GenomeNet

Database: RefSeq
Entry: NC_003037
LinkDB: NC_003037
Original site: NC_003037 
LOCUS       NC_003037            1354226 bp    DNA     circular CON 27-JUN-2013
DEFINITION  Sinorhizobium meliloti 1021 plasmid pSymA, complete sequence.
ACCESSION   NC_003037
VERSION     NC_003037.1  GI:16262453
DBLINK      Project: 57603
            BioProject: PRJNA57603
KEYWORDS    RefSeq.
SOURCE      Sinorhizobium meliloti 1021
  ORGANISM  Sinorhizobium meliloti 1021
            Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
            Rhizobiaceae; Sinorhizobium/Ensifer group; Sinorhizobium.
REFERENCE   1  (bases 1 to 1354226)
  AUTHORS   Barnett,M.J., Fisher,R.F., Jones,T., Komp,C., Abola,A.P.,
            Barloy-Hubler,F., Bowser,L., Capela,D., Galibert,F., Gouzy,J.,
            Gurjal,M., Hong,A., Huizar,L., Hyman,R.W., Kahn,D., Kahn,M.L.,
            Kalman,S., Keating,D.H., Palm,C., Peck,M.C., Surzycki,R.,
            Wells,D.H., Yeh,K.-C., Davis,R.W., Federspiel,N.A. and Long,S.R.
  TITLE     Nucleotide sequence and predicted functions of the entire
            Sinorhizobium meliloti pSymA megaplasmid
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 98 (17), 9883-9888 (2001)
   PUBMED   11481432
REFERENCE   2  (bases 1 to 1354226)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (10-SEP-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 1354226)
  CONSRTM   NCBI Microbial Genomes Annotation Project
  TITLE     Direct Submission
  JOURNAL   Submitted (25-JUN-2001) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from AE006469.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..1354226
                     /organism="Sinorhizobium meliloti 1021"
                     /mol_type="genomic DNA"
                     /strain="1021"
                     /db_xref="taxon:266834"
                     /plasmid="pSymA"
     gene            1353..4457
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /db_xref="GeneID:1235225"
     CDS             1353..4457
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /EC_number="1.2.1.2"
                     /function="Small molecule metabolism; Energy metabolism,
                     carbon"
                     /codon_start=1
                     /transl_except=(pos:1965..1967,aa:Sec)
                     /transl_table=11
                     /product="formate dehydrogenase subunit alpha"
                     /protein_id="NP_435247.1"
                     /db_xref="GI:16262454"
                     /db_xref="GeneID:1235225"
                     /translation="MEAVPMNVDLSRRSFLKLAGAGAAATSLGAMGFGEAEAAVVAHV
                     RPHKLTTTTETRNTCPYCSVACGVIIYSKGDLRKGEAADIIHIEGDADHPTNRGTLCP
                     KGAALKDFVKSPTRLQYPMHRKPGSDKFERISWEDAFDRIARLMKDDRDANFIAANAA
                     GVPVNRWTTVGMLAASATTNETAWATFKFAKALGIVGFDNQARVUHGPTVSSLGPTFG
                     RGAMTNSWTDIKNTDLVVVMGGNAAEAHPCGFKWVTEAKATRGAKLIVVDPRYTRTAS
                     VSDYYAPIRQGTDIAFLNGVMKYCIDNDKVQWDYMKAFTNASYLVKDGFGYQDGLFTG
                     YDAEKRDYDKSTWDYVLGDDGFVVTDPALQHPRCVWNLLKAHLAPYTPEMVERICGTP
                     KDKFLKVAEMISECSSPTKTMTSMYALGWTQHSSGSQNIRAMAMLQLILGNIGVRGGG
                     MNALRGHSNIQGLTDLGLMSHLLTGYLTMPTEKDVDFTTYMSTRQFKPLRPGQTSYWQ
                     NYRKFMVSFQKAMWGDAARIDNDWAFNYLSKLDVPAYDVLRVFELMYAGKVNGYICQG
                     FNPLLAFPNRDKNTKALSNLKWLVTMDPLDTETARFWENHGDFNPVDTASIQTEVFQL
                     PTTCFAEEEGSLTNSGRWLQWHWAGGTPPGEAKHDTYIVAQIFLRMKEMYRNEGGAFP
                     DPILNLSWDYADPNEPTPEELAKEINGRALTDLMDPANPMKVQVAAGKQILNFSQLRD
                     DGSTMCGCWIYSGNFNEQGNNMARRDNHDPDDTGAYLGWSFAWPLNRRTLYNRASADL
                     QGKPWDPSRKLLEWDGTKWAGYDVPDIAPTAKPDEIGPFIMNQEGTARLFSRGLMRDG
                     PFPAHMEPFESPVANVFNPKMRGNPVSRVFQTDVAQMGLSDEFPYAATSYRLTEHFHY
                     WTKHNRVNSALQPEFFVEISEELAEEKNIENGGWVRVWSKRGSVKAKAVVTKRIRPLM
                     CDGKPVHVVGIPLHWGFTGSAKKGLGPNSLAPFVGDANIETPEYKAFLVNIEPSTAPE
                     EATV"
     misc_feature    1377..4424
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /note="formate dehydrogenase, alpha subunit,
                     proteobacterial-type; Region: formate-DH-alph; TIGR01553"
                     /db_xref="CDD:233466"
     misc_feature    1527..4004
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /note="Formate dehydrogenase N, alpha subunit
                     (Formate-Dh-Na) is a major component of nitrate
                     respiration in bacteria such as in the E. coli formate
                     dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that
                     is a complex of three different subunits and is the...;
                     Region: MopB_Formate-Dh-Na-like; cd02752"
                     /db_xref="CDD:239153"
     misc_feature    order(1527..1529,1533..1538,1548..1550,1653..1655,
                     2091..2096)
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /note="[4Fe-4S] binding site [ion binding]; other site"
                     /db_xref="CDD:239153"
     misc_feature    order(1659..1661,1953..1955,1965..1967,2067..2069,
                     2073..2075,2082..2087,2154..2162,2211..2213,2217..2219,
                     2604..2612,2619..2624,2718..2723,3048..3056,3066..3068,
                     3126..3134,3141..3143,3231..3233,3327..3329)
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239153"
     misc_feature    4041..4427
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /note="Formate dehydrogenase N, alpha subunit
                     (Formate-Dh-Na) is a major component of nitrate
                     respiration in bacteria such as in the E. coli formate
                     dehydrogenase N (Fdh-N). Fdh-N is a membrane protein that
                     is a complex of three different subunits and is the...;
                     Region: MopB_CT_Formate-Dh-Na-like; cd02792"
                     /db_xref="CDD:239193"
     misc_feature    order(4065..4079,4083..4094,4305..4307,4350..4352,
                     4398..4403)
                     /gene="fdoG"
                     /locus_tag="SMa0002"
                     /note="molybdopterin cofactor binding site; other site"
                     /db_xref="CDD:239193"
     gene            4454..5446
                     /gene="fdoH"
                     /locus_tag="SMa0005"
                     /db_xref="GeneID:1235226"
     CDS             4454..5446
                     /gene="fdoH"
                     /locus_tag="SMa0005"
                     /EC_number="1.2.1.2"
                     /function="Small molecule metabolism; Energy metabolism,
                     carbon"
                     /note="glimmer prediction; similar to E. coli fdoH"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase susbunit beta"
                     /protein_id="NP_435248.1"
                     /db_xref="GI:16262455"
                     /db_xref="GeneID:1235226"
                     /translation="MMDSPRTAVSNPPVQPMESNLTERDLVRRSATTELPPPERQLTP
                     VAKLIDVSKCIGCKACQSACVEWNDTHPGIGENVGYYTNPHDLTEDMFTLMRFTEWVN
                     PETDNLEWLIRKDGCMHCADPGCLKACPAPGAIVQYTNGIVDFVHENCIGCGYCIKGC
                     PFNIPRISKVDHRAYKCTLCSDRVAVGQGPACAKACPTQAIVFGTKEDMKKHAEHRIA
                     DLKSRGYTNAGLYDPPGVGGTHVMYVLHHSDKPHIYSDLPDDPKISAVVQAWKGVTKY
                     TGLAAMGLVAAGAILHGVFGRANRVQPEDEESAERLVDSAGAAGRTPDDKGQRS"
     misc_feature    4526..5374
                     /gene="fdoH"
                     /locus_tag="SMa0005"
                     /note="formate dehydrogenase, beta subunit, Fe-S
                     containing; Region: FDH-beta; TIGR01582"
                     /db_xref="CDD:233481"
     misc_feature    4781..5065
                     /gene="fdoH"
                     /locus_tag="SMa0005"
                     /note="4Fe-4S dicluster domain; Region: Fer4_11;
                     pfam13247"
                     /db_xref="CDD:257603"
     misc_feature    5240..5371
                     /gene="fdoH"
                     /locus_tag="SMa0005"
                     /note="Formate dehydrogenase N, transmembrane; Region:
                     Form-deh_trans; pfam09163"
                     /db_xref="CDD:255210"
     gene            5424..6110
                     /gene="fdoI"
                     /locus_tag="SMa0007"
                     /db_xref="GeneID:1235227"
     CDS             5424..6110
                     /gene="fdoI"
                     /locus_tag="SMa0007"
                     /EC_number="1.2.1.2"
                     /function="Small molecule metabolism; Energy metabolism,
                     carbon"
                     /note="glimmer prediction; similar to E. coli fdoI"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit gamma"
                     /protein_id="NP_435249.1"
                     /db_xref="GI:16262456"
                     /db_xref="GeneID:1235227"
                     /translation="MTKASDLEPEDAIHRGPPVTVDRYGPGKRVNHWITASSLILLAL
                     SGLAMFHPSLFFLTGLFGGGQNTRMLHPWIGVVLFFSFYIFFFQLWKANLFTRADMGW
                     FTGIRDVIGGHEDRLPEMGKYNAGQKVIFWAMALLIVALIITGVIIWDQYFYSYTSIE
                     TKRFAVLAHAVAAVLIICVFIVHVYAAFWTRGTFRAMTKGSVTGGWAWRHHRKWLKEL
                     AGRGRIDPAE"
     misc_feature    5466..6107
                     /gene="fdoI"
                     /locus_tag="SMa0007"
                     /note="Cytochrome b subunit of formate dehydrogenase
                     [Energy production and conversion]; Region: FdnI; COG2864"
                     /db_xref="CDD:225419"
     gene            6149..7069
                     /gene="fdhE"
                     /locus_tag="SMa0009"
                     /db_xref="GeneID:1235228"
     CDS             6149..7069
                     /gene="fdhE"
                     /locus_tag="SMa0009"
                     /function="Small molecule metabolism; Energy metabolism,
                     carbon"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase subunit epsilon"
                     /protein_id="NP_435250.1"
                     /db_xref="GI:16262457"
                     /db_xref="GeneID:1235228"
                     /translation="MSVSPVQPDPSVIGGVPKAPFVLKPNLARLFNDRASRFEALAQG
                     SHLAPYLNFLAGITRIQSELVSALPPPEPVPADRVERARANAMPPIDRAAMGGSPDCR
                     EVLQQFFEKAEALEKPAAAAEALAQVRTADEEMLTWMIGNVMADDLPVESLAHHLYVA
                     AAMQIQAARLAAGLDGSRLVPIRVGVCPACGGRPVASMVIGFHGAEGARYASCSCCAT
                     MWNEVRVKCLACGSTKGIGYQAVETGDEEATVKAEVCDTCNSWMKILYQNKNPSLDVV
                     ADDVASLGLDLLMKDTEYKRAGFDPFLMGY"
     misc_feature    6152..7063
                     /gene="fdhE"
                     /locus_tag="SMa0009"
                     /note="formate dehydrogenase accessory protein FdhE;
                     Region: FdhE; TIGR01562"
                     /db_xref="CDD:130625"
     gene            7074..8474
                     /gene="selA"
                     /locus_tag="SMa0011"
                     /db_xref="GeneID:1235229"
     CDS             7074..8474
                     /gene="selA"
                     /locus_tag="SMa0011"
                     /EC_number="2.9.1.1"
                     /function="Small molecule metabolism; aa-tRNAs"
                     /note="catalyzes the formation of
                     selenocysteinyl-tRNA(Sec) from seryl-tRNA(Sec) and
                     L-selenophosphate in selenoprotein biosynthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine synthase"
                     /protein_id="NP_435251.1"
                     /db_xref="GI:16262458"
                     /db_xref="GeneID:1235229"
                     /translation="MSGPVDLRALPSVDQMLNAAAVSPLVEQHGRAVVTDELRKVLGE
                     VRLAVRSGGALPGKDGIVAALLSRLDDRSRSNLRPLFNLTGTVLHTNLGRALLAQEAV
                     DAAVDAMREAAALEFDLDSGGRGERDSHLRELLCELTGAEDATVVNNNAAAVLIALNS
                     VGAGRQAIVSRGELIEIGGAFRMPDIMERAGVDLVEVGTTNRTHAKDYVKAIGPETAL
                     ILKVHTSNYRIEGFTAEVPGAELAAIAHERGVVLLNDLGSGSLVDLSRYGLGREPTVR
                     EAVAEGADLVTFSGDKLLGGPQAGFIVGRRDLIAEINRNPLKRALRVDKIRIAATAAT
                     LKLYRDPDRLASRLPTLFMLSRVQAEVRAQAERLAPQVGAMLAPSGYAVEVCSCSSQI
                     GSGALPVDTIPSAGLRIVGSSGSALEALAALFRSLSRPILGRLRDGALVLDLRCLSDE
                     AEFLKTLSEGSGDAVA"
     misc_feature    7092..8447
                     /gene="selA"
                     /locus_tag="SMa0011"
                     /note="seryl-tRNA(sec) selenium transferase; Region: selA;
                     TIGR00474"
                     /db_xref="CDD:232992"
     misc_feature    7092..7211
                     /gene="selA"
                     /locus_tag="SMa0011"
                     /note="Selenocysteine synthase N terminal; Region:
                     Se-cys_synth_N; pfam12390"
                     /db_xref="CDD:257018"
     misc_feature    7311..8417
                     /gene="selA"
                     /locus_tag="SMa0011"
                     /note="L-seryl-tRNA selenium transferase; Region: SelA;
                     pfam03841"
                     /db_xref="CDD:112645"
     misc_feature    order(7521..7526,7533..7535,7737..7739,7860..7862,
                     7869..7871,7938..7940,7947..7949)
                     /gene="selA"
                     /locus_tag="SMa0011"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    7947..7949
                     /gene="selA"
                     /locus_tag="SMa0011"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     gene            8383..9255
                     /locus_tag="SMa0013"
                     /db_xref="GeneID:1235230"
     CDS             8383..9255
                     /locus_tag="SMa0013"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435252.2"
                     /db_xref="GI:193782525"
                     /db_xref="GeneID:1235230"
                     /translation="MVRWFWTCAVCPMRRNSSKPCPRVAAMRWLERLRGNKPQTAPVA
                     DPMAEALARAQAGDYGSALRIWEPLARAGVARAQNNIGACFAEGLGVPENRELACKWL
                     RLAAEAGDPVGQRNYAALHMQGLAGTDADYGIAAEYYRRAAEKGDAPAQDMLSWLLLE
                     GEIMTADPLEARRWAECAAEAGIASSMTRLGMLHHNALGVERDAQKAVYWWLKAAERG
                     DADAQAMLGAACHMGAGTIRNGVTALVWLIRATEGGSTLAKPFMGPVRDSLSPAEIQE
                     AERRAQEPLSRRAP"
     misc_feature    8521..9252
                     /locus_tag="SMa0013"
                     /note="FOG: TPR repeat, SEL1 subfamily [General function
                     prediction only]; Region: COG0790"
                     /db_xref="CDD:223861"
     misc_feature    8605..8712
                     /locus_tag="SMa0013"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     misc_feature    8932..9039
                     /locus_tag="SMa0013"
                     /note="Sel1-like repeats; Region: SEL1; smart00671"
                     /db_xref="CDD:214772"
     gene            9252..11252
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /db_xref="GeneID:1235231"
     CDS             9252..11252
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /function="Small molecule metabolism; aa-tRNAs"
                     /codon_start=1
                     /transl_table=11
                     /product="selenocysteine-specific elongation factor"
                     /protein_id="NP_435253.1"
                     /db_xref="GI:16262460"
                     /db_xref="GeneID:1235231"
                     /translation="MIVGTAGHIDHGKTTLVKALTGVDTDRLKEEKARGITIDLGFAY
                     ARFAKDAVTGFVDVPGHERFIHTMLAGAGGIDYAMLVVAADDGIKPQTLEHLAILDLL
                     GVSRGLVAITKADLADPARLENLTDEIGAVLSSTSLRDAEILPVSVAAGQGIELLKER
                     LAAAECATAASAVGGRFRLAVDRSFTLSGAGTVVTGTVLSGSVGVGDQVTVSPAGRSA
                     RVRSIHAQNQRAERGFAGQRCALNLAGEGISKDAITRGDMVVDPHLHAPSDRLDADLS
                     VLESETKPIGEWFSARFHHASAETGIRIVPLEGPLLPGERRRVQLVLDRPIAAAVGDR
                     FILRDVSARRTIGGGRLLDLRAPARKRRSPERLSYLQAASLSHAGEALAALLDVPPFL
                     VDLDVFARDRALSEAELQNAIRSASAEVIEGSAVRHALSKRQRAAFSDEVQRVLSAFH
                     VENPDLQGIGRERLRLQVTPRLPPPAFLVALRAEQTAGRLVLEGAFVRLPGHEVRLSE
                     KEEELYARILPHLEGEERFRPPRVRDFAEALGVDEREIRRILKLCARLGRVDQIRHDH
                     FFTRQTTAEMVAIIRQVAANAERGEFSAGLFRDRVNNGRKVAIEILEFFDRQGVTIRH
                     GDVRRVNPHRLDLYEGPVPEADEGRGSSPVERPDFKFYRAGS"
     misc_feature    9252..10664
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="Selenocysteine-specific translation elongation
                     factor [Translation, ribosomal structure and biogenesis];
                     Region: SelB; COG3276"
                     /db_xref="CDD:225815"
     misc_feature    9255..9734
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="SelB, the dedicated elongation factor for delivery
                     of selenocysteinyl-tRNA to the ribosome; Region: SelB;
                     cd04171"
                     /db_xref="CDD:206734"
     misc_feature    9258..9281
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="G1 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    order(9261..9263,9267..9269,9279..9284,9291..9293,
                     9300..9305,9372..9377,9432..9437,9504..9509,9621..9623,
                     9633..9635)
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="putative GEF interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:206734"
     misc_feature    order(9267..9284,9585..9590,9594..9596,9690..9698)
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="GTP/Mg2+ binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:206734"
     misc_feature    9327..9374
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="Switch I region; other site"
                     /db_xref="CDD:206734"
     misc_feature    9360..9362
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="G2 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    9420..9431
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="G3 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    9426..9482
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="Switch II region; other site"
                     /db_xref="CDD:206734"
     misc_feature    9585..9596
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="G4 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    9690..9698
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="G5 box; other site"
                     /db_xref="CDD:206734"
     misc_feature    9780..10034
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="selB_II: this subfamily represents the domain of
                     elongation factor SelB, homologous to domain II of EF-Tu.
