cerevisiae"
                     /db_xref="taxon:42478"
                     /lab_host="Saccharomyces cerevisiae"
                     /note="Saccharomyces cerevisiae virus ScV-La"
     gene            24..2117
                     /gene="cap"
                     /db_xref="GeneID:1403711"
     CDS             24..2117
                     /gene="cap"
                     /codon_start=1
                     /product="capsid"
                     /protein_id="NP_042580.1"
                     /db_xref="GeneID:1403711"
                     /translation="MSSLLNSLLPEYFKPKTNLNINSSRVQYGFNARIDMQYEDDSGT
                     RKGSRPNAFMSNTVAFIGNYEGIIVDDIPILDGLRADIFDTHGDLDMGLVEDALSKST
                     MIRRNVPTYTAYASELLYKRNLTSLFYNMLRLYYIKKWGSIKYEKDAIFYDNGHACLL
                     NRQLFPKSRDASLESSLSLPEAEIAMLDPGLEFPEEDVPAILWHGRVSSRATCILGQA
                     CSEFAPLAPFSIAHYSPQLTRKLFVNAPAGIEPSSGRYTHEDVKDAITILVSANQAYT
                     DFEAAYLMLAQTLVSPVPRTAEASAWFINAGMVNMPTLSCANGYYPALTNVNPYHRLD
                     TWKDTLNHWVAYPDMLFYHSVAMIESCYVELGNVARVSDSDAINKYTFTELSVQGRPV
                     MNRGIIVDLTLVAMRTGREISLPYPVSCGLTRTDALLQGTEIHVPVVVKDIDMPQYYN
                     AIDKDVIEGQETVIKVKQLPPAMYPIYTYGINTTEFYSDHFEDQVQVEMAPIDNGKAV
                     FNDARKFSKFMSIMRMMGNDVTATDLVTGRKVSNWADNSSGRFLYTDVKYEGQTAFLV
                     DMDTVKARDHCWVSIVDPNGTMNLSYKMTNFRAAMFSRNKPLYMTGGSVRTIATGNYR
                     DAAERLRAMDETLRLKPFKITEKLDFRVAAYAIPSLSGSNMPSLHHQEQLQISEVDAE
                     PINPIGEDELPPDIE"
     misc_feature    120..>995
                     /gene="cap"
                     /note="L-A virus, major coat protein; Region:
                     LA-virus_coat; pfam09220"
                     /db_xref="CDD:286324"
     gene            1970..4561
                     /gene="pol"
                     /db_xref="GeneID:1403712"
     CDS             <1970..4561
                     /gene="pol"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="NP_042581.1"
                     /db_xref="GeneID:1403712"
                     /translation="FSCSSLRDTKFVGQQYAILTPSGTTTDIRSGRGTNQSYRRGRTS
                     TGYRIGVEDDEDLDIGTVKYIVPLYLNGDNVAQNCLEATHVLIKACSIANRIVDDGEG
                     HCFTQQGLAQQWIFHRGEMIFVKAVRIGQLNAYYVDYKNVTNYSLKTAAQVGATISNN
                     LRHGFVDNQQDAYTRLVANYSDTRKWIRDNFTYNYNMEKEKYRITQYHHTHVRLKDLF
                     PSRKIVKLEGYEALLAMMLDRFNNIESTHVTFFTYLRALPDREKEVFISLVLNYNGLG
                     REWLKSEGVRAKQAQGTVKYDMSKLFELNVLENGVDEEVDWEKEKRNRSDIKTVNISY
                     AKVLEHCRELFIMARAEGKRPMRMKWQEYWRQRAVIMPGGSVHSQHPVEQDVIRVLPR
                     EIRSKKGVASVMPYKEQKYFTSRRPEIHAYTSTKYEWGKVRALYGCDFSSHTMADFGL
                     LQCEDTFPGFVPTGSYANEDYVRTRIAGTHSLIPFCYDFDDFNSQHSKEAMQAVIDAW
                     ISVYHDKLTDDQIEAAKWTRNSVDRMVAHQPNTGETYDVKGTLFSGWRLTTFFNTALN
                     YCYLANAGINSLVPTSLHNGDDVFAGIRTIADGISLIKNAAATGVRANTTKMNIGTIA
                     EFLRVDMRAKNSTGSQYLTRGIATFTHSRVESDAPLTLRNLVSAYKTRYDEILARGAS
                     IDNMKPLYRKQLFFARKLFNVEKDIVDNLITMDISCGGLQEKGRVSEMVLQEVDIENI
                     DSYRKTRMIAKLIDKGVGDYTAFLKTNFSEIADAITRETRVESVTKAYNVKKKTVVRA