                     SelB may function by replacing EF-Tu. In prokaryotes, the
                     incorporation of selenocysteine as the 21st amino acid,
                     encoded by TGA, requires several...; Region: selB_II;
                     cd03696"
                     /db_xref="CDD:239667"
     misc_feature    10017..10301
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="This family represents the domain of elongation
                     factor SelB, homologous to domain III of EF-Tu. SelB may
                     function by replacing EF-Tu. In prokaryotes, the
                     incorporation of selenocysteine as the 21st amino acid,
                     encoded by TGA, requires several elements:...; Region:
                     selB_III; cd04094"
                     /db_xref="CDD:239761"
     misc_feature    10575..10748
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="Elongation factor SelB, winged helix; Region:
                     SelB-wing_2; pfam09106"
                     /db_xref="CDD:255185"
     misc_feature    10998..11141
                     /gene="selB"
                     /locus_tag="SMa0015"
                     /note="Elongation factor SelB, winged helix; Region:
                     SelB-wing_3; pfam09107"
                     /db_xref="CDD:255186"
     gene            11506..12063
                     /locus_tag="SMa0017"
                     /db_xref="GeneID:1235232"
     CDS             11506..12063
                     /locus_tag="SMa0017"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435254.1"
                     /db_xref="GI:16262461"
                     /db_xref="GeneID:1235232"
                     /translation="MAAADDGRNGGGLRQRKARRGLPQARRNHLSGTTRIGKRQAQIL
                     GSGGLGPSNEPRGGCCMPLGREIPSEDGGENSRSKRSAWGRRQKTMSLTTAFIAELIR
                     AANEVERLTPYEISRLLDRSVDTIRDMRRQTGIAASHRARDVVIDLQLASARARDLSA
                     AETRDVLLDAADIIRTLKIVLDGKE"
     gene            complement(12259..12546)
                     /locus_tag="SMa5000"
                     /db_xref="GeneID:6435249"
     CDS             complement(12259..12546)
                     /locus_tag="SMa5000"
                     /note="Has some similarity to S; meliloti SMa1907 and a
                     group of conserved hypothetical proteins; Possible protein
                     fragment created by insertion of the adjacent insertion
                     element, TRm2011"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000327.1"
                     /db_xref="GI:193782526"
                     /db_xref="GeneID:6435249"
                     /translation="MSSNVSIISPWNMEFIRSVLGEAGYNAKLLVDDPRSFETAELLV
                     TKLFLAGEDSRPGLAAKLECQLGKAGGYRRPPGSSLARYAIQGLPSELQFS"
     repeat_region   12658..13716
                     /standard_name="ISRm2011-2/ISRm11"
                     /note="SMa3000; predicted by homology"
                     /rpt_family="ISRm2011-2/ISRm11"
     gene            12754..13161
                     /locus_tag="SMa0018"
                     /db_xref="GeneID:1235233"
     CDS             12754..13161
                     /locus_tag="SMa0018"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase TRm2011-2a"
                     /protein_id="NP_435255.1"
                     /db_xref="GI:16262462"
                     /db_xref="GeneID:1235233"
                     /translation="MARPFSNDLRERVVDAVTGEGLSCRAAAKRFGIGISTAIDWVRR
                     FRETGSAAPGQMGGHKPRKLSGPHRAWLLCRCRERDFTLHGLVAELSERGLKVDYRAV
                     WTFVHEEGLSYKKRRWSPANGSGPTSPATGHDG"
     misc_feature    12754..13158
                     /locus_tag="SMa0018"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3415"
                     /db_xref="CDD:225949"
     misc_feature    12781..12909
                     /locus_tag="SMa0018"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     gene            13227..13700
                     /locus_tag="SMa0020"
                     /db_xref="GeneID:1235234"
     CDS             13227..13700
                     /locus_tag="SMa0020"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase TRm2011-2b"
                     /protein_id="NP_435256.1"
                     /db_xref="GI:16262463"
                     /db_xref="GeneID:1235234"
                     /translation="MAPLRGWAPRGERLVGYAPFGHWNTMTFVAALRADRVSAPFILD
                     GPINGERFRIYVQQVLVPELKAGDIVILDNLGSHKGQEIRAAIRKAGARLFFLPKYSP
                     DLNPIEKLFAKIKHWLREAQARSRDAIHDELRHILQAVTPQECAAYFKEAGYERA"
     misc_feature    13227..13613
                     /locus_tag="SMa0020"
                     /note="DDE superfamily endonuclease; Region: DDE_3;
                     pfam13358"
                     /db_xref="CDD:257686"
     gene            complement(14450..15094)
                     /locus_tag="SMa0021"
                     /db_xref="GeneID:1235235"
     CDS             complement(14450..15094)
                     /locus_tag="SMa0021"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /note="glimmer prediction, with response regulator
                     receiver domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435257.1"
                     /db_xref="GI:16262464"
                     /db_xref="GeneID:1235235"
                     /translation="MYRLYNHAIARFSLDCFEGLTGDKTCRLKAQAWLIAELHQLGYR
                     DMPQKRCCAYRGLRHSYRKIAKEPRSEQTSSCEEADMKPATILLAEDEALLLLDYEAA
                     LADAGFVVVAVARGGKAIEVWRSADSEVAGVATDIRFYELPNGWSVARVAREIYPGIP
                     IVYGTGHGALEWRSRGVANSILLEKPFALAQLVTAVSELLNEPVLLSVAPDPNP"
     misc_feature    complement(14495..14797)
                     /locus_tag="SMa0021"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(14537..14542,14600..14602,14660..14662,
                     14687..14689))
                     /locus_tag="SMa0021"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(14687..14689)
                     /locus_tag="SMa0021"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(14660..14665,14666..14671))
                     /locus_tag="SMa0021"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(14534..14542)
                     /locus_tag="SMa0021"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            15716..15807
                     /gene="selC"
                     /locus_tag="SMa0022"
                     /note="selenocysteine tRNA in FdH cluster"
                     /db_xref="GeneID:1235236"
     tRNA            15716..15807
                     /gene="selC"
                     /locus_tag="SMa0022"
                     /product="tRNA-Sec"
                     /note="SMA0022"
                     /db_xref="GeneID:1235236"
     gene            15826..16209
                     /locus_tag="SMa5014"
                     /db_xref="GeneID:6435250"
     CDS             15826..16209
                     /locus_tag="SMa5014"
                     /note="Similar to hypothetical protein from XautDRAFT_0850
                     [Xanthobacter autotrophicus Py2]"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000328.1"
                     /db_xref="GI:193782527"
                     /db_xref="GeneID:6435250"
                     /translation="MTAETPGTDFDDWVVSTYRDVGSFTMLFVLLRIGDTSVDLLRSA
                     YLHVVGDELRWPDMVQLFRGAGVEWSGAVFYRAGREGLVEDGEAKSRLASLVFKLNED
                     RSLISEGDLFNADGLRLTIEEIKPH"
     gene            complement(16251..17318)
                     /locus_tag="SMa0025"
                     /db_xref="GeneID:1235237"
     CDS             complement(16251..17318)
                     /locus_tag="SMa0025"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction, C-terminus similar to
                     hypothetical protein HI1048 - Haemophilus influenzae
                     (strain Rd KW20) with transglutaminase-like superfamily
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435258.2"
                     /db_xref="GI:193782528"
                     /db_xref="GeneID:1235237"
                     /translation="MLNRRRFLTNAATAAAATLWVSKGGMQARAEEAGNGSPWRRFEI
                     ITKVDLQPAEGPAQLWLPVVRSAGDYQKADAPLWVSNSTDIRMEKDPSSGADILRVMW
                     EDEPRRVIEVTQHVATRDRRVTSKIAATEAELQHELRGTPSMPVDGIVKTTAMRIVEG
                     RDRAEDRARAIYDWVIDNTFRDANIDGCGVGNARDMLETGYFGGKCADISSLFVSLAR
                     AAGLPARDVFGIRVADSADFKSLGRSGDITKAQHCRAEVYLDAHGWVPVDPADVRKVV
                     LEENLPLDNPAVRAFREKAYGNWEMNWVGYNTARDLVLPGGELRQGFLMYPAAVTSRG
                     ELDCLNPQTFAYSITSREITA"
     misc_feature    complement(16362..17222)
                     /locus_tag="SMa0025"
                     /note="Transglutaminase-like enzymes, putative cysteine
                     proteases [Amino acid transport and metabolism]; Region:
                     COG1305"
                     /db_xref="CDD:224224"
     misc_feature    complement(16512..16868)
                     /locus_tag="SMa0025"
                     /note="Transglutaminase-like superfamily; Region:
                     Transglut_core; pfam01841"
                     /db_xref="CDD:250908"
     gene            complement(17424..17852)
                     /locus_tag="SMa0026"
                     /db_xref="GeneID:1235238"
     CDS             complement(17424..17852)
                     /locus_tag="SMa0026"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435259.1"
                     /db_xref="GI:16262466"
                     /db_xref="GeneID:1235238"
                     /translation="MEQAFPNIVGGDEKEIAMSNLAPTRPSACVLAAFCLLIALAPNP
                     ASAQNTNERADCAAAAGKAEPATPPDRASADGTAPGNSGSTGWTGGTGGAHIGTNPQG
                     ATAGSTTWQPPTARGIDLATAPEIPAPETAAPGTQTPTDC"
     gene            complement(17865..18914)
                     /gene="selD"
                     /locus_tag="SMa0028"
                     /db_xref="GeneID:1235239"
     CDS             complement(17865..18914)
                     /gene="selD"
                     /locus_tag="SMa0028"
                     /EC_number="2.7.9.3"
                     /function="Small molecule metabolism; Global functions"
                     /note="catalyzes the formation of selenophosphate from
                     selenide and ATP"
                     /codon_start=1
                     /transl_table=11
                     /product="selenophosphate synthetase"
                     /protein_id="NP_435260.1"
                     /db_xref="GI:16262467"
                     /db_xref="GeneID:1235239"
                     /translation="MNTLAPRLTDLAHGGGCGCKLAPSVLQQLLANQPAARPFAQLLV
                     GNDMADDAAVWQVDDNTCVIATTDFFMPIVDDPRDFGRIAATNAISDVYAMGGKPILA
                     LAIVGMPINKLDSTTIAKILEGGASICAEAGIPVAGGHSIDSVEPIYGLAVIGLCHPS
                     EVRRNGGVKAGDALILTKGIGVGIYSAAIKKNALPPGCYEEMIGSTTLLNRIGADLAA
                     DPDVHALTDVTGFGVLGHGLEMARASQLSLTLRLSAIPFLSQAYMLAEQGFITGASGR
                     NWASYGADVVLPDDLPDWQRLLLADPQTSGGLLVACAPEKAGALVEKVRLAGYPLAGI
                     VGTAAAGAAQIKVIS"
     misc_feature    complement(17871..18914)
                     /gene="selD"
                     /locus_tag="SMa0028"
                     /note="selenophosphate synthetase; Provisional; Region:
                     PRK00943"
                     /db_xref="CDD:234870"
     misc_feature    complement(17904..18893)
                     /gene="selD"
                     /locus_tag="SMa0028"
                     /note="Selenophosphate synthetase  (SelD) catalyzes the
                     conversion of selenium to selenophosphate which is
                     required by a number of bacterial, archaeal and eukaryotic
                     organisms for synthesis of Secys-tRNA, the precursor of
                     selenocysteine in selenoenzymes. The...; Region: SelD;
                     cd02195"
                     /db_xref="CDD:100031"
     misc_feature    complement(order(18198..18200,18459..18461,18471..18476,
                     18495..18497,18594..18596,18603..18605,18612..18614,
                     18642..18644,18708..18710,18714..18716,18720..18731))
                     /gene="selD"
                     /locus_tag="SMa0028"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100031"
     misc_feature    complement(order(18495..18503,18642..18644,18654..18656))
                     /gene="selD"
                     /locus_tag="SMa0028"
                     /note="putative ATP binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100031"
     gene            complement(19209..19436)
                     /locus_tag="SMa0031"
                     /db_xref="GeneID:1235240"
     CDS             complement(19209..19436)
                     /locus_tag="SMa0031"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435261.1"
                     /db_xref="GI:16262468"
                     /db_xref="GeneID:1235240"
                     /translation="MSEWIDFERWPDCKRMERPGIVFEVTNGDQTLLTGCVVPLPLPS
                     DWVAHPLRFRAVPQPRPRHSSPLPKPAGPQQ"
     misc_feature    complement(19281..>19409)
                     /locus_tag="SMa0031"
                     /note="NADH dehydrogenase subunit C; Validated; Region:
                     PRK07735"
                     /db_xref="CDD:236081"
     gene            complement(19453..21108)
                     /locus_tag="SMa0034"
                     /db_xref="GeneID:1235241"
     CDS             complement(19453..21108)
                     /locus_tag="SMa0034"
                     /EC_number="3.4.24.40"
                     /function="Macromolecule metabolism; Macromolecule
                     degradation; degradation of proteins, peptides,
                     glycopeptides"
                     /note="glimmer prediction; partially similar to serralysin
                     (Serratia protease) precursor"
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="NP_435262.1"
                     /db_xref="GI:16262469"
                     /db_xref="GeneID:1235241"
                     /translation="MPAATTYATTGNAYIDGLLGDWKWGIKDFTFSFPTSASFYSAGY
                     GNGEPLKGFAALSGAQQAATRAALDQFSSVANVTFTEITESATKHADLRLASSDAPST
                     AWAYFPSTAAEGGDAWFNKSSGHYSRPVKGNYAYVTFLHETGHALGLEHAHEGNVMPV
                     NRDSMEYTVMSYRSYVGASTTTGYTNETWGYAQSLMMYDIAALQHMYGADFTTHSENT
                     TYRWSPTSGEMFVNGMGQGAPGGNKILLTVWDGGGTDTYDFSNYTTALKVDLRPGEWT
                     TTSAAQLAKLHYDGSKVAIGNIANALQYQGDTRSLIENAKGGAGNDAITGNAAANALW
                     GNGGNDRLIGGDGNDNLAGGAGADRLDGGNGTDLANYSNATAGMVADLYSPGSNTGEA
                     AGDTYVSIERLYGSAFNDTLRGDNRANLLNGLAGNDMLNGRDGNDTLIGGNGADRLIG
                     GGGADTFVFQTTAQSAPAFRDVIDDFASGVDRMDLRSIDASSKAIGDQAFLFIGSSAF
                     HGKAGELNFRSGIVSGDVNGDGLADFQIRVMNLSALSGSDFLL"
     misc_feature    complement(19672..21108)
                     /locus_tag="SMa0034"
                     /note="RTX toxins and related Ca2+-binding proteins
                     [Secondary metabolites biosynthesis, transport, and
                     catabolism]; Region: COG2931"
                     /db_xref="CDD:225483"
     misc_feature    complement(20485..21024)
                     /locus_tag="SMa0034"
                     /note="Zinc-dependent metalloprotease, serralysin_like
                     subfamily. Serralysins and related proteases are important
                     virulence factors in pathogenic bacteria. They may be
                     secreted into the medium via a mechanism found in
                     gram-negative bacteria, that does not...; Region:
                     ZnMc_serralysin_like; cd04277"
                     /db_xref="CDD:239804"
     misc_feature    complement(order(20656..20658,20674..20676,20683..20688))
                     /locus_tag="SMa0034"
                     /note="active site"
                     /db_xref="CDD:239804"
     gene            21429..23051
                     /locus_tag="SMa0036"
                     /db_xref="GeneID:1235242"
     CDS             21429..23051
                     /locus_tag="SMa0036"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; similar to ABC transporter
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435263.1"
                     /db_xref="GI:16262470"
                     /db_xref="GeneID:1235242"
                     /translation="MIRIENISKSNSHRILYIEASAALNRGEKIGLVGPNGAGKTTLF
                     RMITGQELPDEGQVAVEKGMTIGYFDQDVGEMAGRSAVAEVMEGAGPISAVAAELHEL
                     ETAMSDPDRMDEMDAIVERYGEVQARYEELDGYALEGRAREVLAGLSFSQEMMDGDVA
                     KLSGGWKMRVALARILLMRPDVMLLDEPSNHLDLESLIWLENFLKGYDGALLMTSHDR
                     EFMNRIVTKIIEIDGGALTTYSGDYGFYDEQRALNARQQQAQFERQQAMLAKEIKFIE
                     RFKARASHASQVQSRVKKLEKIDRVEPPRRRQTVAFEFLPAPRSGEDVVNLKSVHKTY
                     GSRTIYDGLDFMVRRRERWCIMGINGAGKSTLLKLVTGTTNPDKGSVSLGASVKLGYF
                     AQHSMDLLDGESTILQWLEERFPKAGQAPLRALAGCFGFSGDDVEKRCRVLSGGEKAR
                     LVMAAMLFDPPNFLVLDEPTNHLDLDTKEMLIKALSAYQGTMLFVSHDRRFLSALSNR
                     VLELTPDGINQYGGGYSEYVERTGQEAPGLRG"
     misc_feature    21429..23030
                     /locus_tag="SMa0036"
                     /note="ATPase components of ABC transporters with
                     duplicated ATPase domains [General function prediction
                     only]; Region: Uup; COG0488"
                     /db_xref="CDD:223562"
     misc_feature    21432..22130
                     /locus_tag="SMa0036"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     misc_feature    22113..22370
                     /locus_tag="SMa0036"
                     /note="ABC transporter; Region: ABC_tran_2; pfam12848"
                     /db_xref="CDD:257346"
     misc_feature    22401..22976
                     /locus_tag="SMa0036"
                     /note="ATP-binding cassette domain of elongation factor 3,
                     subfamily F; Region: ABCF_EF-3; cd03221"
                     /db_xref="CDD:213188"
     gene            complement(23398..24297)
                     /locus_tag="SMa0039"
                     /db_xref="GeneID:1235243"
     CDS             complement(23398..24297)
                     /locus_tag="SMa0039"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; similar to LysR-family
                     transcriptional regulators with HTH domain"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435264.2"
                     /db_xref="GI:193782529"
                     /db_xref="GeneID:1235243"
                     /translation="MDRLTSMAVFVKAVDLGSFAAAAEALGLSGPMVGKHVRSLEDRL
                     GVQLINRTTRRQSLTEFGYVYYERCRVVLAEAQAADALASDQLSEPRGKLRVTMPVHF
                     GRHCVTPVLLELARKYPALELDLSFNDRIIDLAEDGFDLSIRTGVLEDRAGLIARRVA
                     RQPMIVCASPSYLESHGCPEAPEDLAQHAAVVYRRSGPVSPWLFPRPGQSSSEVTPLH
                     RFRLDDLDAIADAAARGLGLAWLPYWLVRGRIEAGTLVRLLPEQPPFLYDCHAVWLQT
                     PHLPLKVRVAVDALAAQLPSFMT"
     misc_feature    complement(23428..24297)
                     /locus_tag="SMa0039"
                     /note="transcriptional regulator; Provisional; Region:
                     PRK10632"
                     /db_xref="CDD:182601"
     misc_feature    complement(24112..24288)
                     /locus_tag="SMa0039"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(23428..24024)
                     /locus_tag="SMa0039"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_6; cd08475"
                     /db_xref="CDD:176164"
     misc_feature    complement(order(23491..23493,23572..23574,23623..23625,
                     23812..23814,23818..23820,23863..23865,23980..23982,
                     23992..23994))
                     /locus_tag="SMa0039"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176164"
     misc_feature    complement(order(23596..23598,23605..23610,23629..23643,
                     23731..23733,23917..23937,23941..23943,23953..23955,
                     23962..23967,23971..23976,23986..23991))
                     /locus_tag="SMa0039"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176164"
     gene            24399..25388
                     /locus_tag="SMa0041"
                     /db_xref="GeneID:1235244"
     CDS             24399..25388
                     /locus_tag="SMa0041"
                     /codon_start=1
                     /transl_table=11
                     /product="quinone oxidoreductase"
                     /protein_id="NP_435265.2"
                     /db_xref="GI:193782530"
                     /db_xref="GeneID:1235244"
                     /translation="MARVVRFHELGGPEVLRIEDVHVPEPGPHEVRIRVKALGLNRAE
                     ALLRSGAYIETATFPSGLGLEAAGFVEKVGPGVQGFIPGDPVSVLPPKSMIRWPAYGE
                     LAIFPAALLVRHPPSLSFEEAAAVWMQYLTAYGGLVDIGGLRRGDFVAITAASSSVGL
                     AAIQIANMVGAIPVAVTRTSAKRQGLLEAGAAHVIASMEEDLEAQLKRVSGQHGIRVV
                     FDPVGGPIFEPLAAAMAWGGILVEYGGLSPEKTPFPLFAVLSKSLTLRGYLVHELLAD
                     PGRLERAKAFILDGLVSGALRPIIARAFPFDQIVEAHRFLESNEQFGKIVVTV"
     misc_feature    24402..25385
                     /locus_tag="SMa0041"
                     /note="Medium chain dehydrogenases/reductase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR2; cd08268"
                     /db_xref="CDD:176229"
     misc_feature    24402..25385
                     /locus_tag="SMa0041"
                     /note="NADPH:quinone reductase and related Zn-dependent
                     oxidoreductases [Energy production and conversion /
                     General function prediction only]; Region: Qor; COG0604"
                     /db_xref="CDD:223677"
     misc_feature    order(24519..24527,24534..24536,24762..24764,24792..24794,
                     24855..24866,24870..24875,24927..24932,24942..24944,
                     24987..24989,25059..25064,25068..25070,25125..25130,
                     25200..25208)
                     /locus_tag="SMa0041"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176229"
     gene            complement(25417..25683)
                     /locus_tag="SMa0044"
                     /db_xref="GeneID:1235245"
     CDS             complement(25417..25683)
                     /locus_tag="SMa0044"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; start codon changed based on
                     codon usage pattern"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435266.1"
                     /db_xref="GI:16262473"
                     /db_xref="GeneID:1235245"
                     /translation="MCRNIKPLFNFDPPATDEEVRDAALQFVRKLSGTTKPSERNEAA
                     FERAVDSIAACARELLDALETSQPPRNREEVAARARERSAMRFA"
     misc_feature    complement(25420..25683)
                     /locus_tag="SMa0044"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5552"
                     /db_xref="CDD:227839"
     gene            complement(25848..26597)
                     /gene="cah"
                     /locus_tag="SMa0045"
                     /db_xref="GeneID:1235246"
     CDS             complement(25848..26597)
                     /gene="cah"
                     /locus_tag="SMa0045"
                     /EC_number="4.2.1.1"
                     /function="Small molecule metabolism; energy metabolism,
                     carbon; aerobic respiration"
                     /codon_start=1
                     /transl_table=11
                     /product="carbonic anhydrase"
                     /protein_id="NP_435267.1"
                     /db_xref="GI:16262474"
                     /db_xref="GeneID:1235246"
                     /translation="MERRDFLRGLALLAACPLCVKTAYAAEGVHWRYEGEEGPEHWGS
                     LAKENSACSAGSQQSPIDIRGAVKADIPELTADWKSGGTILNNGHTIQVNAAGGTLRR
                     GDKSYDLVQYHFHSPSEHFVDGKSFPMEAHFVHKNAETGTLGVLGVFLVPGAANSTFA
                     SLAEKFPRNPGEESPLITIDPKGLLPSSLSYWTYEGSLTTPPCSEIVDWMVAMEAVEV
                     DPGDIKKFTALYSMNARPALAGNRRYVLSSS"
     misc_feature    complement(25857..26486)
                     /gene="cah"
                     /locus_tag="SMa0045"
                     /note="Carbonic anhydrase alpha, prokaryotic-like
                     subfamily. Carbonic anhydrases (CAs) are zinc-containing
                     enzymes that catalyze the reversible hydration of carbon
                     dioxide in a two-step mechanism: a nucleophilic attack of
                     a zinc-bound hydroxide ion on carbon...; Region:
                     alpha_CA_prokaryotic_like; cd03124"
                     /db_xref="CDD:239398"
     misc_feature    complement(order(26001..26003,26202..26204,26241..26243,
                     26253..26255,26259..26261,26265..26267,26331..26333))
                     /gene="cah"
                     /locus_tag="SMa0045"
                     /note="active site"
                     /db_xref="CDD:239398"
     misc_feature    complement(order(26202..26204,26253..26255,26259..26261))
                     /gene="cah"
                     /locus_tag="SMa0045"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:239398"
     gene            26906..27154
                     /locus_tag="SMa5015"
                     /db_xref="GeneID:6435251"
     CDS             26906..27154
                     /locus_tag="SMa5015"
                     /note="Similar to an approximately 75 amino acid-central
                     region of GntR-family transcriptional regulators; Possible
                     ORF fragment"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000329.1"
                     /db_xref="GI:193782531"
                     /db_xref="GeneID:6435251"
                     /translation="MVPEVLRHLESESLVANLPNKGPIVSRLDLNEAKQIDQIRVAVG
                     GRATVRGAARPAIVEALEASFKGIRECYASRLRRAPAT"
     misc_feature    <26915..>27130
                     /locus_tag="SMa5015"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     gene            27295..27516
                     /locus_tag="SMa0050"
                     /db_xref="GeneID:1235248"
     CDS             27295..27516
                     /locus_tag="SMa0050"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; partial homology to  succinate
                     semialdehyde dehydrogenase; looks like fragmented gene"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435269.1"
                     /db_xref="GI:16262476"
                     /db_xref="GeneID:1235248"
                     /translation="MQVGFYDDFAERLAAKVRKMKVDNGFEPGADTGPLISQKALARV
                     QEHISDAVAKGRECGLFFEPTVLMGGRWR"
     misc_feature    <27298..>27495
                     /locus_tag="SMa0050"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     gene            27507..27713
                     /locus_tag="SMa0052"
                     /db_xref="GeneID:1235249"
     CDS             27507..27713
                     /locus_tag="SMa0052"
                     /function="Miscellaneous; Unknown"
                     /note="looks like fragmented gene; glimmer prediction;
                     partial homology to  succ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435270.1"
                     /db_xref="GI:16262477"
                     /db_xref="GeneID:1235249"
                     /translation="MEMKVARGNFGPVASLFKFSTEEAVFEMANNTEFGLASYFYSKD
                     ISKIFRVPEALEYGMVGINAGLIH"
     misc_feature    <27510..27707
                     /locus_tag="SMa0052"
                     /note="NAD(P)+-dependent aldehyde dehydrogenase
                     superfamily; Region: ALDH-SF; cl11961"
                     /db_xref="CDD:264488"
     gene            complement(28295..29428)
                     /locus_tag="SMa0056"
                     /db_xref="GeneID:1235250"
     CDS             complement(28295..29428)
                     /locus_tag="SMa0056"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism"
                     /note="glimmer prediction; start codon changed based on
                     similarity in protein database"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase/enolase"
                     /protein_id="NP_435271.1"
                     /db_xref="GI:16262478"
                     /db_xref="GeneID:1235250"
                     /translation="MKRPRITDIRATTVTVPLEAPLRHSNGAHWGRFVRTIVEVETDV
                     GIVGLGEMGGGGESAEAAFRALKPYLLGHDTFELENLRFMICNPTASLYNNRTQMHAA
                     IEFACLDIMGKFLGVPVCDLLGGKMRDAVPFASYMFFRLPNKDTGEGETRTADQLIEQ
                     TLALKKKCGFTSHKLKSGVFPPDYELEVFRAWAKALGPDSVRYDPNAAFSVEEAIRFA
                     KGIEDLNNDYYEDPTWGLNGMRRVRENTTMPLATNTVVVNFEQLATNILNPAVDVILL
                     DTTFWGGSALREGGGRLRDLPTRHCGTFVGRTRHPARHHASPRRGSPEPRLPRGCALS
                     PTHGRYHRRRPDALRERHYQGADGAGSRGGARSRQARAVRRPP"
     misc_feature    complement(28298..29419)
                     /locus_tag="SMa0056"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    complement(<28580..29416)
                     /locus_tag="SMa0056"
                     /note="Enolase-superfamily, characterized by the presence
                     of an enolate anion intermediate which is generated by
                     abstraction of the alpha-proton of the carboxylate
                     substrate by an active site residue and is stabilized by
                     coordination to the essential Mg2+ ion; Region:
                     enolase_like; cl17188"
                     /db_xref="CDD:266540"
     misc_feature    complement(order(28670..28672,28739..28741,28817..28819))
                     /locus_tag="SMa0056"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:238188"
     misc_feature    complement(28598..28600)
                     /locus_tag="SMa0056"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238188"
     gene            complement(29492..30688)
                     /locus_tag="SMa0058"
                     /db_xref="GeneID:1235251"
     CDS             complement(29492..30688)
                     /locus_tag="SMa0058"
                     /EC_number="5.-.-.-"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="N-acylglucosamine 2-epimerase"
                     /protein_id="NP_435272.1"
                     /db_xref="GI:16262479"
                     /db_xref="GeneID:1235251"
                     /translation="MKPIPDFRSKDFLLAHMREIMDFYHPICLNEEDGGYYNEYRDDG
                     FITDRKTQHLVSTTRFIFNYATAAVLFERPDFAEAAAHGVRYLDEVHRDPEHGGYYWL
                     MRGRDAVDATKHCYGHAFVLLAYATAMKAGIPGTGARVSQTWDLLENRFWEPDRELYK
                     DEVSRDWGATSPYRGQNANMHMTEAMLAAYEATGEIRYLDRAETLARRICVELAANTQ
                     DVVWEHYRQDWSVDWDYNKDDPKHLFRPYGYQPGHMTEWTKLLLILERYRPQDWLLPK
                     ALLLYETALAKSADLEFGGMHYSYGPEGKLYDLDKYHWVHCETIAAAAALAGRTGRER
                     YWQDYDRLWRYSWRHLIDHEYGCWFRILSPDGVKQSDIKSPSGKTDYHPFGACYEILR
                     VLGEAQ"
     misc_feature    complement(29498..30685)
                     /locus_tag="SMa0058"
                     /note="AGE domain; N-acyl-D-glucosamine 2-epimerase
                     domain; Responsible for intermediate epimerization during
                     biosynthesis of N-acetylneuraminic acid. Catalytic
                     mechanism is believed to be via nucleotide elimination and
                     readdition and is ATP modulated. AGE is...; Region: AGE;
                     cd00249"
                     /db_xref="CDD:238153"
     misc_feature    complement(order(29501..29503,29513..29515,30446..30448,
                     30485..30487,30635..30637,30656..30658))
                     /locus_tag="SMa0058"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238153"
     misc_feature    complement(order(29534..29536,29543..29548,29558..29560,
                     29735..29737,29747..29752,29909..29914,29921..29923,
                     29930..29932,30137..30139,30146..30151,30158..30160,
                     30320..30322,30329..30331,30341..30343,30503..30505,
                     30512..30514,30524..30526))
                     /locus_tag="SMa0058"
                     /note="putative active cleft [active]"
                     /db_xref="CDD:238153"
     gene            complement(30703..31488)
                     /locus_tag="SMa0059"
                     /db_xref="GeneID:1235252"
     CDS             complement(30703..31488)
                     /locus_tag="SMa0059"
                     /note="glimmer prediction; similar to short chain alcohol"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain alcohol dehydrogenase"
                     /protein_id="NP_435273.1"
                     /db_xref="GI:16262480"
                     /db_xref="GeneID:1235252"
                     /translation="MSDFNGKSIVVTGGSLGMGLACAHRFAAGGGKVTIVANDKASVD
                     EAVTSIGDNAAGFVGDVRSKADMNAAVQAAVSRHGGVDILACCAGIQRYGTVVDTADE
                     VWDDVLDINLKGIFLASKFAIPEMRKRGGGAIVAISSVQAYASQTGVAAYTASKGAIN
                     ALVRAMALDHAGDNITVNAVCPASIDTPMLRWAADLWKGEGTVEATLETWGKGHPLGR
                     VGKPSEVAELVAFLASEKARFITGADIKIDGGVLSKLGIVIPD"
     misc_feature    complement(30706..31488)
                     /locus_tag="SMa0059"
                     /note="aldose dehydrogenase; Validated; Region: PRK06398"
                     /db_xref="CDD:235794"
     misc_feature    complement(30745..31464)
                     /locus_tag="SMa0059"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(30925..30930,30934..30945,31021..31023,
                     31033..31035,31072..31080,31159..31161,31222..31230,
                     31306..31314,31372..31380,31435..31446,31450..31452))
                     /locus_tag="SMa0059"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(31021..31023,31033..31035,31072..31074,
                     31156..31158))
                     /locus_tag="SMa0059"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(31488..32423)
                     /locus_tag="SMa0060"
                     /db_xref="GeneID:1235253"
     CDS             complement(31488..32423)
                     /locus_tag="SMa0060"
                     /note="glimmer prediction; similar to Ca2+-binding protein
                     regucalcin highly conserved in vertebrate species"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolactonase"
                     /protein_id="NP_435274.1"
                     /db_xref="GI:16262481"
                     /db_xref="GeneID:1235253"
                     /translation="MSATVSLLLDAKDIVGESILWCGDEKALYWVDIVGKRIHRLEPE
                     NGRHDTWPTPDFVTSIGMRKDGGFIVGLSRNVCLWTPDGPFEEFAMPEPDLPENRLNE
                     GRVAPDGSFWVATMQSNLDAGGSPKDMDRQSGAVYRIDPTGHVSQLTPNEYGITNTMG
                     WTRDNRFFFADTLANEIYMFDCDLAARRIDNRRTIVAGFARGLPDGSCLDADDRLWNC
                     RVAGGAAVAGFDGAGRLMHLIELPASWPTSCTFGGPVLSTLYVTSARFTMTGDHLDMH
                     PLEGGLFAVEGVGHGVEEPKFGQAPDKFPSVSEIA"
     misc_feature    complement(31533..32423)
                     /locus_tag="SMa0060"
                     /note="Gluconolactonase [Carbohydrate transport and
                     metabolism]; Region: COG3386"
                     /db_xref="CDD:225921"
     gene            32634..33323
                     /locus_tag="SMa0062"
                     /db_xref="GeneID:1235254"
     CDS             32634..33323
                     /locus_tag="SMa0062"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; with gntR domain"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435275.1"
                     /db_xref="GI:16262482"
                     /db_xref="GeneID:1235254"
                     /translation="MTRDIKISAAEHCYRTLSRKIIGLELKPNEPIGEHALAGLLGVS
                     RTPVREALSRLSAEGLVDLRSRAGVVVAPIRMDAVRTAQFVREQLELAIVAEAAQQSN
                     RRVLLGIRQAIEEQELAILEDNPDLFFECDERMHALYCSLAGRDGVWAFISDAKKHMD
                     RVRRLSIQAGQLDQLVEDHRRVLKAVGEGDATKAQEIMRLHLRRAVVDLGELSQRFSS
                     YFALDAAGDAR"
     misc_feature    32634..33296
                     /locus_tag="SMa0062"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    32673..32849
                     /locus_tag="SMa0062"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(32733..32738,32760..32774,32778..32783,32790..32792,
                     32820..32825,32829..32840)
                     /locus_tag="SMa0062"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    32886..33245
                     /locus_tag="SMa0062"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            33453..34187
                     /locus_tag="SMa0063"
                     /db_xref="GeneID:1235255"
     CDS             33453..34187
                     /locus_tag="SMa0063"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; with gntR transcriptional
                     regulator domain"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435276.2"
                     /db_xref="GI:193782532"
                     /db_xref="GeneID:1235255"
                     /translation="MIELKAEEQSSSGRSGAEGLLGGVMTAVKTHIRENGLQVGDSLP
                     SEGTFAEKLGVSRSVVREAYRSLAALTLIDIGNGRRPRVAAPKADVLALVTDHAVHTD
                     QVTIQQIFDVRRTVERRTVVLAAMRRTDKEAAEIVALAEAMQRDFDQPVRVMEHDIAF
                     HEAIGRASRNPMFALIVGSFHVVTRHTWPIGWASRGSNETRQESIDGHMTIAQAIANG
                     DPAKGEEAMVEHFDLTVKALLAAGVY"
     misc_feature    33522..34178
                     /locus_tag="SMa0063"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    33522..33704
                     /locus_tag="SMa0063"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    order(33582..33584,33588..33593,33615..33629,33633..33638,
                     33645..33647,33675..33680,33684..33695)
                     /locus_tag="SMa0063"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    33774..34148
                     /locus_tag="SMa0063"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            34190..35392
                     /locus_tag="SMa0064"
                     /db_xref="GeneID:1235256"
     CDS             34190..35392
                     /locus_tag="SMa0064"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; with homology to the domain of
                     mandelate racemase / muconate lactonizing enzyme family"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydratase/enolase"
                     /protein_id="NP_435277.2"
                     /db_xref="GI:193782533"
                     /db_xref="GeneID:1235256"
                     /translation="MKITELETVRVRDFPNILWVRIHTDEGLVGLGETFFMAQTVETY
                     IHEVVAPKLVGRDPLEIDRISKDLTGYLGFRSTGAEMRGNSAVDIGLWDLFGKATNLP
                     IAQLLGGFSRREIRTYNTCAGNTYMRDAKGQQTANYGIGGPRRDYDDLNGFLERADEL
                     AEDLLSEGITAMKIWPFDIAAEKSGGQYISGPDLRKALEPFEKIRKRVGDRIDIMVEF
                     HSMWQLTPAIQIARALEPYATFWHEDPIKMDSLSSLKRYAAASRAPLCASETLATRWA
                     FRDLMETDAAGVVMLDLSWCGGISEAKKISTMAEAWHLPVAPHDCTGPVVLAASTHLS
                     LNAPNALVQESVRAYYKTWYADLTTQLPTVTNGMITIPPGAGHGVDLAPDLDRKFEVS
                     RRSSQIED"
     misc_feature    34190..35371
                     /locus_tag="SMa0064"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    34193..35329
                     /locus_tag="SMa0064"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily. Enzymes of this subgroup share three
                     conserved carboxylate ligands for the essential divalent
                     metal ion (usually Mg2+), two aspartates and a glutamate,
                     and conserved catalytic residues; Region: MR_like;
                     cd03316"
                     /db_xref="CDD:239432"
     misc_feature    order(34706..34708,34712..34714,34838..34840,34916..34918,
                     34994..34996,35063..35065,35144..35146,35219..35221)
                     /locus_tag="SMa0064"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239432"
     gene            35455..36147
                     /locus_tag="SMa0065"
                     /db_xref="GeneID:1235257"
     CDS             35455..36147
                     /locus_tag="SMa0065"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; similar to transcriptional
                     regulator with gntR domain"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435278.1"
                     /db_xref="GI:16262485"
                     /db_xref="GeneID:1235257"
                     /translation="MQNIKPQRVLSAIEAVGPQVYRILREQIIQAELVPGARISEAEI
                     ARSLSISRQPVREAFIKLAEEGLVQVLPQRGTYVTRISTASVMDVRFVREAIEADIVR
                     QVAGEHPAAIVDELREQIARQKQVPHDDRAAFLRLDELFHHTLATAAGRAHAWSVIES
                     VKAQMDRVRFLSVDDLQIGRLIEQHERIVDAIAARDVGGAEQALRMHLREILKSLPEI
                     ARSREEFFDGTG"
     misc_feature    35509..36135
                     /locus_tag="SMa0065"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    35509..35691
                     /locus_tag="SMa0065"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(35575..35580,35602..35616,35620..35625,35632..35634,
                     35662..35667,35671..35682)
                     /locus_tag="SMa0065"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    35716..36081
                     /locus_tag="SMa0065"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            36205..37167
                     /locus_tag="SMa0067"
                     /db_xref="GeneID:1235258"
     CDS             36205..37167
                     /locus_tag="SMa0067"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; similar to sugar ABC
                     transporter periplasmic sugar-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435279.1"
                     /db_xref="GI:16262486"
                     /db_xref="GeneID:1235258"
                     /translation="MIAGTALGLTLMAPAASAEGLSIAFISHSSASNTFWQAVKKGYD
                     DACEKVGASCQLILTQTEGAVEQAVANLQAAIASRPDAIFVAIVDNNAYDNVIKEAVD
                     AGILVLAVNVDDSEGAKGNARKAFIGQGFTAAGYSLAKAQSENFPKDGPLNLLVGVNA
                     PGQTWSEQRAGGVTKFLEEYKAEHSDREVNITRIDSATDLALTADRIGAYLNANPDTA
                     AYFDTGYWHAGVAKVLKDRGIEPGKVLLGGFDLVPEVLQQMEAGYVQVQVDQQPYMQG
                     FIPVMQAYLWKTAGLTPSDVDTGQGIVTPKDVPTILELAKQGLR"
     misc_feature    36205..37158
                     /locus_tag="SMa0067"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    36268..37113
                     /locus_tag="SMa0067"
                     /note="Periplasmic sugar-binding domain of uncharacterized
                     ABC-type transport systems; Region:
                     PBP1_ABC_sugar_binding_like_4; cd06312"
                     /db_xref="CDD:107307"
     misc_feature    order(36307..36309,36535..36537,36709..36711,36952..36954,
                     37012..37014)
                     /locus_tag="SMa0067"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107307"
     gene            37353..38336
                     /locus_tag="SMa0070"
                     /db_xref="GeneID:1235259"
     CDS             37353..38336
                     /locus_tag="SMa0070"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; C-terminal similar to sugar ABC
                     transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435280.1"
                     /db_xref="GI:16262487"
                     /db_xref="GeneID:1235259"
                     /translation="MKRFLKIYLDKPELAGLALLFVLVLVFQAKSNGILLSFENMRGV
                     MGLLPEMALVAIGVTLLMICGEFDLSVGSVFALMPMSMAVLLNSGVPFTVAVLLGLMI
                     CGAIGFINGYVTLQFSIPSFITTLGMLFIARSLTIVISGGFPPLLPPDLPTWLFTDYI