                     FRDLSAAYHERAVRHAWKGMSGLHIVNRIRMGVSNLVMVVSKINPAKANVLAKSGDPT
                     KWLAVLT"
     misc_feature    2531..3928
                     /gene="pol"
                     /note="Viral RNA-directed RNA-polymerase; Region: RdRP_4;
                     pfam02123"
                     /db_xref="CDD:280316"
     misc_feature    1970
                     /gene="cap"
                     /function="translational frameshift site"
ORIGIN      
        1 gaatttttcg gtgaaccgga attatgtcgt ctctgttaaa ttcattacta ccagaatatt
       61 ttaaacctaa aactaatttg aatatcaact cttctagggt ccaatatggc tttaatgctc
      121 gcattgatat gcagtatgaa gacgatagtg ggactagaaa aggctcaaga cccaatgcat
      181 ttatgtctaa cacagttgct tttataggaa actatgaagg tattattgtt gatgacattc
      241 cgatattgga tggtcttagg gccgacattt ttgatactca tggtgactta gacatgggcc
      301 tcgttgagga tgcattgtct aagagtacca tgattagaag gaatgtacca acttatactg
      361 cttacgcgag tgaattactg tataagagaa accttacatc tctattttac aatatgctcc
      421 gtttatacta cattaaaaaa tggggcagta ttaagtatga aaaagatgcc atcttttatg
      481 ataatggcca cgcctgtctt ttaaacaggc aattgtttcc aaagtctcgt gatgcttctt
      541 tggaatcaag cctctctttg cctgaggctg aaattgcaat gcttgatcct ggcctggaat
      601 ttccagaaga ggatgtgcct gcaattttat ggcacggcag agtgtcatcc agagcaacgt
      661 gtatcttagg gcaagcttgc tcagagttcg cgcctctggc ccccttttcg attgcgcatt
      721 attcaccaca attgacgaga aaactatttg tcaatgcgcc cgctgggatt gagcctagct
      781 ccgggcggta tactcacgag gatgtaaaag atgcgattac gatccttgtg tctgcaaacc
      841 aggcttatac tgactttgaa gcagcatact tgatgcttgc tcaaacgttg gtctcacctg
      901 taccacgcac tgccgaagca agtgcatggt tcatcaatgc tggcatggtc aatatgccaa
      961 ctttgtcatg tgcaaatggt tattatccag cactgaccaa tgtcaatcct taccaccggc
     1021 tagacacatg gaaagatacg ttaaatcatt gggtggctta tcccgacatg ctgttttacc
     1081 attcagtggc aatgattgag agctgctatg ttgaactcgg gaatgtggct cgtgtgtcag
     1141 acagtgatgc aataaacaaa tacactttca ctgagctatc agtgcaagga cggcctgtta
     1201 tgaatcgagg aattattgta gatctgacac ttgtggcaat gcgtactggt agggagatct
     1261 cactacctta cccggtcagc tgtggcctga cccgtacaga cgcgttattg caaggtactg
     1321 agattcacgt tccagttgtt gtcaaagata tcgacatgcc ccagtattac aacgcgattg
     1381 ataaggatgt tattgagggg caggaaactg tgattaaagt gaaacagctg ccaccagcta
     1441 tgtatccaat ttatacttac gggatcaaca ctactgaatt ctattctgac cattttgaag
     1501 accaggtaca agttgaaatg gcaccaatcg ataatggaaa agcagttttt aacgatgcaa
     1561 gaaagttttc gaaatttatg tccataatgc gcatgatggg gaatgatgtt actgctactg
     1621 atttagttac aggtagaaaa gtgtcgaatt gggccgacaa ctcatcaggg cgtttcttgt
     1681 acacggatgt gaagtatgaa ggacaaactg cctttttggt tgatatggat actgtcaagg
     1741 cgagagacca ctgttgggtg tcaattgttg atcctaatgg tacaatgaac ttgtcatata
     1801 agatgaccaa ttttagagca gcaatgtttt ctagaaacaa gcccttgtat atgacagggg
     1861 ggtcagtcag gaccatagct actggcaatt atcgagatgc tgctgaaaga ttacgtgcaa
     1921 tggatgaaac gctcagatta aaacctttta agattactga gaagttggat tttcgtgtag
     1981 cagcttacgc gataccaagt ttgtcgggca gcaatatgcc atccttacac catcaggaac
     2041 aactacagat atcagaagtg gacgcggaac caatcaatcc tataggagag gacgaacttc
     2101 caccggatat agaataggtg tcgaagacga tgaggactta gatattggta cggtcaaata