                     WQGSPFRMSFLWFVVIAALVAALLSLTNFGNWIRATGGFNEAAASMGIPVKRVKIVCF
                     MLCSVLAGFAGLLQVLRLGSPLPSIGEGLELQAVAAAVIGGTALAGGIGTVFGAIIGT
                     LLIRTIDNGLVLSRVDANWFKFAIGVLTMFAVIANAWMGKMSRKIKVEAHK"
     misc_feature    37497..38285
                     /locus_tag="SMa0070"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    37953..38009
                     /locus_tag="SMa0070"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            38333..39064
                     /locus_tag="SMa0072"
                     /db_xref="GeneID:1235260"
     CDS             38333..39064
                     /locus_tag="SMa0072"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; similar to sugar ABC transport
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435281.1"
                     /db_xref="GI:16262488"
                     /db_xref="GeneID:1235260"
                     /translation="MTTPIIECRNLQKWYSGVHALKNVDLTIHPGETVGLVGDNGAGK
                     STLIKILSGVHHQDSGDVLIEGRRVALRSPKDAMRYGLETIYQYNSMVPTMSIARNLF
                     IGREPMKWSVFGVGIMDQKRMRVESIQAIADVDLHLRSPDALVGELSGGQRQGVAIAR
                     AMHFKSKVLILDEPTNHLSVKETDKVIGFVRGLKAQGLTGIFISHNMQHVFQSCDRIV
                     AMARGEIVFDKPTADTSIDEVHALL"
     misc_feature    38339..39031
                     /locus_tag="SMa0072"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    38348..39010
                     /locus_tag="SMa0072"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    38444..38467
                     /locus_tag="SMa0072"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(38453..38458,38462..38470,38591..38593,38846..38851,
                     38945..38947)
                     /locus_tag="SMa0072"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    38582..38593
                     /locus_tag="SMa0072"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    38774..38803
                     /locus_tag="SMa0072"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    38834..38851
                     /locus_tag="SMa0072"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    38858..38869
                     /locus_tag="SMa0072"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    38933..38953
                     /locus_tag="SMa0072"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     gene            39072..39830
                     /gene="fabG"
                     /locus_tag="SMa0074"
                     /db_xref="GeneID:1235261"
     CDS             39072..39830
                     /gene="fabG"
                     /locus_tag="SMa0074"
                     /note="catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="NP_435282.1"
                     /db_xref="GI:16262489"
                     /db_xref="GeneID:1235261"
                     /translation="MTELSGKTILITGALGTLGRAQAERLGRAGAGLLLLLDRPGAEA
                     GEGFAASLAAAHETMAIYVGEDLNNLASAEKRAATLSSEHGGIDILINNAALIINKPF
                     EEFSLEEYEDQVRVNSSAAFALARAVTPGMKQKRYGKIVNFCSLTLNGRWDGYVPYVA
                     SKGAMLGLTKALARELGPHGVRVNAVSPGAVVSEAEERVFADRLQQYNDWIVENQSLK
                     ARIQPSDVADLVHFLVSPASDMISGQNIAIDGGW"
     misc_feature    39072..39827
                     /gene="fabG"
                     /locus_tag="SMa0074"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK12825"
                     /db_xref="CDD:237218"
     misc_feature    39096..39818
                     /gene="fabG"
                     /locus_tag="SMa0074"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(39108..39110,39114..39125,39183..39191,39264..39272,
                     39348..39356,39417..39419,39498..39506,39543..39545,
                     39555..39557,39633..39644,39648..39653)
                     /gene="fabG"
                     /locus_tag="SMa0074"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(39420..39422,39504..39506,39543..39545,39555..39557)
                     /gene="fabG"
                     /locus_tag="SMa0074"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            39830..40717
                     /locus_tag="SMa0077"
                     /db_xref="GeneID:1235262"
     CDS             39830..40717
                     /locus_tag="SMa0077"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435283.1"
                     /db_xref="GI:16262490"
                     /db_xref="GeneID:1235262"
                     /translation="MPAIELSNGEARLLARPDLGAGLTAFDVLHDGVWQAIFRRVDPS
                     TAHPFALSNILLVPFSGRVSGGGFTFDGTFHALPRNVETELYPIHGNGFSAAWDVASL
                     SADLLTLTLSAEGPGPFRYDATMSYRLQGAGLLMELSLVNRARIRLPYGAGFHPWFVR
                     EPDTTLHAPARGVWLEQSDHLPKAHDAIAAQADLDFNRPKPLPARWINNWFDGWDGKA
                     RIHWPSRGLAVDVDASEGLRQYVVFSPAAAADFFCFEPVTHPVDAFNLPGKAEAHGLK
                     ILEPDESLAVSARVAADFG"
     misc_feature    39863..40702
                     /locus_tag="SMa0077"
                     /note="aldose 1-epimerase, similar to Escherichia coli
                     YphB; Region: Aldose_epim_Ec_YphB; cd09021"
                     /db_xref="CDD:185698"
     misc_feature    order(40013..40015,40094..40096,40292..40294,40298..40300,
                     40451..40453,40553..40555,40592..40594)
                     /locus_tag="SMa0077"
                     /note="active site"
                     /db_xref="CDD:185698"
     misc_feature    order(40292..40294,40592..40594)
                     /locus_tag="SMa0077"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:185698"
     gene            40959..41981
                     /locus_tag="SMa0078"
                     /db_xref="GeneID:1235263"
     CDS             40959..41981
                     /locus_tag="SMa0078"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; similar to pckR,  regulator of
                     pckA expression; also similar to LacI/GalR"
                     /codon_start=1
                     /transl_table=11
                     /product="LacI family transcriptional regulator"
                     /protein_id="NP_435284.1"
                     /db_xref="GI:16262491"
                     /db_xref="GeneID:1235263"
                     /translation="MSSQERKKSRVTLLDVARHASVSRATASLVLRKSPLVGSETRAR
                     VEQAMRDLGYVYNIGAARLRVERSQIIGAIVPNLTNPFFAELLSGIEEAIGATGKVVI
                     LANSGERVERQSMLLQRMREHGVDGVVLCPAAGTEPDLSEQLAAWGMPVVQVLRHISV
                     DMDYVGVDYAGGMRQAVDYLASLGHEKIAFAVHGPFHSAYRERVDGFRDAMLAKAFDP
                     EILIHLPAQLGEIADSTHLLFAKATQPTAVICFNHLVALGLAAGLHDCGLTIGRDLSL
                     IGFDDVADAEAIRPRLTSVSTGPTAIGEMAARLLVERIANPDLPPRRVVNDTTLSVRQ
                     SCGRPA"
     misc_feature    40989..41975
                     /locus_tag="SMa0078"
                     /note="Transcriptional regulators [Transcription]; Region:
                     PurR; COG1609"
                     /db_xref="CDD:224525"
     misc_feature    41001..41150
                     /locus_tag="SMa0078"
                     /note="Helix-turn-helix (HTH) DNA binding domain of the
                     LacI family of transcriptional regulators; Region:
                     HTH_LacI; cd01392"
                     /db_xref="CDD:143331"
     misc_feature    order(41022..41036,41040..41045,41052..41054,41067..41072,
                     41079..41081,41118..41120,41127..41129,41136..41141,
                     41145..41150)
                     /locus_tag="SMa0078"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:143331"
     misc_feature    41118..41147
                     /locus_tag="SMa0078"
                     /note="domain linker motif; other site"
                     /db_xref="CDD:143331"
     misc_feature    41166..41960
                     /locus_tag="SMa0078"
                     /note="Ligand-binding domain of MalI, a transcription
                     regulator of the maltose system of Escherichia coli and
                     its close homologs from other bacteria; Region:
                     PBP1_MalI_like; cd06289"
                     /db_xref="CDD:107284"
     misc_feature    order(41166..41168,41205..41213,41220..41225,41229..41234,
                     41253..41267,41271..41273,41304..41306,41313..41315,
                     41322..41330,41643..41645,41727..41729,41739..41741,
                     41748..41753)
                     /locus_tag="SMa0078"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:107284"
     misc_feature    order(41202..41207,41214..41216,41349..41351,41421..41423,
                     41457..41459,41565..41567,41634..41636,41796..41798,
                     41847..41849)
                     /locus_tag="SMa0078"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107284"
     gene            42106..42774
                     /locus_tag="SMa0079"
                     /db_xref="GeneID:1235264"
     CDS             42106..42774
                     /locus_tag="SMa0079"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to amino acid
                     (glutamine) ABC transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435285.1"
                     /db_xref="GI:16262492"
                     /db_xref="GeneID:1235264"
                     /translation="MYEFNFAPVLASFDQLLVGAWLTVRLSCAAMLIGLVVSVFCAWG
                     KTAGPAILRHVIDGYIEIIRNTPFLVQIFFIFFGMPSLGLRLSPNSAALLALVVNFGA
                     YGTEIIRAGIESIHKGQVEAGWALGLSRPQIFRYVVMKPALRTVYPALTSQFIYLMLN
                     TSVVSVISADDLAAAGNDLQSATFASFEVYIAVTLIYLALSVGFSALFYALEKAAFKY
                     PLGR"
     misc_feature    42121..42759
                     /locus_tag="SMa0079"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    42163..42720
                     /locus_tag="SMa0079"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(42211..42216,42223..42228,42241..42243,42271..42282,
                     42286..42315,42322..42327,42331..42333,42397..42402,
                     42406..42408,42412..42414,42421..42426,42430..42432,
                     42442..42447,42454..42456,42505..42507,42547..42552,
                     42559..42561,42580..42591,42598..42603,42640..42645,
                     42673..42678,42685..42690,42694..42699,42706..42711,
                     42718..42720)
                     /locus_tag="SMa0079"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(42289..42333,42580..42597)
                     /locus_tag="SMa0079"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(42331..42333,42382..42384,42598..42600,42634..42636,
                     42643..42645,42673..42675)
                     /locus_tag="SMa0079"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(42457..42495,42511..42516,42526..42528)
                     /locus_tag="SMa0079"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            42785..43441
                     /locus_tag="SMa0081"
                     /db_xref="GeneID:1235265"
     CDS             42785..43441
                     /locus_tag="SMa0081"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to amino acid ABC
                     transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435286.1"
                     /db_xref="GI:16262493"
                     /db_xref="GeneID:1235265"
                     /translation="MIRAFGWNEFLVIVAAAQWTIALSAIAFAGGSVGGLLVALMRVS
                     ETRALRLFATGFIRVFQGTPLLMQLFLVFFGMNIFGFAINPWIAATIALALHASAFLG
                     EIWRGCIEAVPKGQREAATALGLRYFRSMRHVILPQAARIAVAPTVGFLVQLIKGTSL
                     ASIIGFTELTRQGQIINNATFSPFLVFGTVAAVYFLLCWPLSLIARRMETRFSRATAR
                     "
     misc_feature    42788..43429
                     /locus_tag="SMa0081"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    42833..43375
                     /locus_tag="SMa0081"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(42881..42886,42893..42898,42911..42913,42941..42952,
                     42956..42985,42992..42997,43001..43003,43067..43072,
                     43076..43078,43082..43084,43091..43096,43100..43102,
                     43112..43117,43124..43126,43175..43177,43217..43222,
                     43229..43231,43250..43261,43268..43273,43310..43315,
                     43343..43348,43355..43360,43364..43369)
                     /locus_tag="SMa0081"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(42959..43003,43250..43267)
                     /locus_tag="SMa0081"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(43001..43003,43052..43054,43268..43270,43304..43306,
                     43313..43315,43343..43345)
                     /locus_tag="SMa0081"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(43127..43165,43181..43186,43196..43198)
                     /locus_tag="SMa0081"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            43471..44286
                     /locus_tag="SMa0082"
                     /db_xref="GeneID:1235266"
     CDS             43471..44286
                     /locus_tag="SMa0082"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to amino acid ABC
                     transporter periplasmic amino acid-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435287.1"
                     /db_xref="GI:16262494"
                     /db_xref="GeneID:1235266"
                     /translation="MRREGLMNISRRIAISVLGAAIVAGLVAPAAAQTVETIKSAGTV
                     KVGMLVDFPPFGIMDANNQPDGYDADVAKLLAKELGVEVTIVPVTGPNRIPYLQSNQV
                     DLLVASLGITEERAKNVDFSQPYAGISIGVFGAADLAVTKPEDLAGKTIGVARASTQD
                     TATTKIAPQDANIQRFDDDASAVQALLSGQVELIGVSNVVAAQIEAAAPGRFNQKLQL
                     SQQVQGIAVRKGSSEMLKFVNGFLDKVKADGQLNAIHEKWLGSPLPEFVTEAK"
     misc_feature    43600..44247
                     /locus_tag="SMa0082"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    43600..44247
                     /locus_tag="SMa0082"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    order(43624..43626,43738..43740,43813..43815,43942..43944,
                     44059..44061)
                     /locus_tag="SMa0082"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(44008..44010,44020..44022,44038..44040)
                     /locus_tag="SMa0082"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    44125..44142
                     /locus_tag="SMa0082"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            44302..45081
                     /locus_tag="SMa0083"
                     /db_xref="GeneID:1235267"
     CDS             44302..45081
                     /locus_tag="SMa0083"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to amino acid ABC
                     transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435288.1"
                     /db_xref="GI:16262495"
                     /db_xref="GeneID:1235267"
                     /translation="MNTEREYASPPDSREALDPAVRMEGVNKWYDAFHALKNIDLTVG
                     RGERIVICGPSGSGKSTLIRCINQLETIHSGRIVVDGHDLTAGGRNVDLVRQETGMVF
                     QQFNLFPHMTVLENCTLAPMKVRGLAKAEAEETAMKYLKRVRIPEQAVKYPAQLSGGQ
                     QQRVAIARALCMNPKIMLFDEPTSALDPEMVKEVLDTMVDLANEGMTMLCVTHEMGFA
                     RSVADRVVFMDRGEVLEIAPPDAFFGAPQHERTRFFLGQIS"
     misc_feature    44356..45078
                     /locus_tag="SMa0083"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    44362..45000
                     /locus_tag="SMa0083"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    44458..44481
                     /locus_tag="SMa0083"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    order(44467..44472,44476..44484,44608..44610,44839..44844,
                     44938..44940)
                     /locus_tag="SMa0083"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    44599..44610
                     /locus_tag="SMa0083"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    44767..44796
                     /locus_tag="SMa0083"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    44827..44844
                     /locus_tag="SMa0083"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    44851..44862
                     /locus_tag="SMa0083"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    44926..44946
                     /locus_tag="SMa0083"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            45099..46052
                     /locus_tag="SMa0085"
                     /db_xref="GeneID:1235268"
     CDS             45099..46052
                     /locus_tag="SMa0085"
                     /note="glimmer prediction; similar to  D-isomer specific
                     2-hydroxyacid"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="NP_435289.1"
                     /db_xref="GI:16262496"
                     /db_xref="GeneID:1235268"
                     /translation="MEFRNVKPDLLLVEPMMPFVMDELQRNYSVHRLYQAADRPALEA
                     ALPSIRAVATGGGAGLSNEWMEKLPSLGIIAINGVGTDKVDLARARRRNIDVTTTPGV
                     LADDVADLGIALMLAVLRRVGDGDRLVREGRWAAGEQLPLGHSPKGKRIGVLGLGQIG
                     RALASRAEAFGMSVRYWNRSTLSGVDWIAHQSPVDLARDSDVLAVCVAASAATQNIVD
                     ASLLQALGPEGIVVNVARGNVVDEDALIEALKSGTIAGAGLDVFVNEPAIRSEFHTTP
                     NTVLMPHQGSATVETRMAMGKLVLANLAAHFAGEKAPNTVN"
     misc_feature    45117..46049
                     /locus_tag="SMa0085"
                     /note="Lactate dehydrogenase and related dehydrogenases
                     [Energy production and conversion / Coenzyme metabolism /
                     General function prediction only]; Region: LdhA; COG1052"
                     /db_xref="CDD:223980"
     misc_feature    45120..46022
                     /locus_tag="SMa0085"
                     /note="Hydroxy(phenyl)pyruvate Reductase,
                     D-isomer-specific 2-hydroxyacid-related dehydrogenase;
                     Region: HPPR; cd12156"
                     /db_xref="CDD:240633"
     misc_feature    order(45264..45266,45330..45338,45405..45407,45804..45806,
                     45945..45947)
                     /locus_tag="SMa0085"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240633"
     misc_feature    order(45333..45338,45417..45419,45561..45575,45627..45638,
                     45714..45722,45735..45737,45798..45806,45876..45878,
                     45945..45947,45951..45956)
                     /locus_tag="SMa0085"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240633"
     misc_feature    order(45804..45806,45891..45893,45945..45947)
                     /locus_tag="SMa0085"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240633"
     gene            46069..46401
                     /locus_tag="SMa0087"
                     /db_xref="GeneID:1235269"
     CDS             46069..46401
                     /locus_tag="SMa0087"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435290.1"
                     /db_xref="GI:16262497"
                     /db_xref="GeneID:1235269"
                     /translation="MIVRQALFEGTIRPGREQAFRGYVEEKLVPLWRAFPGVREVRVL
                     HAVDRDEGAPAFAMILSTTYDDREALARALASPVRYESRELTKGLLEMFEGHIHHHVF
                     DLDARSTA"
     misc_feature    46120..>46299
                     /locus_tag="SMa0087"
                     /note="EthD domain; Region: EthD; cl17553"
                     /db_xref="CDD:266745"
     gene            46684..47100
                     /locus_tag="SMa0089"
                     /db_xref="GeneID:1235270"
     CDS             46684..47100
                     /locus_tag="SMa0089"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435291.1"
                     /db_xref="GI:16262498"
                     /db_xref="GeneID:1235270"
                     /translation="MKRNEQMTRRDAVFPANRHALYEAHGYSAAIRSGDLLFVSGQVG
                     SRSDGSPEPDFGRQVQLAFDNLRATLNAAGCTFDDIVDVTTFHTDPENQFETIMAVKN
                     QVFGTPPYPNWTALGVNWLAGFDFEIKVIARIPEAA"
     misc_feature    46756..47085
                     /locus_tag="SMa0089"
                     /note="YjgH belongs to a large family of
                     YjgF/YER057c/UK114-like proteins present in bacteria,
                     archaea, and eukaryotes with no definitive function. The
                     conserved domain is similar in structure to chorismate
                     mutase but there is no sequence similarity and no...;
                     Region: YjgH_like; cd02198"
                     /db_xref="CDD:100005"
     misc_feature    order(46762..46767,46774..46776,46780..46782,46789..46791,
                     46795..46797,46801..46806,46918..46920,46924..46929,
                     46933..46935,46939..46941,46975..46977,46984..46986,
                     46996..46998,47011..47037,47062..47064,47068..47070,
                     47074..47076)
                     /locus_tag="SMa0089"
                     /note="homotrimer interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:100005"
     misc_feature    order(46762..46764,46963..46965,46975..46977,47020..47022,
                     47062..47064)
                     /locus_tag="SMa0089"
                     /note="putative active site [active]"
                     /db_xref="CDD:100005"
     gene            47225..47920
                     /locus_tag="SMa0091"
                     /db_xref="GeneID:1235271"
     CDS             47225..47920
                     /locus_tag="SMa0091"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435292.1"
                     /db_xref="GI:16262499"
                     /db_xref="GeneID:1235271"
                     /translation="MKTALAVFGGFVLSLALFLSGAVVAVLFLTGKPARQPQLDVNQS
                     EVWTKQPRAVDRTAQQFERLPARPAPSDVNASREPETPAMANEAEKERSPEPLDRMAT
                     ASIQSPPAEEEPTASTVPAAHAEWCARRYRSYRPFDNTYRSFSGGRRSCNSPYMDAAW
                     GPSEDPSPVPRGIDAEDADDPSTQMEYSAGDGEAIRLTQEHVAYCFSRYRSYRPEDNS
                     YQPYSGGPRRQCR"
     misc_feature    47588..47680
                     /locus_tag="SMa0091"
                     /note="BA14K-like protein; Region: BA14K; pfam07886"
                     /db_xref="CDD:203793"
     misc_feature    47822..47917
                     /locus_tag="SMa0091"
                     /note="BA14K-like protein; Region: BA14K; pfam07886"
                     /db_xref="CDD:203793"
     gene            48182..49033
                     /locus_tag="SMa0093"
                     /db_xref="GeneID:1235272"
     CDS             48182..49033
                     /locus_tag="SMa0093"
                     /EC_number="2.6.1.21"
                     /function="Small molecule metabolism; Degradation; amino
                     acids"
                     /note="glimmer prediction. Interconversion of pyruvate and
                     D-alanine. Similar to Smc01047 of S. meliloti chromosome"
                     /codon_start=1
                     /transl_table=11
                     /product="Branched-chain amino acid aminotransferase"
                     /protein_id="NP_435293.1"
                     /db_xref="GI:16262500"
                     /db_xref="GeneID:1235272"
                     /translation="MGRIVYVHGQFVPEEEARIGLFDRGFLFGDAVYEVTAVIGGRMI
                     DNDLHLGRLERSLRELAIPLGLSRKEIAGVQAELIARNALLDGTVYLQVSRGEADRDF
                     LYSDALAPRLVGFTQAKTLTGTKAQQDGISVDLADDPRWHRRDIKTAMLLGQVMAKQA
                     ARARGFDDVWLVENGLVTEGASSTAHVITGDGRILTRAASRATLPGCTQRALALLCAA
                     EDLAIEERAFTPNEAQAAAEAFQTSASSLVMPVVRIGERVVGNGKPGPMTRKLQALYL
                     EAAGVPV"
     misc_feature    48182..49018
                     /locus_tag="SMa0093"
                     /note="PyridoxaL 5'-Phosphate Dependent Enzymes class IV
                     (PLPDE_IV). This D-amino acid superfamily, one of five
                     classes of PLPDE, consists of branched-chain amino acid
                     aminotransferases (BCAT), D-amino acid transferases
                     (DAAT), and...; Region: PLPDE_IV; cl00224"
                     /db_xref="CDD:260277"
     misc_feature    order(48254..48259,48263..48268,48272..48274,48278..48280,
                     48356..48358,48449..48451,48455..48457,48518..48520,
                     48626..48628,48638..48640,48644..48646,48656..48658,
                     48698..48700)
                     /locus_tag="SMa0093"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238254"
     misc_feature    order(48278..48280,48335..48337,48620..48622,48716..48718,
                     48800..48805,48911..48913)
                     /locus_tag="SMa0093"
                     /note="substrate-cofactor binding pocket; other site"
                     /db_xref="CDD:238254"
     misc_feature    order(48335..48337,48620..48622,48716..48718)
                     /locus_tag="SMa0093"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238254"
     misc_feature    48620..48622
                     /locus_tag="SMa0093"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238254"
     gene            49084..50121
                     /locus_tag="SMa0095"
                     /db_xref="GeneID:1235273"
     CDS             49084..50121
                     /locus_tag="SMa0095"
                     /EC_number="3.4.11.19"
                     /function="Macromolecule metabolism; Macromolecule
                     degradation; degradation of proteins, peptides,
                     glycopeptides"
                     /codon_start=1
                     /transl_table=11
                     /product="D-aminopeptidase"
                     /protein_id="NP_435294.1"
                     /db_xref="GI:16262501"
                     /db_xref="GeneID:1235273"
                     /translation="MKTARELGLIPQGRLEPGPGNAITDVAGVSVGHRSLRGEGLFTG
                     VTAILPHAGDVFRVKPRAAVEVINGFGKSAGLMQVAEIGTIETPIVLTNTFGVAACTE
                     ALVRRAISANPAIGRKTSTVNALVCECNDGSINDIQALAVTPADAEAALDAARTGPVE
                     QGAVGAGSGMTAFGFKAGIGTASRRMRVGKRDFTLGTLVLANFGAAGDLVLPDGRRPD
                     PRVPAGPERGSVIVVMATDLPLADRQLQRVARRAGAGLARLGAFWGHGSGDVALCFTT
                     ADPVEHEPATAFTTQERLADGHIDIAFRAAADTTQEAVLNALCMAPAMPARNGRIYPC
                     LADWLMENPSP"
     misc_feature    49120..50106
                     /locus_tag="SMa0095"
                     /note="L-Aminopeptidase D-amidase/D-esterase (DmpA)
                     family; DmpA catalyzes the release of N-terminal D and L
                     amino acids from peptide susbtrates. DmpA is synthesized
                     as a single polypeptide precursor, which is
                     autocatalytically cleaved to the active...; Region: DmpA;
                     cd02253"
                     /db_xref="CDD:239071"
     misc_feature    order(49264..49266,49324..49329,49810..49812,49822..49824,
                     49831..49833,49954..49968,49972..49974)
                     /locus_tag="SMa0095"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239071"
     misc_feature    order(49279..49290,49294..49302,49306..49308,49312..49317,
                     49324..49326,49366..49368,49375..49377,49399..49401,
                     49471..49473,49831..49836,49867..49881,49969..49971,
                     49981..49983,49990..49992)
                     /locus_tag="SMa0095"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239071"
     misc_feature    order(49471..49473,49687..49689,49768..49770,49882..49887)
                     /locus_tag="SMa0095"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239071"
     misc_feature    49765..49770
                     /locus_tag="SMa0095"
                     /note="cleavage site"
                     /db_xref="CDD:239071"
     gene            complement(50138..51079)
                     /locus_tag="SMa0097"
                     /db_xref="GeneID:1235274"
     CDS             complement(50138..51079)
                     /locus_tag="SMa0097"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; with HTH domain, similar to
                     LysR family"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435295.1"
                     /db_xref="GI:16262502"
                     /db_xref="GeneID:1235274"
                     /translation="MEIKWLEDFVTLADTSSFSRAAELRNVTQPAFSRRIKQLESWLG
                     ATLISRATMPAELTPAGRNFLPVAQEAIRTFYAAREVLRLPHEPGLIRFAALHTLTVT
                     FFPRWLKTLEAAGGSFSTSLIPDRGGIEANLDALVGDEADFFLTYAHPEVPFHLDSGQ
                     FSSLTVAHDRLIPLVAAEIVLSGDPQPGLNLLDRAIAQPRLAIPYLSYGFNSFFGVAL
                     SRLLLRRPPFRRRTTHENTISAGLMNMAVTGAGVCWLPESLAREEIDARRLVPASADE
                     GWNLDLEIRLYRHAASRNRKVEELWATAQRLLEPAPA"
     misc_feature    complement(50177..51079)
                     /locus_tag="SMa0097"
                     /note="cell density-dependent motility repressor;
                     Provisional; Region: PRK10082"
                     /db_xref="CDD:182228"
     misc_feature    complement(50894..51073)
                     /locus_tag="SMa0097"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(50153..50815)
                     /locus_tag="SMa0097"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            51262..52887
                     /locus_tag="SMa0101"
                     /db_xref="GeneID:1235275"
     CDS             51262..52887
                     /locus_tag="SMa0101"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="amidohydrolase"
                     /protein_id="NP_435296.1"
                     /db_xref="GI:16262503"
                     /db_xref="GeneID:1235275"
                     /translation="MAFGIKADLILINGRIWRGREEGISEALAVWQGKILATGSDTDI
                     LGLKGPRTEVIDLEGRFATPGLIDNHLHLIATGMAMGWVDATPASAPTLAALMGRISD
                     RAATTPKGGWVRARGYDQVKLDTGRHPTRDDLDRVAPDHPVLLTRACGHVSIANSRAL
                     ELAGITEATAVPEGGVIGVTEGRLNGFLAENAQNLVKAAMPSATTEDLIDGIERAGRY
                     LLSFGITSCMDAAVGQVSGFAEIQAYEMAKLSGRLPVRVWLTLLGDPGVSIVEDCWRA
                     GLLSGAGDDMLRVGGVKVFLDGSAGGRTAWMTRPYRGEPDNIGVQMLPDAEVEAVVKA
                     CHDRGYQMVCHAIGDGAIEQLITAYEKALAANPDPDRRHRVEHCGFSTPDQNARMKAA
                     GILPAPQMAFIHDFGDSYISVLGEERGRLSYPIGTWMRMGLKPSTGSDSPVCSPDPFP
                     NLHAMLTRQTGKGTVMEASERLSRQEALQTYTEYGAYSQKAEGVKGRLVPGQWADIAV
                     FDNDLLAAPPETILSDTSCVLTLLAGRVVHDAR"
     misc_feature    51268..52884
                     /locus_tag="SMa0101"
                     /note="Predicted metal-dependent hydrolase with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1574"
                     /db_xref="CDD:224490"
     misc_feature    51340..52785
                     /locus_tag="SMa0101"
                     /note="YtcJ_like metal dependent amidohydrolases. YtcJ is
                     a Bacillus subtilis ORF of unknown function. The
                     Arabidopsis homolog LAF3 has been identified as a factor
                     required for photochrome A signalling; Region: YtcJ_like;
                     cd01300"
                     /db_xref="CDD:238625"
     misc_feature    order(51469..51471,51475..51477,52294..52296,52390..52392,
                     52579..52581)
                     /locus_tag="SMa0101"
                     /note="active site"
                     /db_xref="CDD:238625"
     gene            52944..54536
                     /locus_tag="SMa0104"
                     /db_xref="GeneID:1235276"
     CDS             52944..54536
                     /locus_tag="SMa0104"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to dipeptide
                     transporter dipeptide-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435297.1"
                     /db_xref="GI:16262504"
                     /db_xref="GeneID:1235276"
                     /translation="MLKRLTLAAMLSLGVAAGALAAGERHGGTLVFTAPYGSSFATLD
                     VQSSPNTQEEFITQAIHRALYSWDSNQNKPVLELATSEEVSEDGKVHTYHLRKNAVFH
                     NGKPLTADDIIYSYKRIANPENAFPGASFIAVIKGAEDYIAGKADEISGLKKIDDHTL
                     EITYTGTINPGFPLMQNTTVIYPSNVEGESTFGKNPVGLGAFVFKEHVPGSQVVVEKF
                     DKYYEEGRPYLDRINIVLMAEDAARDVAFRNKEIDVSILGPTQYQAYQGEEGLKDHLL
                     EVAEVYTRNIGFNPAFEPFKDKRVRQAINHAINAPLIIERLVKNKAYPASGWLPISSP
                     AFDKDKAPYAYDPEKAKALLAEAGYADGFEFEVTASPNESWGVPIVEAILPMLKKVGI
                     TVKPKPVESSTLGEAVTTNNFQAFIWSNLSGPDPLNALRCYYSKTAQSACNYTSYASP
                     EFDKLYEAAQQERDSAKQNDLLRQANNIVQDDAPVWFFNYNKAVMAYQPWIHGLVPNA
                     TELAIQPYDEIWIDETAPSSRQ"
     misc_feature    52956..54506
                     /locus_tag="SMa0104"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    53034..54455
                     /locus_tag="SMa0104"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cd00995"
                     /db_xref="CDD:173853"
     gene            54624..55559
                     /locus_tag="SMa0105"
                     /db_xref="GeneID:1235277"
     CDS             54624..55559
                     /locus_tag="SMa0105"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to dipeptide transport
                     system permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435298.1"
                     /db_xref="GI:16262505"
                     /db_xref="GeneID:1235277"
                     /translation="MLRFTLRRVLQIIPTVVVVALLIFVIFSVVPGTFAASLFADGRR
                     AADPQMIARLNEEFGLNKPLMERFVTYVTDLAQFDLGTSFRTRQPVIDLINDRMWASL
                     QLAIAAMIFALVISVPLGFVAALRPGSVLDTVTMIGAVSGLSMPQFWLGLLMMYLFAL
                     QLNWLPSFGYGDGSFRNLILPAVTLGVTPLALLARTTRAGVLDVLNADFIRTAHSKGM
                     SEAKVVRWHVARNALVLIVTTVGLQFGSLIGQAVVIEKLFAWPGIGSLLVDSVASRDI
                     PVVQGTILVIVLWFLVINTAVDLIYAAIDPRIKQE"
     misc_feature    54624..55556
                     /locus_tag="SMa0105"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    54915..55487
                     /locus_tag="SMa0105"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(54963..54968,54975..54980,54993..54995,55026..55037,
                     55041..55070,55077..55082,55086..55088,55185..55190,
                     55194..55196,55200..55202,55209..55214,55218..55220,
                     55230..55235,55242..55244,55293..55295,55335..55340,
                     55347..55349,55368..55379,55386..55391,55416..55421,
                     55449..55454,55461..55466,55470..55475,55482..55487)
                     /locus_tag="SMa0105"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55044..55088,55368..55385)
                     /locus_tag="SMa0105"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55086..55088,55170..55172,55386..55388,55410..55412,
                     55419..55421,55449..55451)
                     /locus_tag="SMa0105"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55245..55283,55299..55304,55314..55316)
                     /locus_tag="SMa0105"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            55565..56386
                     /locus_tag="SMa0106"
                     /db_xref="GeneID:1235278"
     CDS             55565..56386
                     /locus_tag="SMa0106"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to dipeptide ABC
                     transporter dipeptide-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435299.1"
                     /db_xref="GI:16262506"
                     /db_xref="GeneID:1235278"
                     /translation="MRLGFNFWLGAGLTTLVILAGILAPWIAPFDPVLDADLMNSELP
                     PDATFWFGTDGQGRDVYTRILYGAQISLTVGIVSQVINSIIGVTLGMTAGYWGGWWDD
                     LVNGFTNVMLAIPSLIFALAVMAVLGPGLPSLLIALGLTNWSWTCRIARSSTLSLKSL
                     GYVQAAQTLGYGDLRIMFTQILPNMMGPILVMATLGMGSAVLSEAALSFLGLGIQPPF
                     PSWGSMLTDARQLIQLAPWVAIFPGLAIFLSVLGFNLLGDGLRDSLDPHMRTRNP"
     misc_feature    55565..56377
                     /locus_tag="SMa0106"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    55766..56314
                     /locus_tag="SMa0106"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(55814..55819,55826..55831,55844..55846,55874..55885,
                     55889..55918,55925..55930,55934..55936,55985..55990,
                     55994..55996,56000..56002,56009..56014,56018..56020,
                     56030..56035,56042..56044,56093..56095,56135..56140,
                     56147..56149,56168..56179,56186..56191,56231..56236,
                     56264..56269,56276..56281,56285..56290,56297..56302,
                     56309..56314)
                     /locus_tag="SMa0106"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55892..55936,56168..56185)
                     /locus_tag="SMa0106"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(55934..55936,55970..55972,56186..56188,56225..56227,
                     56234..56236,56264..56266)
                     /locus_tag="SMa0106"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(56045..56083,56099..56104,56114..56116)
                     /locus_tag="SMa0106"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            56383..57297
                     /locus_tag="SMa0108"
                     /db_xref="GeneID:1235279"
     CDS             56383..57297
                     /locus_tag="SMa0108"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; similar to oligopeptide ABC
                     transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435300.1"
                     /db_xref="GI:16262507"
                     /db_xref="GeneID:1235279"
                     /translation="MTEPLLDIRDLHLGIAVGRSVNRPLLKGVSFQIMPGEAYGLVGE
                     SGSGKSVTSLAVMGLLKKPLAVSGGEILFKGQNLLELPKREMRRLRGNRIAMIFQEPM
                     TALNPLSTIGRQIAEMFVLHQGKSWDEAQKLAIEALASVRVPNPDRRARNYPHQMSGG
                     LRQRVMIAMALACNPDLLIADEPTTALDVTVQAEVLRLIKELCAERGTAVLFISHDLG
                     VIASICQRVGVMYAGCLVEENETRALFAAPRHEYTRGLLGALPRFGSRSLHGRQRLVD
                     IDSIIADRSKLIETRFIAPRGAEEGGQP"
     misc_feature    56395..57270
                     /locus_tag="SMa0108"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppD; COG0444"
                     /db_xref="CDD:223521"
     misc_feature    56395..57099
                     /locus_tag="SMa0108"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    56509..56532
                     /locus_tag="SMa0108"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(56518..56523,56527..56535,56677..56679,56923..56928,
                     57025..57027)
                     /locus_tag="SMa0108"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    56668..56679
                     /locus_tag="SMa0108"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    56851..56880
                     /locus_tag="SMa0108"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    56911..56928
                     /locus_tag="SMa0108"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    56935..56946
                     /locus_tag="SMa0108"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    57013..57033
                     /locus_tag="SMa0108"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    57088..>57249
                     /locus_tag="SMa0108"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            57294..58256
                     /locus_tag="SMa0110"
                     /db_xref="GeneID:1235280"
     CDS             57294..58256
                     /locus_tag="SMa0110"
                     /function="Cell processes; Transport of small molecules;
                     amino acids, amines, peptides"
                     /note="glimmer prediction; oligopeptide ABC transporter
                     ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435301.1"
                     /db_xref="GI:16262508"
                     /db_xref="GeneID:1235280"
                     /translation="MTDPLLEVDDLHVRFSVSGGGLLGTGRRMLHAVNGIGFSLSKGE
                     CLSIVGESGCGKSTTALSVLGLQEPTEGTIRYRGQPLTGPGAPGRMQRAKAVQMVFQD
                     PYASLNPRQSVRTSLAAPLRLHGITAASEIADRIEVMLANVGLTPEQANRYPHEFSGG
                     QRQRIGIARALILEPEIVVLDEPVSALDVSIRAQIINLLLDLQEKLGLGYLMISHDLS
                     VVEHMSDRVLVMFFGQVVEEGGWRDIFERPAHPYTRRLIAAIPDPDAALNPGTKDHFA
                     DVPLPDGRSFAVDGSTAPDVFSAPPPSELVEIAPGHRMRLVPAV"
     misc_feature    57300..58094
                     /locus_tag="SMa0110"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     system, ATPase component [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppF; COG1124"
                     /db_xref="CDD:224049"
     misc_feature    57306..58010
                     /locus_tag="SMa0110"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    57441..57464
                     /locus_tag="SMa0110"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(57450..57455,57459..57467,57594..57596,57834..57839,
                     57936..57938)
                     /locus_tag="SMa0110"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    57585..57596
                     /locus_tag="SMa0110"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    57762..57791
                     /locus_tag="SMa0110"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    57822..57839
                     /locus_tag="SMa0110"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    57846..57857
                     /locus_tag="SMa0110"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    57924..57944
                     /locus_tag="SMa0110"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    57993..58238
                     /locus_tag="SMa0110"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            58298..58612
                     /locus_tag="SMa5001"
                     /db_xref="GeneID:6435252"
     CDS             58298..58612
                     /locus_tag="SMa5001"
                     /note="Has weak similarity to PilT-like proteins and StbB-
                     like plasmid stability proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000330.1"
                     /db_xref="GI:193782534"
                     /db_xref="GeneID:6435252"
                     /translation="MRKQRVREFPRFGESELLFGIGVLPDGRRKKALTEMLDGVLELF
                     GDRVLPFDIGAARCYAKLAVTARAAGKEFPTRPTDILPPLPPPGDLSSRQAIPARQSL
                     PS"
     misc_feature    <58343..>58537
                     /locus_tag="SMa5001"
                     /note="PIN (PilT N terminus) domain: Superfamily; Region:
                     PIN_SF; cl14812"
                     /db_xref="CDD:265458"
     gene            complement(58803..59234)
                     /locus_tag="SMa0112"
                     /db_xref="GeneID:1235281"
     CDS             complement(58803..59234)
                     /locus_tag="SMa0112"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435302.1"
                     /db_xref="GI:16262509"
                     /db_xref="GeneID:1235281"
                     /translation="MQAGGVSMTNAQCACGALRLMLNEPPQLTALCHCLACQRRTGAP
                     FSANAFYSIDCVEISGVSTEYIRTAESGRKVRMHFCPTCGSTLFWKADASPSWIGVAV
                     GSFADPAFAPPAMSVFERSKHKWVQLEGTVEHFQDLPIGQY"
     misc_feature    complement(58824..59216)
                     /locus_tag="SMa0112"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3791"
                     /db_xref="CDD:226314"
     gene            59703..62264
                     /locus_tag="SMa0113"
                     /db_xref="GeneID:1235282"
     CDS             59703..62264
                     /locus_tag="SMa0113"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; similar to sensory transduction