     2161 cattgtgcca ttgtatttga acggtgataa tgtggcacaa aattgtttag aagcaacaca
     2221 cgtgcttatc aaagcttgta gtattgcgaa ccggattgta gatgacggag agggtcactg
     2281 tttcacacag caagggctgg cgcagcagtg gatcttccat aggggggaga tgatatttgt
     2341 gaaggcggta cgcattggtc aactcaatgc atattatgta gactataaga acgtcacaaa
     2401 ttatagtctt aaaaccgctg ctcaagtagg agcgacgata tcaaataact tacgccacgg
     2461 atttgttgac aatcaacaag acgcatacac gcgcttggtt gccaactact ctgatacgcg
     2521 gaagtggata cgtgacaatt ttacatataa ttataatatg gagaaagaaa agtataggat
     2581 aacccaatac caccatacac atgtgaggtt gaaagatttg tttccatcca ggaaaatagt
     2641 taaactagag ggatatgaag ccttgttggc aatgatgcta gacaggttta acaacataga
     2701 gtcaacacat gtaactttct tcacatattt aagagcacta cctgaccgtg aaaaagaagt
     2761 ctttattagc ttagtcttaa actataatgg ccttggcaga gagtggttga agtctgaagg
     2821 tgttagggct aaacaagcac aaggtactgt gaaatacgat atgagtaaac tatttgaact
     2881 gaatgtacta gagaacggag ttgacgaaga agttgactgg gagaaagaga aacgcaacag
     2941 gtcagatatc aagactgtta acataagtta tgcaaaagtt ctcgaacatt gtagagagct
     3001 attcatcatg gcgagggccg aagggaaacg gccaatgagg atgaaatggc aagagtactg
     3061 gaggcagaga gcagttatca tgccaggtgg atcggtccac agtcaacatc cagtcgaaca
     3121 ggacgtgatt agagtattac ccagagaaat cagaagtaag aagggggtgg caagtgtcat
     3181 gccatacaaa gaacagaagt atttcacgtc cagaaggccg gaaatacacg cttacacttc
     3241 aacgaaatac gagtggggaa aagtgagggc actatatggg tgtgattttt catcacatac
     3301 aatggctgat tttggattgt tacaatgcga ggatacattc ccgggctttg taccaacagg
     3361 gtcttacgcc aatgaggatt atgtcaggac cagaattgct gggactcact cattgatccc
     3421 tttctgttac gatttcgatg atttcaacag ccaacattca aaggaagcca tgcaagcagt
     3481 gattgatgca tggatatctg tctatcacga taagttaaca gatgaccaga tagaggcggc
     3541 aaagtggaca cgaaactcgg tagatagaat ggtcgctcac caacctaaca ctggtgagac
     3601 ttatgatgtt aaagggacac tgtttagtgg ctggcgatta acaacatttt tcaatacggc
     3661 gttgaactat tgctacctgg ctaatgcagg tataaactca ctagtgccaa cgagtctcca
     3721 taatggtgat gatgtttttg cagggataag gacaatagct gacggtattt ctttgatcaa
     3781 aaacgccgca gccacgggag ttcgcgctaa tacaactaaa atgaacattg gtacgatagc
     3841 agagtttttg agagttgata tgcgtgcaaa aaatagtact ggcagtcagt atttaacaag
     3901 agggattgct accttcacgc acagtagggt tgagtctgat gcaccactga cattgcgcaa
     3961 tctagtatct gcttacaaaa ccagatatga cgagatttta gctcgtggcg caagcatcga
     4021 taacatgaag ccactctatc gtaagcaatt attttttgct agaaagttgt tcaatgtcga
     4081 gaaggacatt gttgacaatc tgataacgat ggacatatca tgtggcggtt tgcaagaaaa
     4141 gggtagggta tcagagatgg tgttacagga ggttgacatt gagaatatag atagttatag
     4201 gaagacaagg atgatcgcca aactgattga caagggggtt ggcgattata ctgcattcct
     4261 gaaaactaac ttttccgaga tagctgatgc tatcacaaga gagacacgtg tagagtcagt
     4321 gaccaaggct tataatgtta agaagaaaac ggtcgtacgc gcgtttaggg acctaagcgc
     4381 agcatatcat gaaagagcgg tgagacatgc ttggaagggg atgagtggac tacacatagt
     4441 caacaggatt cgtatgggag tgagcaactt agtaatggtt gttagcaaaa tcaatcctgc
     4501 aaaagctaat gtgctagcca aatcaggaga tcctacaaaa tggcttgcag tccttacatg
     4561 atatacaggc aaccacataa gacctgagaa caaagagtac atacgatact acgca
//
DBGET integrated database retrieval system