                     histidine kinase with PAS domain"
                     /codon_start=1
                     /transl_table=11
                     /product="Sensor histidine kinase"
                     /protein_id="NP_435303.1"
                     /db_xref="GI:16262510"
                     /db_xref="GeneID:1235282"
                     /translation="MKSRESPVYMSNVEEFPLTGRVLTEYEALITSAPTALDAIPGAV
                     YVCDHEGWLVGYNAEAAELWGRQPSLSAPRERFCGSQRLFLSDGSPMDHQECPMAEAI
                     KTGVSTRNAEVIIERPDGSRIFALVNIRPLRDHRGVIQGAINCFQDISQQKRIEAEVN
                     CKSKDLEDFFENSAIGLHIVSAAGIILRANKAELELLGYPADEYVGRHIAEFHADAPV
                     IGDILDRLSCGEKLDRYPARLRARDGSIKHVLITSNSRFEDGKFVNTRCFTTDITSLH
                     ETENAWRETEERLAATYQAATIGIAESDADGRLLRVNDAFCTMLGRSREQLLNMTFLD
                     YTHEDDRDEEARCYARQVSGETDTYAIRKRAVKADGTVIYLDVYSSTVRDRTGRFRYG
                     VRVLLDVTEAKRMDDRRRESEQHMRDLLEALPAAVYTTDAEGRITFFNKAAVEMAGRT
                     PQIGDKWCVTWRLYRPDGTYLPHDQCPMAVTLKEDRPVRGEQAVAERPDGTRVPFIPY
                     PTPLHDVAGKLVGAVNMLVDISDREKAAEYAERLASIVRFSDDAIVSKDTQGIIQTWN
                     KGAERLFGYSAEEVIGKPINILIPPDRQGEEPGILERIRRDEHIDHYETVRIRKDGSL
                     IDVSLTVSPLKDARGRVVGASKIARDITERRRSEEHRKLLVNELNHRVKNTLATVQSL
                     AAQTFRGVNASEDFGRFQSRLVALARAHDVLTRESWQGADLGEVLHATINPICVEPQQ
                     RVQASGPPLRLRPKMALALSMAFHELCTNAAKYGALTNDGGLIKVNWHVSNIESVSHL
                     HLQWEEIGGPSVMVPARTGFGTRLLERALARELGGKVDLVFAPSGVRFHIEAPLT"
     misc_feature    59820..60149
                     /locus_tag="SMa0113"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    59829..60539
                     /locus_tag="SMa0113"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    order(59868..59870,59880..59882,59898..59900,59952..59963,
                     60045..60047,60060..60062)
                     /locus_tag="SMa0113"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(59946..59948,59955..59957,59979..59981,59988..59990,
                     59994..59996,60081..60083,60087..60089)
                     /locus_tag="SMa0113"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    60219..60518
                     /locus_tag="SMa0113"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    60237..60914
                     /locus_tag="SMa0113"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    order(60267..60269,60279..60281,60297..60299,60336..60338,
                     60339..60341,60417..60419,60432..60434)
                     /locus_tag="SMa0113"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(60327..60329,60357..60359,60366..60371,60453..60455,
                     60459..60461)
                     /locus_tag="SMa0113"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    60588..60899
                     /locus_tag="SMa0113"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    60597..61307
                     /locus_tag="SMa0113"
                     /note="FOG: PAS/PAC domain [Signal transduction
                     mechanisms]; Region: AtoS; COG2202"
                     /db_xref="CDD:225112"
     misc_feature    order(60636..60638,60648..60650,60666..60668,60705..60716,
                     60795..60797,60810..60812)
                     /locus_tag="SMa0113"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(60696..60698,60708..60710,60732..60734,60741..60746,
                     60831..60833,60837..60839)
                     /locus_tag="SMa0113"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    60969..61289
                     /locus_tag="SMa0113"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(61017..61019,61029..61031,61047..61049,61089..61100,
                     61185..61187,61200..61202)
                     /locus_tag="SMa0113"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(61071..61073,61092..61094,61119..61121,61128..61133,
                     61221..61223,61227..61229)
                     /locus_tag="SMa0113"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    61320..61679
                     /locus_tag="SMa0113"
                     /note="PAS domain S-box; Region: sensory_box; TIGR00229"
                     /db_xref="CDD:232884"
     misc_feature    61347..61655
                     /locus_tag="SMa0113"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    order(61395..61397,61407..61409,61425..61427,61464..61475,
                     61566..61568)
                     /locus_tag="SMa0113"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    order(61455..61457,61467..61469,61500..61502,61509..61514,
                     61587..61589,61593..61595)
                     /locus_tag="SMa0113"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     misc_feature    61632..62261
                     /locus_tag="SMa0113"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG3920"
                     /db_xref="CDD:226434"
     misc_feature    61701..61946
                     /locus_tag="SMa0113"
                     /note="HWE histidine kinase; Region: HWE_HK; pfam07536"
                     /db_xref="CDD:148894"
     gene            62292..62654
                     /locus_tag="SMa0114"
                     /db_xref="GeneID:1235283"
     CDS             62292..62654
                     /locus_tag="SMa0114"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; with response regulator
                     receiver domain"
                     /codon_start=1
                     /transl_table=11
                     /product="two-component response regulator"
                     /protein_id="NP_435304.1"
                     /db_xref="GI:16262511"
                     /db_xref="GeneID:1235283"
                     /translation="MTERRLRVLVVEDESMIAMLIEDTLCELGHEVAATASRMQEALD
                     IARKGQFDIAIIDVNLDGEPSYPVADILAERNVPFIFATGYGSKGLDTRYSNIPLLTK
                     PFLDSELEAVLVQISKEV"
     misc_feature    62316..62630
                     /locus_tag="SMa0114"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(62325..62330,62460..62462,62484..62486,62538..62540,
                     62571..62573,62595..62600)
                     /locus_tag="SMa0114"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    62460..62462
                     /locus_tag="SMa0114"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(62469..62474,62478..62486)
                     /locus_tag="SMa0114"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    62595..62603
                     /locus_tag="SMa0114"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            63200..64117
                     /locus_tag="SMa0116"
                     /db_xref="GeneID:1235284"
     CDS             63200..64117
                     /locus_tag="SMa0116"
                     /function="Cell processes; Chaperoning"
                     /note="glimmer prediction, sequence similarity to DnaJ and
                     CbpA (co-chaperone-curved DNA binding protein)"
                     /codon_start=1
                     /transl_table=11
                     /product="DnaJ/CbpA-type protein"
                     /protein_id="NP_435305.2"
                     /db_xref="GI:193782535"
                     /db_xref="GeneID:1235284"
                     /translation="MTDDPYQILGVPRTGKPDEIRKAYRKRAKELHPDLHPGDKEVET
                     KFKALSAAYHLLSDPEQRARFDRGEIDASGAERPQQHFYRHYADADHARRYGSAGGTG
                     EFEDVSDIFADLFGQGGAGGRFKARGQDRHYHLELEFLDAVNGARRRITFPDGNTLDL
                     AIPAGTRDGSTLRLRGKGTPGIAGGEPGDALIEISVRSHSVFRREGNDIEIDLPITLY
                     EAVLGAKIEVPTISGRVSMTIPKGSNTGDILRLRGKGVKSQHGPAGDQRVTLKVVLPT
                     ATDPDLERFMETWRRSHAYDPREALGRAT"
     misc_feature    63209..64027
                     /locus_tag="SMa0116"
                     /note="chaperone protein DnaJ; Region: DnaJ_bact;
                     TIGR02349"
                     /db_xref="CDD:233829"
     misc_feature    63209..63373
                     /locus_tag="SMa0116"
                     /note="DnaJ domain or J-domain.  DnaJ/Hsp40 (heat shock
                     protein 40) proteins are highly conserved and play crucial
                     roles in protein translation, folding, unfolding,
                     translocation, and degradation. They act primarily by
                     stimulating the ATPase activity of Hsp70s; Region: DnaJ;
                     cd06257"
                     /db_xref="CDD:99751"
     misc_feature    order(63293..63301,63326..63328,63335..63340,63347..63352)
                     /locus_tag="SMa0116"
                     /note="HSP70 interaction site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99751"
     misc_feature    63584..64027
                     /locus_tag="SMa0116"
                     /note="C-terminal substrate binding domain of DnaJ and
                     HSP40; Region: DnaJ_C; cd10747"
                     /db_xref="CDD:199909"
     misc_feature    order(63596..63598,63641..63658,63662..63664,63734..63736)
                     /locus_tag="SMa0116"
                     /note="substrate binding site [polypeptide binding]; other
                     site"
                     /db_xref="CDD:199909"
     misc_feature    order(63848..63853,63860..63865,63923..63934,64019..64027)
                     /locus_tag="SMa0116"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:199909"
     gene            64114..64452
                     /locus_tag="SMa0117"
                     /db_xref="GeneID:1235285"
     CDS             64114..64452
                     /locus_tag="SMa0117"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435306.1"
                     /db_xref="GI:16262513"
                     /db_xref="GeneID:1235285"
                     /translation="MKLTERQVLEQFDIVTRKQLRQWVHSGWIVPAQGERGPSFDDVD
                     VARIRLVCELRRDMNVNDDAVPIILALLDQLYGLRRELRTIATALLEQPDEVRQQLKQ
                     ALLSPIGQQH"
     misc_feature    64156..64365
                     /locus_tag="SMa0117"
                     /note="Helix-Turn-Helix DNA binding domain of
                     transcription regulators from the MerR superfamily;
                     Region: HTH_MerR-SF; cl02600"
                     /db_xref="CDD:261364"
     gene            64679..65206
                     /locus_tag="SMa0118"
                     /db_xref="GeneID:1235286"
     CDS             64679..65206
                     /locus_tag="SMa0118"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; partial homology to alcohol"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435307.1"
                     /db_xref="GI:16262514"
                     /db_xref="GeneID:1235286"
                     /translation="MFRLGIGFACFATSAFGLQPLGAAADDPAIARGEYLVTMGGCND
                     CHTPGYFFGKPDSSRFLGGSDVGFEIPGEGVFIGRNITPDKETGIGSWTREQIVTAIQ
                     TGQRPDGRMLAPIMPWHAFAQLTKEDAGAIAAFLQSLKPVSHQVPGPFKPGEKVSTFM
                     FRILPPGETAAAAPK"
     misc_feature    64679..65095
                     /locus_tag="SMa0118"
                     /note="Cytochrome c, mono- and diheme variants [Energy
                     production and conversion]; Region: CccA; COG2010"
                     /db_xref="CDD:224921"
     misc_feature    <64751..65095
                     /locus_tag="SMa0118"
                     /note="Predicted thiol oxidoreductase [Energy production
                     and conversion]; Region: COG3488"
                     /db_xref="CDD:226019"
     gene            complement(65491..65658)
                     /locus_tag="SMa0121"
                     /db_xref="GeneID:1235287"
     CDS             complement(65491..65658)
                     /locus_tag="SMa0121"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435308.1"
                     /db_xref="GI:16262515"
                     /db_xref="GeneID:1235287"
                     /translation="MIRFERKPDPQPSLKEAENKRTKQISEAAKEENKKSGTTGAPRR
                     APQAADDDRLI"
     gene            complement(65729..66112)
                     /locus_tag="SMa0123"
                     /db_xref="GeneID:1235288"
     CDS             complement(65729..66112)
                     /locus_tag="SMa0123"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435309.1"
                     /db_xref="GI:16262516"
                     /db_xref="GeneID:1235288"
                     /translation="MQNSKTSITQQFGSYKPSKAILVWACVATAAATMIVGFNWGGWV
                     TGGTSRTAAAAAADIARGELASAICVERFNAAPDAAAKLIEFKAITDGYKKRQFVEAG
                     GWATMPGETAPDSRSVQGCATALAI"
     gene            complement(66192..67826)
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /db_xref="GeneID:1235289"
     CDS             complement(66192..67826)
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /function="Cell processes; Chaperoning"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; the rhizobia and high GC
                     gram-positive bacteria have multiple copies of the groEL
                     gene which are active under different environmental
                     conditions; the R. leguminosarum protein in this cluster
                     is transcribed under anaerobic conditions and is not
                     necessary for growth"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="NP_435310.1"
                     /db_xref="GI:16262517"
                     /db_xref="GeneID:1235289"
                     /translation="MSAKQIVFSTDARDRLLRGVELLNNAVKVTLGPKGRNVVIDKSY
                     GAPRITKDGVSVAKEIELEDKFENMGAQMVRAVASKTNDLAGDGTTTATVLAASIFRE
                     GAKLVSVGMNPMDLKRGIDLGVAAVLAEIKARATKVISSSEIAQVGTIAANGDAGVGE
                     MIARAMEKVGNEGVITVEEARTADTELDVVEGMQFDRGYLSPYFVTNAEKMRVELEDP
                     YILIHEKKLGSLQAMLPILEAAVQSGKPLLIISEDVEGEVLATLVVNRLRGGLKIAAV
                     KTPGFGDRRKAMLEDIAVLTAGQMISEDLGIKLENVTLDMLGRARRVLIEKDTTTIID
                     GSGDKASIQARVSQIKAQIEETASDYDKEKLQERLAKLAGGVAVIRVGGATELEVKEK
                     KDRIDDALNATRAAVEEGIVPGGGVALLRAKSALVGLTDDNADVTAGISIVRRALEAP
                     IRQIADNAGVEGSIVVGKLVDGRDHNQGFDAQTETYVDMIKAGIVDPAKVVRTALRDA
                     GSIASLLITAEAMIADIPERGSPQSTGNGAVDSMGY"
     misc_feature    complement(66195..67826)
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(66255..67817)
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(66258..66278,66285..66287,66450..66452,
                     66669..66671,66675..66677,67056..67058,67140..67142,
                     67236..67238,67599..67601,67608..67610,67620..67622,
                     67644..67646,67650..67652,67680..67682,67686..67691,
                     67704..67706,67710..67721,67752..67754,67803..67805,
                     67815..67817))
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(66339..66341,66345..66347,66465..66467,
                     66582..66584,66633..66635,67377..67379,67554..67556,
                     67566..67568,67728..67736))
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(66426..66428,66435..66440,66444..66446,
                     66471..66473,66525..66527,67500..67502))
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(66597..66602,66702..66704,67248..67250,
                     67269..67271,67404..67406))
                     /gene="groEL"
                     /locus_tag="SMa0124"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(67874..68191)
                     /gene="groES"
                     /locus_tag="SMa0125"
                     /db_xref="GeneID:1235290"
     CDS             complement(67874..68191)
                     /gene="groES"
                     /locus_tag="SMa0125"
                     /function="Cell processes; Chaperoning"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="NP_435311.1"
                     /db_xref="GI:16262518"
                     /db_xref="GeneID:1235290"
                     /translation="MTFRPLLDRVVIRRAEGNTQSKGGIIIPDTAKEKPQEGEVIAVG
                     PGSRDESGKLIPLDVKIGDTILFGKWSGTEVKIDGEDLLIMKESDIMGIVANTVPTAA
                     NAA"
     misc_feature    complement(67910..68188)
                     /gene="groES"
                     /locus_tag="SMa0125"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(67913..67921,67967..67969,67973..67975,
                     67988..67990,68018..68020,68081..68086,68165..68167,
                     68174..68176,68180..68182,68186..68188))
                     /gene="groES"
                     /locus_tag="SMa0125"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(68099..68140)
                     /gene="groES"
                     /locus_tag="SMa0125"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(68024..68026,68057..68059))
                     /gene="groES"
                     /locus_tag="SMa0125"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            68805..69014
                     /gene="cspA8"
                     /locus_tag="SMa0126"
                     /db_xref="GeneID:1235291"
     CDS             68805..69014
                     /gene="cspA8"
                     /locus_tag="SMa0126"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; C-terminus with CSD,
                     'Cold-shock' DNA-binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="CspA8 Cold shock family protein"
                     /protein_id="NP_435312.1"
                     /db_xref="GI:16262519"
                     /db_xref="GeneID:1235291"
                     /translation="MTTGTVKWFNSTKGFGFIAPDDGSADVFVHISAVERAGMNSIVE
                     GQKLGFELERDNKSGKMSAGQLRAA"
     misc_feature    68811..68975
                     /gene="cspA8"
                     /locus_tag="SMa0126"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    order(68826..68828,68853..68855,68886..68888,68973..68975)
                     /gene="cspA8"
                     /locus_tag="SMa0126"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    order(68844..68864,68883..68894)
                     /gene="cspA8"
                     /locus_tag="SMa0126"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            69135..69515
                     /locus_tag="SMa0128"
                     /db_xref="GeneID:1235292"
     CDS             69135..69515
                     /locus_tag="SMa0128"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435313.1"
                     /db_xref="GI:16262520"
                     /db_xref="GeneID:1235292"
                     /translation="MRHPSDNGFAERRNAAADAKRQLLTKFASAPKPTDPEMREKLAA
                     REAASRARDARRAEREALKTAENERILAEAAASAAAAEAEQRAEAEARQAEISNRVSR
                     VVADEAARKAERDRRYAARKARRA"
     gene            69601..70668
                     /locus_tag="SMa0130"
                     /db_xref="GeneID:1235293"
     CDS             69601..70668
                     /locus_tag="SMa0130"
                     /EC_number="1.14.99.-"
                     /function="Small molecule metabolism; Fatty acid
                     biosynthesis"
                     /note="glimmer prediction, C-terminus with fatty acid
                     desaturase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="fatty acid desaturase"
                     /protein_id="NP_435314.1"
                     /db_xref="GI:16262521"
                     /db_xref="GeneID:1235293"
                     /translation="MSAHVYPPASLVEDNAGAWLKTLAKYRQPRLGRSAFELFVTLVP
                     FAIFWAAACFSLANGFWPGLIAILPASAFLLRLFMIQHDCGHGSFFSRRGLDDWTGRL
                     LGVLTLTPYDYWRRAHAAHHATAGNLDERGVGDITTLTITEYCALSPIKRLGYRLYRH
                     PLVMFGIGPAWLFLFKQRLPFGMMNSGALPWISTMATNFAIVTLAALMVWAVGLGTFL
                     LIHLPVVLLAGAAGVWLFYVQHQFEETHWSAGEDWRFPQAALHGASHYDLPPVLRWLT
                     GNIGIHHVHHLSSRIPYYRLPEVLRDHPQLAGIGRITLWDSLKCVRLVLWDDRRRRLV
                     SFHDAAGSLRRSLTEDGRKTK"
     misc_feature    69634..70650
                     /locus_tag="SMa0130"
                     /note="Fatty acid desaturase [Lipid metabolism]; Region:
                     DesA; COG3239"
                     /db_xref="CDD:225779"
     misc_feature    69697..70488
                     /locus_tag="SMa0130"
                     /note="The Delta12 Fatty Acid Desaturase
                     (Delta12-FADS)-like CD includes the integral-membrane
                     enzymes, delta-12 acyl-lipid desaturases, oleate
                     12-hydroxylases, omega3 and omega6 fatty acid desaturases,
                     and other related proteins, found in a wide range of...;
                     Region: Delta12-FADS-like; cd03507"
                     /db_xref="CDD:239584"
     misc_feature    order(69844..69846,69856..69858,69952..69954,69961..69966,
                     70444..70446,70453..70458)
                     /locus_tag="SMa0130"
                     /note="putative di-iron ligands [ion binding]; other site"
                     /db_xref="CDD:239584"
     gene            70668..70955
                     /locus_tag="SMa0132"
                     /db_xref="GeneID:1235294"
     CDS             70668..70955
                     /locus_tag="SMa0132"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435315.1"
                     /db_xref="GI:16262522"
                     /db_xref="GeneID:1235294"
                     /translation="MIELTPTQIRGLKLAKDGDVHPQAGKRWTHLNAQVTYAKQDRFK
                     ERPQKIKFLTTATLNELRDHRLVKALNTDVPPEESAHGITMAGKMLLLKIK"
     gene            complement(71066..71671)
                     /locus_tag="SMa0134"
                     /db_xref="GeneID:1235295"
     CDS             complement(71066..71671)
                     /locus_tag="SMa0134"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; similar to Smb20087 of S.
                     meliloti pSymb"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435316.1"
                     /db_xref="GI:16262523"
                     /db_xref="GeneID:1235295"
                     /translation="MRTVTGLFDDYGDAREAVSDLEAAGVPSDDISIVANNIGDRYST
                     DGSNAAEGAGTGAGLGAAGGGVVGLLTGLGLMAIPGVGPVVAAGWLASTAAGAAAGAI
                     AGGAAGGLIGALTESGVDEEDAHVYAEGVRRGGTLVTARVEDSVAPRAEAILKQRKIV
                     DPAARRSIYAQEGWSRFDENADPYTLDQVDRERERYRSMMP"
     gene            complement(71712..72026)
                     /locus_tag="SMa5002"
                     /db_xref="GeneID:6435253"
     CDS             complement(71712..72026)
                     /locus_tag="SMa5002"
                     /note="Similar to S; meliloti SMb20086 and to
                     Agrobacterium tumefaciens Atu5288 & Atu5493"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000331.1"
                     /db_xref="GI:193782536"
                     /db_xref="GeneID:6435253"
                     /translation="MKNIIIVAAALMSAATTASLAQTTPSSEGETPAVATPDSQNPTA
                     PVEGANSFTEAQAKERIEEAGYTDVSGLKLDDKGVWQATAMKEGKSVSVALDYQGNVT
                     AQ"
     misc_feature    complement(71739..72017)
                     /locus_tag="SMa5002"
                     /note="Peptidase propeptide and YPEB domain; Region:
                     PepSY_2; pfam13670"
                     /db_xref="CDD:257976"
     gene            72274..74286
                     /locus_tag="SMa0136"
                     /db_xref="GeneID:1235296"
     CDS             72274..74286
                     /locus_tag="SMa0136"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction, partial conserved with
                     hypothetical membrane protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435317.2"
                     /db_xref="GI:193782537"
                     /db_xref="GeneID:1235296"
                     /translation="MLKFSRGIDQDRAATAGGLQQIAFARGSAAAAQPSRLPTLVATA
                     AAVAVLYFARDVFLPLAIAILLTFALAPLVSRLRRVGCPRSVAVIGTVTTAFLFLSAF
                     GVVIAMQVSEVAQNLPTYQYNIVEKVRTLKETGSESQILERIGRVIERISTEISRPEP
                     EVRASPEPTPETKPLLVEIFSPQRPIETLKNIINPLLGPLATTGLVIVVVIFMLLERE
                     ELRDRFIRLVGYGDLHRTTEALQDAGARVGRYLLMQLVVNITYGIPLAIGLSLLGIPN
                     AVLWGMLAIVLRFVPYIGPVIAAALPLFLAFAAAPGWSLLVWTAALFIVLELLSNNVV
                     EPWLYGSRTGLSPLAIIVAAIFWAWLWGPVGLVLSTPLTVCLVVLGRHVPQFEFLEIL
                     LGNEPVLDPKERLYQRLLAGDPDEATDNAEDMLQEKYLVEFYDTVAIPALLLAERDRA
                     RGALTNTQAAQIAQSANTLIANLEEIAGEEEGEEETSTEAQESDDDNDDAEEYDLPPG
                     DGKSVLCVGGRSDLDDVTASMLAQTLWIQGADAAHATHEVLKAGNIKALQLEGRNAVV
                     LSVLDQDFMRHAKFTVRRLKRIAPAARVGIVLWKEDGRPGTTERDQLIESLQADFVVF
                     GMGDAVREALSDELPRSLKLAHPKIAPGYAMRRSKRTDTESTVKAD"
     misc_feature    72424..73467
                     /locus_tag="SMa0136"
                     /note="Predicted permease, member of the PurR regulon
                     [General function prediction only]; Region: yhhT; COG0628"
                     /db_xref="CDD:223701"
     misc_feature    73810..74175
                     /locus_tag="SMa0136"
                     /note="B12 binding domain (B12-BD). Most of the members
                     bind different cobalamid derivates, like B12
                     (adenosylcobamide) or methylcobalamin or methyl-Co(III)
                     5-hydroxybenzimidazolylcobamide. This domain is found in
                     several enzymes, such as glutamate mutase; Region:
                     B12-binding_like; cl00293"
                     /db_xref="CDD:260332"
     gene            74378..76579
                     /locus_tag="SMa0137"
                     /db_xref="GeneID:1235297"
     CDS             74378..76579
                     /locus_tag="SMa0137"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction, C-terminus similar to nitrogen
                     fixation positive activator protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Diguanylate cyclase/phosphodiesterase"
                     /protein_id="NP_435318.2"
                     /db_xref="GI:193782538"
                     /db_xref="GeneID:1235297"
                     /translation="MRFVAGKVAVFRWMLPLAIAMALMGGIYLAVRWSAQQSDAVAVK
                     RQQHLVELVISKMQGSIAHDQESVTVWDDAVRKVSQEWDPRWVDSNLGSWMNSYFRHD
                     GAFVISPDRKPLYAFLAGQTNEQEAFSEIGPEAMPLIAKLQERLAAGDEGGTSEQVLS
                     IGESDLVRIGGRPAIISVKPIVSDTGDIVQEPGREYLHLAARFLDGDFLTHLGDDYGF
                     EDLRFSVLPELGRQRSYAPIVSSSRETIGYFSWLPFRPGADVMKATAPVLLVAGALLF
                     ALTSALSVVLRRRSRRLQESQAELDHLARHDPLTGLANRASFNRLLARVVATSTIDQA
                     NALLYLDLDRFKQVNDTLGHPVGDRLMVEVAKRLKETAAGAAISRIGGDEFTIIVART
                     RQDEVEKLCDALIAAIRRPFEIDGQPILIGLSIGVAVATGNDADPIEITRKADIALYH
                     AKSAGRNRYAVFGPHMDELIRTKRDLEQDLRAALDAGNQLEVFYQPVYSAQSHEISSL
                     EALIRWRHPSKGPIAPDAFVPLAETAGLIDRLGAFVLKEACSTAREFPGLDIAVNVSA
                     VELAQRHYAAQVLSLLRQFGIEPSRLELEITETALLDEAGVCEKNITALREFGVKFAL
                     DDFGTGFSSFGRLQRLEVDRIKIDRSFVHAFDRPGGGVAVVQSIVGIAHAKGLRITAE
                     GVETEEQSEILRKLGCDELQGFHLSRPMSKNSLRQLLGADKAQGTSSSSRS"
     misc_feature    74378..75220
                     /locus_tag="SMa0137"
                     /note="Predicted periplasmic ligand-binding sensor domain
                     [Signal transduction mechanisms]; Region: COG3322"
                     /db_xref="CDD:225859"
     misc_feature    75290..75757
                     /locus_tag="SMa0137"
                     /note="Diguanylate-cyclase (DGC) or GGDEF domain; Region:
                     GGDEF; cd01949"
                     /db_xref="CDD:143635"
     misc_feature    order(75398..75400,75524..75526)
                     /locus_tag="SMa0137"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143635"
     misc_feature    order(75413..75415,75422..75427,75437..75439,75449..75451,
                     75512..75514,75518..75529)
                     /locus_tag="SMa0137"
                     /note="active site"
                     /db_xref="CDD:143635"
     misc_feature    order(75500..75502,75584..75586)
                     /locus_tag="SMa0137"
                     /note="I-site; other site"
                     /db_xref="CDD:143635"
     misc_feature    75809..76510
                     /locus_tag="SMa0137"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(76655..76975)
                     /locus_tag="SMa0139"
                     /db_xref="GeneID:1235298"
     CDS             complement(76655..76975)
                     /locus_tag="SMa0139"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435319.1"
                     /db_xref="GI:16262526"
                     /db_xref="GeneID:1235298"
                     /translation="MLTVDFTVAGILNGGPAFKHNEAFSFQIATDDQEETDRYWNAIV
                     GNGGQESACGWCKDKWGISWQITPRVLAEAMAAGGDEAKRAFEAMMTMKKIDVAAIEA
                     ARRG"
     misc_feature    complement(76676..>76975)
                     /locus_tag="SMa0139"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG3865"
                     /db_xref="CDD:226383"
     misc_feature    complement(order(76781..76783,76787..76789,76811..76813,
                     76901..76903,76940..76942,76967..76969))
                     /locus_tag="SMa0139"
                     /note="active site"
                     /db_xref="CDD:211348"
     gene            complement(77422..78822)
                     /locus_tag="SMa0142"
                     /db_xref="GeneID:1235299"
     CDS             complement(77422..78822)
                     /locus_tag="SMa0142"
                     /EC_number="3.4.21.-"
                     /function="Macromolecule metabolism; Macromolecule
                     degradation; degradation of proteins, peptides,
                     glycopeptides"
                     /note="glimmer prediction; C-terminus with peptidase S8
                     (Subtilase) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="protease"
                     /protein_id="NP_435320.1"
                     /db_xref="GI:16262527"
                     /db_xref="GeneID:1235299"
                     /translation="MLTKLKLALIAPIAAIALVSGDILAPGNMIVREVIGTGLALADD
                     DDDDGGSGGNRGSGGSGRSGSYGAGAGWSGGKSLFPFREFLPRRSIPRRSRAAAPAAP
                     IRAPDEIVGLGFSPTELGELTATGFEVLERNTMTSFNAEVIKLRIPRRLTLEAARQRA
                     RAAAPQAVIDFNHYFRPEQHPDAPCVTSDCLARDVIGWPSAQTGLSNCAAGVRIGLVD
                     TAINPDHLAFEARNIEIVRLVEEELPESGRQHGTAVAALLVGSASSRTPGLIPGGKLI
                     AVDAFHRGERQDDRSAAFDLARALDLLTRRQVQVINLSLAGPPNLLLEQAVMKAGERG
                     IIMVAAAGNDGPKAEPVYPAAYEEVIAVTATDRRKRPYRRAGRGEHIDFAAPGVAVWT
                     AASVSGARPKTGTSFAAPFVTAAVAMMKASEPDLAPEMIHSRLSGHAEDLGDPGKDAV
                     FGWGLLNARAICKTKS"
     misc_feature    complement(77461..78189)
                     /locus_tag="SMa0142"
                     /note="Peptidase S8 family domain, uncharacterized
                     subfamily 4; Region: Peptidases_S8_4; cd05561"
                     /db_xref="CDD:173797"
     misc_feature    complement(77455..78183)
                     /locus_tag="SMa0142"
                     /note="Subtilase family; Region: Peptidase_S8; pfam00082"
                     /db_xref="CDD:249571"
     misc_feature    complement(order(77605..77607,77794..77796,77878..77880,
                     77935..77937,78073..78075,78169..78171))
                     /locus_tag="SMa0142"
                     /note="active site"
                     /db_xref="CDD:173797"
     misc_feature    complement(order(77605..77607,78073..78075,78169..78171))
                     /locus_tag="SMa0142"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:173797"
     gene            78965..79507
                     /gene="rpoE6"
                     /locus_tag="SMa0143"
                     /db_xref="GeneID:1235300"
     CDS             78965..79507
                     /gene="rpoE6"
                     /locus_tag="SMa0143"
                     /function="Macromolecule metabolism; Macromolecule
                     synthesis, modification; RNA synthesis, modification, DNA
                     transcription"
                     /note="glimmer prediction; partial homology with RNA
                     polymerase sigma factor; with Sigma-70 factor (ECF
                     subfamily) domain"
                     /codon_start=1
                     /transl_table=11
                     /product="RNA polymerase ECF sigma factor"
                     /protein_id="NP_435321.2"
                     /db_xref="GI:193782539"
                     /db_xref="GeneID:1235300"
                     /translation="MSNAVKDVGERLMAFLPNLRRFAISLCGSRDVADDLVQSACERA
                     LASAERFEPGTRFDAWIFRILRNLWIDQVRRQKTAGVQDDITERHDIAGSSGERETEA
                     RLTLKTVAEAITELPDEQREVVLLVCVEELSYREAADVMGIPIGTVMSRLMRARRSLA
                     EAAGITQATGRSQSMKGANE"
     misc_feature    78998..79450
                     /gene="rpoE6"
                     /locus_tag="SMa0143"
                     /note="RNA polymerase sigma factor, sigma-70 family;
                     Region: sigma70-ECF; TIGR02937"
                     /db_xref="CDD:234065"
     misc_feature    79001..79195
                     /gene="rpoE6"
                     /locus_tag="SMa0143"
                     /note="Sigma-70 region 2; Region: Sigma70_r2; pfam04542"
                     /db_xref="CDD:252661"
     misc_feature    79289..79441
                     /gene="rpoE6"
                     /locus_tag="SMa0143"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cd06171"
                     /db_xref="CDD:100119"
     misc_feature    order(79313..79315,79343..79345,79361..79366,79394..79396,
                     79400..79405,79409..79417,79421..79426,79430..79432)
                     /gene="rpoE6"
                     /locus_tag="SMa0143"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     gene            79504..80289
                     /locus_tag="SMa0144"
                     /db_xref="GeneID:1235301"
     CDS             79504..80289
                     /locus_tag="SMa0144"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435322.1"
                     /db_xref="GI:16262529"
                     /db_xref="GeneID:1235301"
                     /translation="MTRADFSDEILMRFADGELDTGTAAEVERAMETDDALVARVALF
                     IETRHAAKAAMEPLLDEPVPSELKRAVERMVMEKTSPPSVSGAGILPFPRRAANESHR
                     SRWLAPVAASLAAVVAGFGGYWLRGSVEAPIEGGLGVAAIGSPALDEALATVAAGEER
                     RLPGSDQRFRAIATFRDNAQALCREFELDSDDRSTVVSVACRAGSEWRVTFAVIAPGA
                     TGGYAPASSTETLDAYLTAIDAGAPLEAAEEARALSELQGAQR"
     misc_feature    79504..80280
                     /locus_tag="SMa0144"
                     /note="Predicted transmembrane transcriptional regulator
                     (anti-sigma factor) [Transcription]; Region: COG5662"
                     /db_xref="CDD:227949"
     gene            complement(80295..80819)
                     /locus_tag="SMa0146"
                     /db_xref="GeneID:1235302"
     CDS             complement(80295..80819)
                     /locus_tag="SMa0146"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435323.1"
                     /db_xref="GI:16262530"
                     /db_xref="GeneID:1235302"
                     /translation="MSGPRSLVAPSTFPQSQRPVCHSLPGRYDRSDRFELELDERFEE
                     EFDELFEDELELEFEELLDEELELELLEELELELLEELELELDELLPATMISPSVRPV
                     WAVCVEVRSTPGNKGAYSLASAAEPTNAARPAAIALFVQFFAISSTPCENRTGSSVRR
                     SNGRCAPLFHDRNF"
     gene            complement(80960..81673)
                     /locus_tag="SMa0148"
                     /db_xref="GeneID:1235303"
     CDS             complement(80960..81673)
                     /locus_tag="SMa0148"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435324.1"
                     /db_xref="GI:16262531"
                     /db_xref="GeneID:1235303"
                     /translation="MLSFLKKDPQVIQFVCHPEDDGVIAPPLPAKSVLPDWFRRLPAV
                     DKGHLSATNNGLTVKRCMPFLDAMTTGWILPIAATVRLDVKDDGRSVDAGWEFDRVMV
                     SNHGAHQVAGNPKEPSPPCKFHNYWSIRTPPGWSCLFLPPLNRPGQPFECVAGIVDTD
                     SYSAHIHFPFFATAPDGLHVVEKGTPLVQVIPFRRADAAVTAEIRAETRAEATEREAI
                     HRNTLAGEGWYRKSARAAR"
     gene            81858..82340
                     /locus_tag="SMa0149"
                     /db_xref="GeneID:1235304"
     CDS             81858..82340
                     /locus_tag="SMa0149"
                     /function="Miscellaneous; Unknown"
                     /note="activates RNA polymerase to cleave back-tracked RNA
                     during elongational pausing"
                     /codon_start=1
                     /transl_table=11
                     /product="transcription elongation factor regulatory
                     protein"
                     /protein_id="NP_435325.1"
                     /db_xref="GI:16262532"
                     /db_xref="GeneID:1235304"
                     /translation="MSVAFIKEESAETASETLLPDRPISPHPNLVTETGLKALELHLQ
                     QAREAFDATSTIEDVNERRRQSAGPLRELRYFAERVRTAQLVPDPASFDVVAFGSTVT
                     FSRDDGRVQKYRIVGEDEADPKAGSISYVSPVARVLMGKSVGDVASVGDQELEILAIS
                     "
     misc_feature    81858..82337
                     /locus_tag="SMa0149"
                     /note="transcription elongation factor regulatory protein;
                     Validated; Region: PRK06342"
                     /db_xref="CDD:180535"
     misc_feature    82134..82337
                     /locus_tag="SMa0149"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            complement(82374..83900)
                     /locus_tag="SMa0150"
                     /db_xref="GeneID:1235305"
     CDS             complement(82374..83900)
                     /locus_tag="SMa0150"
                     /EC_number="6.2.1.-"
                     /function="Small molecule metabolism; Fatty acid
                     biosynthesis"
                     /note="catalyzes the formation of malonyl-CoA from
                     malonate and CoA"
                     /codon_start=1
                     /transl_table=11
                     /product="malonyl-CoA synthase"
                     /protein_id="NP_435326.1"
                     /db_xref="GI:16262533"
                     /db_xref="GeneID:1235305"
                     /translation="MSNHLFDAIRRAARPDSAFILTADGRVWTYGDMLEHSGRIASVL
                     DALGVRPGDRVAVQVEKSPEALMLYLACLRTGAVYLPLNTAYTLAELDYFFGDAEPRL
                     IVCAPGAKEGIAKHAADCGAEVETLDEKGGGSLIDLARGKAPDFPDADRGPDDLAAIL
                     YTSGTTGRSKGAMLTHDNLLSNATTLREYWRFTADDRLIHALPIFHTHGLFVASNVIL
                     LAGASMFFLPKFDANEVLRLMPQSTSMMGVPTFYVRLVQNPGLTHEATAGMRLFVSGS
                     APLLAETHRTFAQMTGHAILERYGMTETNMNTSNPYDGERIAGTVGFPLPGVSLRVAD
                     PESGRPLPKGETGMIEVKGPNVFKGYWRMPEKTQGEFRADGFFITGDLGRIDERGYVH
                     IVGRGKDLVISGGYNIYPKEVETEIDQMPGVVETAVIGLPHPDFGEGVTAVVVRKPGA
                     AIDERAILDGLEGRLARYKQPKRVIFVDDLPRNTMGKVQKNVLRETYARLYAGAEARV
                     "
     misc_feature    complement(82395..83900)
                     /locus_tag="SMa0150"
                     /note="malonyl-CoA synthase; Validated; Region: PRK07514"
                     /db_xref="CDD:181011"
     misc_feature    complement(82431..83855)
                     /locus_tag="SMa0150"
                     /note="Malonyl-CoA synthetase (MCS); Region: MCS; cd05941"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(83391..83396,83400..83417,83424..83426))
                     /locus_tag="SMa0150"
                     /note="acyl-activating enzyme (AAE) consensus motif; other
                     site"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(82485..82487,82593..82595,82680..82682,
                     82689..82691,82698..82700,82722..82724,82758..82760,
                     82938..82940,82983..82985,82995..83012,83067..83075,
                     83139..83141,83151..83153,83157..83159,83277..83285,
                     83292..83297,83415..83417))
                     /locus_tag="SMa0150"
                     /note="active site"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(82680..82682,82698..82700,82722..82724,
                     82758..82760,82938..82940,82995..83012,83067..83075,
                     83415..83417))
                     /locus_tag="SMa0150"
                     /note="AMP binding site [chemical binding]; other site"
                     /db_xref="CDD:213307"
     misc_feature    complement(order(82485..82487,82593..82595,82683..82691,
                     82983..82985,82995..83003,83007..83009,83073..83075,
                     83139..83141,83151..83153,83157..83159,83277..83285,
                     83292..83297))
                     /locus_tag="SMa0150"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213307"
     gene            complement(83897..86626)
                     /locus_tag="SMa0151"
                     /db_xref="GeneID:1235306"
     CDS             complement(83897..86626)
                     /locus_tag="SMa0151"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="predicted by codon usage pattern and blastx.
                     N-terminus of  protein is similar to eukaryotic malonyl
                     CoA decarboxylase, mitochondrial precursor. C-terminus is
                     similar to various membrane proteins including those for
                     C4 dicarboxylic acid transport"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435327.2"
                     /db_xref="GI:193782540"
                     /db_xref="GeneID:1235306"
                     /translation="MIVACLFVLLATGMPIAFALGLAAFAALYMQSGAGIFYVLGDTM
                     FSGIANLAYVSIPMFVLMGAAVASSPAGSDLYTSLDRWLNRIPGGLILSNIGACAIFS
                     GMTGSSPATCAAIGKMGIPEMMRRGYPASVASGSIAAGGTLGILIPPSVTLIVYGIAT
                     ETSIGRLFMAGILPGILLTIMFMTWAVIDCKRKGYEFEARLVRYSMKERLAVLPRILP
                     FLLIIAGTLYVLYGGIATPSEAAGAGAFLTLAVVIVAYRLFRFRPVAGIFGSAMKESV
                     MIMMIMAAAELFAFALSSLFITQTVAAAIADMEVNRWVLMAVINVFLLICGMFLPPVA
                     VIVMTSPMLFPIVTQAGFDPYWFAIVLTINMEVGLITPPIGLNLFVINAIAPQIPTKD
                     ILWGSLPYVLVMFLAIILLCVFPDVATWLPNQMLGDRPMNTTSFFSDMLQSIAERGRR
                     FLSLGPARNGDVNPVGTMEALCDTLLSSRGEASGMALAKNILDRWQGFDQDKRRDFML
                     ALLSRFGPDIERLERAIDAYRADPTPKALLEMSMAAEPRRQELIRRLNLAPNGIATLV
                     RMRADLLELKAQNPDLEAVDTDFAHLFGSWFNRGFLVLRPISWSTPADILEKIIRYEA
                     VHHIGGWDELRRRLAPEDRRCFAFFHPQLVDDPLIFVEVALTREMPPNIADLLKEDRA
                     PIRATDATTAVFYSISNCQEGLRGISFGNFLIKQVVEDLRRDLPRLDTFVTLSPVPGF
                     ADWLSRERQAETSNALSAADRSRLAALDEPDWADQPEIAAAIQPSLTAAAAWYFLRAR
                     NRNGKTVDPVARFHLGNGARLERINFLGDRSERAMRQAHGLMVNYLYKLDDIETNHEA
                     FATRGEVVAAPAIRRLIPADRSSRSLVPGPNVFPPGVRSADAPGRKGDKEFTS"
     misc_feature    complement(85382..86620)
                     /locus_tag="SMa0151"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     misc_feature    complement(85352..86497)
                     /locus_tag="SMa0151"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; COG1593"
                     /db_xref="CDD:224509"
     misc_feature    complement(84089..85099)
                     /locus_tag="SMa0151"
                     /note="Malonyl-CoA decarboxylase (MCD); Region: MCD;
                     pfam05292"
                     /db_xref="CDD:253136"
     gene            complement(86647..87216)
                     /locus_tag="SMa0155"
                     /db_xref="GeneID:1235307"
     CDS             complement(86647..87216)
                     /locus_tag="SMa0155"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435328.1"
                     /db_xref="GI:16262535"
                     /db_xref="GeneID:1235307"
                     /translation="MLKAYSRAVGNASRGLAAVATALLIAAMLVVCQMIMQRYVFRQA
                     TIWQTDFVVFSATAAMFLGAPYVLLKGGHVGIDVVEMVVGERTRYVLRIIAGLLGLLF
                     CAVMLIATWIQFHDAWAGNWKHSSVWAPPLWVPLAALPVSFAMLCLQYVAQILTLLTA
                     PAVPAAMGHGAAEPGSAPGADRHPQEIIQ"
     misc_feature    complement(86677..87216)
                     /locus_tag="SMa0155"
                     /note="TRAP-type C4-dicarboxylate transport system, small
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctM; COG3090"
                     /db_xref="CDD:225632"
     gene            complement(87283..88287)
                     /locus_tag="SMa0157"
                     /db_xref="GeneID:1235308"
     CDS             complement(87283..88287)
                     /locus_tag="SMa0157"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435329.1"
                     /db_xref="GI:16262536"
                     /db_xref="GeneID:1235308"
                     /translation="MSSFRRKLTTSAVAAICSLVASTAGAQTVLKASHQFPGGKGDIR
                     DEMVQLIAREVAAANVGLEIQVFPGSSLYKPNDQWNAVTRGLLDMTSFPLDYASGRHP
                     EFSATLMPGLVGNFDRAMRLNDSEFMGDIKKVIENAGALVIADAWLSGAFASKKNCIT
                     SPDTIKGQVIRAAGPAFEEMLVEAGASISSMPSSEIYTGMQTGVLDAANTSSASFVSY
                     RLFEQAKCLTAPGENALWFMYEPVLVSKRVFDGLTEEQQKAILAAGEKAEVYFNEEVR
                     KGDQVMIDTYKKAGVEVVEMSKEDYDAWLELAKASSYKNFAANVPGGDKLIEKALAVK
                     "
     misc_feature    complement(87286..88287)
                     /locus_tag="SMa0157"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            88416..89090
                     /locus_tag="SMa0160"
                     /db_xref="GeneID:1235309"
     CDS             88416..89090
                     /locus_tag="SMa0160"
                     /function="Miscellaneous; Not classified regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435330.1"
                     /db_xref="GI:16262537"
                     /db_xref="GeneID:1235309"
                     /translation="MSENIFYKLRDDIENGIVTGEFEPGERLDETQLAMRFGVSRTPI
                     REALMQLSAIGLVEIRPRRGAVVVDPAPQRVYEMFEVMAELEGMAGALAARRHTEEDS
                     AALLAAHEKCREAVLSEETDRYYYENEIFHRAIYTASHSGFLEEQCTTLHRRLRPYRR
                     LQLRVRNRMKVSFREHGEIVEAILSGNTDGAREGLRSHVAVQGDRFGDLVANLSNRER
                     RSGRLG"
     misc_feature    88416..89069
                     /locus_tag="SMa0160"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    88428..88616
                     /locus_tag="SMa0160"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(88431..88433,88500..88502,88503..88508,88530..88544,
                     88548..88553,88560..88562,88590..88595,88599..88610)
                     /locus_tag="SMa0160"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    88644..89015
                     /locus_tag="SMa0160"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(89275..89520)
                     /locus_tag="SMa0162"
                     /db_xref="GeneID:1235310"
     CDS             complement(89275..89520)
                     /locus_tag="SMa0162"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435331.2"
                     /db_xref="GI:193782541"
                     /db_xref="GeneID:1235310"
                     /translation="MTISSNRCTALIVTVLPFATLIDREKFDEISTESPFADAGGLTP
                     MPVHRATTKQKNAKREPLDLVMVPVFLHDTRHNVALS"
     gene            89324..90724
                     /gene="pilQ2"
                     /locus_tag="SMa0163"
                     /db_xref="GeneID:1235311"
     CDS             89324..90724
                     /gene="pilQ2"
                     /locus_tag="SMa0163"
                     /function="Structural elements; Cell exterior; surface
                     structures"
                     /note="similar to hypothetical 44.3 kDa protein Y4XJ in
                     Rhizobium sp. NGR234"
                     /codon_start=1
                     /transl_table=11
                     /product="PilQ2 pilus assembly protein"
                     /protein_id="NP_435332.2"
                     /db_xref="GI:193782542"
                     /db_xref="GeneID:1235311"
                     /translation="MTRSRGSLFAFFCFVVALCTGIGVSPPASANGDSVEISSNFSRS
                     IKVAKGKTVTIRAVQRFDEIVIGDPEIATVTPLTDRSFYILGNELGSTSVTIFDAEKN
                     PVGIIDIEVTLDTKLLSSTIRQSVPGSSVKVTSANGRIVLSGSATDAVAATQAEQIAS
                     RFAGDEEVINSIKITSSQQVQLNVRFVEINRDVGKELGTQISAAYAWSNGSVEFNSSP
                     RATSNTPAGSLIGSLIGEGYSVDVAIDALEDRGMARRLAEPNLIARSGETSSFLAGGE
                     FPIPISEQDGTITVSYKKFGVGLDFTPTVLSDGLIALDIEPEVSAIDNTASYRVGNIA
                     IPGFSVRRARTSVDLKSGQSFMIAGLLQSENNLITQRVPGLGQLPILGALFSSKAYQR
                     RETDLVIIVTPHLVKPIDPLKKVASPSDRTKRPTEAEFFLGNIDEVEVNGRGRSASRQ
                     ARVVRAPSSGHFLELQ"
     misc_feature    89405..90688
                     /gene="pilQ2"
                     /locus_tag="SMa0163"
                     /note="Flp pilus assembly protein, secretin CpaC
                     [Intracellular trafficking and secretion]; Region: CpaC;
                     COG4964"
                     /db_xref="CDD:227299"
     misc_feature    89447..89659
                     /gene="pilQ2"
                     /locus_tag="SMa0163"
                     /note="Pilus formation protein N terminal region; Region:
                     T2SS-T3SS_pil_N; pfam13629"
                     /db_xref="CDD:257939"
     misc_feature    89696..89851
                     /gene="pilQ2"
                     /locus_tag="SMa0163"
                     /note="BON domain; Region: BON; pfam04972"
                     /db_xref="CDD:203137"
     misc_feature    90059..90544
                     /gene="pilQ2"
                     /locus_tag="SMa0163"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            90721..91017
                     /locus_tag="SMa0164"
                     /db_xref="GeneID:1235312"
     CDS             90721..91017
                     /locus_tag="SMa0164"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435333.1"
                     /db_xref="GI:16262540"
                     /db_xref="GeneID:1235312"
                     /translation="MIRRSSRPRGFPGLLFASSILLSGCQNHELVRSETIALSAGDAI
                     AANSVMQMVDPWPPRVKQTSLATPADLEQYKPQQPNAEQNGGNGETYPNDTTTQ"
     gene            91039..91569
                     /locus_tag="SMa0166"
                     /db_xref="GeneID:1235313"
     CDS             91039..91569
                     /locus_tag="SMa0166"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435334.1"
                     /db_xref="GI:16262541"
                     /db_xref="GeneID:1235313"
                     /translation="MEMTTGASGRSVLGRSGGGRRPTELVMAIVATVILSSCQTSEVL
                     SGAEFDPTSALASSGDVSKSDLDQGKLQFMNGNYGLAEKHFRKAVELRQDNAEALMGL
                     AACYDRLGRFDLADRAYNQLLKVAGRQPRIVNNMGYSQYLRGEKAKARKLLLEARAAS
                     PGDETIEANLALLDRS"
     misc_feature    91234..91521
                     /locus_tag="SMa0166"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(91234..91239,91246..91251,91336..91341,91345..91350,
                     91357..91362,91438..91443,91450..91455,91462..91467)
                     /locus_tag="SMa0166"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    order(91243..91245,91279..91281,91291..91293,91300..91302,
                     91345..91347,91381..91383,91393..91395,91402..91404,
                     91447..91449,91483..91485,91495..91497,91504..91506)
                     /locus_tag="SMa0166"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    91318..91521
                     /locus_tag="SMa0166"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     gene            91653..92465
                     /locus_tag="SMa0168"
                     /db_xref="GeneID:1235314"
     CDS             91653..92465
                     /locus_tag="SMa0168"
                     /function="Macromolecule metabolism; Macromolecule
                     synthesis, modification; RNA synthesis, modification, DNA
                     transcription"
                     /note="glimmer prediction; with ribosomal RNA adenine
                     dimethylases domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435335.1"
                     /db_xref="GI:16262542"
                     /db_xref="GeneID:1235314"
                     /translation="MAMASDVLARSFGKEAFGLDPQNYHTARPAYPELVWDALRNRAG
                     LRRGISILEIGAGTGLATERLLEDRPHRLLAVEPDRRLARFLRGRLDKEELEVVETPF
                     EKLKVPEKSFDLVVSATAFHWIDAAPALRRIHRLLRAGGTVALFWNVFGDGVRPDPFH
                     RATAHLFSGHRTSPSGGGTTKTPYGLNVGARLGELAEAGFTADEPELIDWTLALDPPA
                     VRRLYATYSNVTALPADERERLLSGLEKIAETEFAGVVTRNMTTSVYTGRRE"
     misc_feature    91761..92426
                     /locus_tag="SMa0168"
                     /note="hypothetical protein; Provisional; Region:
                     PRK08317"
                     /db_xref="CDD:181382"
     misc_feature    91803..92087
                     /locus_tag="SMa0168"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(91812..91832,91881..91886,91950..91958,92004..92006)
                     /locus_tag="SMa0168"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            92526..93311
                     /locus_tag="SMa0169"
                     /db_xref="GeneID:1235315"
     CDS             92526..93311
                     /locus_tag="SMa0169"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="methyltransferase"
                     /protein_id="NP_435336.1"
                     /db_xref="GI:16262543"
                     /db_xref="GeneID:1235315"
                     /translation="MALDRADFYDAELARHNRQLRVAADFGADDRVLDIGCGAGQTTR
                     EAARAAPQGEAIGVDISAEMLEEARRRSAAEGLRNAMFEQGDAQFHGFPTGSFDLCIS
                     RFGVMFFADPAAAFANIGRAMRPGARLVWMVWQSRERNEWSRAIRQALAPAIAVSAGA
                     ANPFSLGDPPVATDLLSAAGFTSIDFADVQEPVFYGSDVDAAFDALTSLYLVQDALAS
                     TNEPPDKPLQRLRDLLEGHMTPEGVFFDSRAWIITARRAGGGG"
     misc_feature    92616..92915
                     /locus_tag="SMa0169"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(92628..92648,92700..92705,92778..92786,92832..92834)
                     /locus_tag="SMa0169"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(93492..94256)
                     /locus_tag="SMa0171"
                     /db_xref="GeneID:1235316"
     CDS             complement(93492..94256)
                     /locus_tag="SMa0171"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435337.1"
                     /db_xref="GI:16262544"
                     /db_xref="GeneID:1235316"
                     /translation="MNATKLLLILPLLAAFAYISLVSLTYLSQRALLYPGASATPAPE
                     RASWGQNASIQTPDGETLHGLYSRGEPGQPSVLFFLGNADRVSNYGFFAQALAARGIG
                     LLALSYRGYPGSSGTPNEHGLLIDGIAAFDWLAARSGNEIVVLGQSLGSGVAVDTAGK
                     RPAVAVILVSAYLSVLSLAQTYYPFFPVALLTKDPFRSDLKIAGVRQPEAVYPRPARH
                     HHPIVFGRSSVSDRSRAQADAHLRCRPQRSVGCPHG"
     misc_feature    complement(93669..94031)
                     /locus_tag="SMa0171"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_5;
                     pfam12695"
                     /db_xref="CDD:257229"
     gene            94473..95393
                     /locus_tag="SMa0172"
                     /db_xref="GeneID:1235317"
     CDS             94473..95393
                     /locus_tag="SMa0172"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; C-terminal homology with
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435338.1"
                     /db_xref="GI:16262545"
                     /db_xref="GeneID:1235317"
                     /translation="MSNSKDEVERIDWLEAELADTIDEDYELELSEPTLSEKIREIYR
                     KAHPPALPRMDYFRALLALQAELIKLQDWVVYHKQKVVVIFEGRDAAGKGGVIKRITQ
                     RLNPRIVRTVALPAPSDREKTQWYFQRYVPHLPAGGEIVLFDRSWYNRCGVERVMGFA
                     TEEEVEQFFDDVPEFERMLVRSGVRLVKYWFSITDEEQQLRFLTRIHDPLKQWKLSPM
                     DLQSRVRWEAYTKAKEETFARTNIREAPWHIVEANDKKRARLNCIDHLLKQIPYEDVP
                     HEDITLPERIFNPNYERKVLPPELYVPAKY"
     misc_feature    94524..95300
                     /locus_tag="SMa0172"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG2326"
                     /db_xref="CDD:225207"
     gene            complement(95789..96871)
                     /locus_tag="SMa0175"
                     /db_xref="GeneID:1235318"
     CDS             complement(95789..96871)
                     /locus_tag="SMa0175"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; partial homology with
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435339.1"
                     /db_xref="GI:16262546"
                     /db_xref="GeneID:1235318"
                     /translation="MERGDKEQENLSRLEQAAQQTADPKTMQQKATKGPEEKLRFSLR
                     KKDVWWTVGLAAAALLLFGIQVLINWRLDWLDVPLRLRVMNYVKGGLLIFIMLTVANV
                     IEVFLIGRIPNRVSRFNLKRIFRLVVVVAIVFVAISVLFVNWYAAFVSLGLISLILGF
                     ALQMPISSFIAWIYILARAPYRVGDRIRIGDAHGDVIDVSYLDTTLWEFGGEYLWTDH
                     PSGRIIKFPNSTVFDTPVFNYSWPLFPYVWNEIKFQLAYESDLEFVARTMREVVEEQV
                     GDIMSQKVKIYKHILSNTPVDELEVKEHPVVHFRVSENTWLEAIVRYLVPPKEAGRTK
                     TRLIKEMLARMNAEPDRVLFPKSNLR"
     misc_feature    complement(95900..96682)
                     /locus_tag="SMa0175"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    complement(95828..96460)
                     /locus_tag="SMa0175"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            complement(98400..99317)
                     /locus_tag="SMa0179"
                     /db_xref="GeneID:1235319"
     CDS             complement(98400..99317)
                     /locus_tag="SMa0179"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; similar to glycine cleavage
                     system transcriptional activator, with bacterial LysR
                     regulatory helix-turn-helix protein domain"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435340.1"
                     /db_xref="GI:16262547"
                     /db_xref="GeneID:1235319"
                     /translation="MHRPRLPPLSALRAFEAAARLASFKAAAEELLVTPTAISHQIKQ
                     LEAHMSLRVLDRTPRAVTLTPRGKALYEATAAGFGEIERVVTRLLAETAPTTVTLTST
                     IAFLSHWLVPRMDALRQTIPNIDLRLHASNKVEELRSGGIETAIRYGRGPFAGTASMQ
                     LCSDAMTPVCSPSLGLSQLGDLRRVTLIHIDGRSRPAPKPDWNRWCEQAGITDLDTSA
                     GPRFPDSMLAVQAAIAGQGVVIASRVLVADALATGLLEAPFTQSLAGDAYHFACALGL
                     EQRTDIAALRMWFQNCFSAAEPDPAHRLP"
     misc_feature    complement(98448..99317)
                     /locus_tag="SMa0179"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    complement(99114..99293)
                     /locus_tag="SMa0179"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(98454..99032)
                     /locus_tag="SMa0179"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    complement(order(98928..98948,98952..99005,99009..99032))
                     /locus_tag="SMa0179"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    complement(order(98583..98585,98643..98651,99003..99005,
                     99009..99014))
                     /locus_tag="SMa0179"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            99435..100307
                     /locus_tag="SMa0180"
                     /db_xref="GeneID:1235320"
     CDS             99435..100307
                     /locus_tag="SMa0180"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="NP_435341.1"
                     /db_xref="GI:16262548"
                     /db_xref="GeneID:1235320"
                     /translation="MVELIAGLIDVFADVPLTGNPLAVVQDADGLTDDQMRRIAGEFN
                     QAETTFLMRSTRADWKLRSFTASGAEVFGAGHNALGAWLWLAENGDLGSLTAARTFQQ
                     EIGRDVLPIELESVGGRIHGRMRQVPLRLSDPLDDVAPLADALGLDPRDILPEPPARP
                     ADTGATHLMVRVLNVDSVDRALPVADKLLAVLEKTPAEGCYIYALDADAPDTAYARFF
                     NPSVGLWEDAATGTAAGPLAAYLAATGNLTNNELVIEQGTKMGRRSILRIRLAPLPEL
                     SGAGIVVVKGVIRL"
     misc_feature    99435..100304
                     /locus_tag="SMa0180"
                     /note="Predicted epimerase, PhzC/PhzF homolog [General
                     function prediction only]; Region: COG0384"
                     /db_xref="CDD:223461"
     misc_feature    99456..100238
                     /locus_tag="SMa0180"
                     /note="Diaminopimelate epimerase; Region: DAP_epimerase;
                     cl19724"
                     /db_xref="CDD:268077"
     gene            complement(100505..100708)
                     /gene="cspA7"
                     /locus_tag="SMa0181"
                     /db_xref="GeneID:1235321"
     CDS             complement(100505..100708)
                     /gene="cspA7"
                     /locus_tag="SMa0181"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; start codon changed based on
                     similarity to other proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="CspA5 cold shock protein transcriptional
                     regulator"
                     /protein_id="NP_435342.1"
                     /db_xref="GI:16262549"
                     /db_xref="GeneID:1235321"
                     /translation="MPKGTVKFFNDDKGFGFITPEDGGTDVFVHVSALQHGGSLKEGD
                     KVSYDVGQDRKTGKSKAENVSVL"
     misc_feature    complement(100511..100702)
                     /gene="cspA7"
                     /locus_tag="SMa0181"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(100544..100546,100625..100627,
                     100658..100660,100685..100687))
                     /gene="cspA7"
                     /locus_tag="SMa0181"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(100619..100630,100649..100669))
                     /gene="cspA7"
                     /locus_tag="SMa0181"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            100964..102508
                     /locus_tag="SMa0185"
                     /db_xref="GeneID:1235322"
     CDS             100964..102508
                     /locus_tag="SMa0185"
                     /function="Structural elements; Cell envelope"
                     /codon_start=1
                     /transl_table=11
                     /product="transmembrane-transport protein"
                     /protein_id="NP_435343.1"
                     /db_xref="GI:16262550"
                     /db_xref="GeneID:1235322"
                     /translation="MADNIHTPEQASRREWVGLCVLSIACLIYSMDLSVLFLAVPAIV
                     ADLDPSASQLLWINDIYGFMVAGFLVTMGTLGDRIGRRRVLLMGAFAFGVASAFAAFS
                     NTPGQLILARALLGIAGATIAPSTLSLIVNLFKNEAERNRAISIWGTAFALGGLVGPL
                     IGGILLQYFHWGSVFLINIPVMLLLLAVAPFLLPEYKNNDAGRLDLLSVVLSLATVLP
                     IIYGFKHMAADGFQLAQIVYIGLGLLVGLLFVRRQRRLSDPLVDLALFRVPAFTASLM
                     VNLAGVFFVFGVFLFQNLFLQLVLGLSPLEAALWSAPSALVFAVMSFQAYRFTNRFGP
                     VRTVLGGLLVNAAGAAAMAIAAYAESLIGILGSSMIIGFGFVPVVLTTTGLIVGTAPP
                     ERAGSASAISETSAEFGGALGIAVLGSLATLIYRMAMNRADLSSLNPVQAEAVSATLA
                     GAVETARSMPGSTSAVWLETAKSGFSLGFAICCVVATVTLLLLAIVARRVYATAHIDE
                     STLAPH"
     misc_feature    101003..102451
                     /locus_tag="SMa0185"
                     /note="methyl viologen resistance protein SmvA;
                     Provisional; Region: PRK14995"
                     /db_xref="CDD:184957"
     misc_feature    101024..>101545
                     /locus_tag="SMa0185"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(101060..101062,101069..101077,101081..101086,
                     101135..101137,101144..101149,101156..101158,
                     101168..101173,101177..101182,101318..101323,
                     101330..101335,101342..101347,101354..101356,
                     101393..101398,101405..101410,101426..101428)
                     /locus_tag="SMa0185"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            102649..103602
                     /locus_tag="SMa0187"
                     /db_xref="GeneID:1235323"
     CDS             102649..103602
                     /locus_tag="SMa0187"
                     /note="glimmer prediction; has short chain  domain; SDR
                     superfamily member"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain dehydrogenase"
                     /protein_id="NP_435344.2"
                     /db_xref="GI:193782543"
                     /db_xref="GeneID:1235323"
                     /translation="MKSETGQKQRDIQKQVEGADKKEKPKTSGAMQAGARRYPEPPFP
                     KVHQDKPGSEADLPVAPMYDAPFYKGSDKLKDKVALITGGDSGIGRSVAVLFAREGAD
                     VAIVHLDESQDADDTKAAVEKEGRKCLVIKGDVKDASFCRKAVEKTVMQLGRLDILIN
                     NAAFQVHTRDIEDLTDEHFDETLKTNLYGYFYMAKAAIPHLKNGSAIINTGSVTGLTG
                     SKELLDYSMTKGGIHAFTRALSGHLVPKGIRVNAVAPGPVWTPLNPSDKEAEDVEKFG
                     SQTPMKRAAQPEEIAPAYVFLASPQMSSYITGEILPIVGGY"
     misc_feature    102736..103596
                     /locus_tag="SMa0187"
                     /note="oxidoreductase; Provisional; Region: PRK06128"
                     /db_xref="CDD:180413"
     misc_feature    102742..103599
                     /locus_tag="SMa0187"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06701"
                     /db_xref="CDD:235853"
     misc_feature    order(102895..102897,102901..102906,102910..102912,
                     102967..102975,103129..103137,103276..103284,
                     103321..103323,103333..103335,103411..103422)
                     /locus_tag="SMa0187"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(103204..103206,103282..103284,103321..103323,
                     103333..103335)
                     /locus_tag="SMa0187"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            104028..104471
                     /locus_tag="SMa0189"
                     /db_xref="GeneID:1235324"
     CDS             104028..104471
                     /locus_tag="SMa0189"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435345.1"
                     /db_xref="GI:16262552"
                     /db_xref="GeneID:1235324"
                     /translation="MRTDLVNRPQDGSAGRSALLVASAVNAVAAIYHIIGGTPEVMYP
                     VYSANLPPSSAGVLDILWYQMAALIVGSAVATLVAAFRSDWRWPVAWIIGGHFLVVSG
                     ICLFFTFVWFGNPWGLIQWAIFGPVGLIIFWAAARPAERAGAPTL"
     gene            104560..105189
                     /locus_tag="SMa0190"
                     /db_xref="GeneID:1235325"
     CDS             104560..105189
                     /locus_tag="SMa0190"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; with bacterial regulatory
                     proteins, tetR domain"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator"
                     /protein_id="NP_435346.1"
                     /db_xref="GI:16262553"
                     /db_xref="GeneID:1235325"
                     /translation="MADKQGGPTKADWVAAGLSALTAGGIEAVRVERLAVILGVSKGP
                     FYWRFKNRGELLEAIIEFWKRDFTADLIEQTSHFDTPRERLEALAELAVVSTSGALDV
                     AKTECALRAWAAQDPLPRAAVREVDAMRTKHLTEEFKLLGAPHPLAEQLAKAIYLALL
                     GLYTVRQYTPELADEQSYLTAVRIALDAAQIQSHSTEASAAKSRLEPDI"
     misc_feature    104560..105087
                     /locus_tag="SMa0190"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    104599..104736
                     /locus_tag="SMa0190"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            complement(105799..106329)
                     /locus_tag="SMa0191"
                     /db_xref="GeneID:1235326"
     CDS             complement(105799..106329)
                     /locus_tag="SMa0191"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435347.1"
                     /db_xref="GI:16262554"
                     /db_xref="GeneID:1235326"
                     /translation="MTADKISPDMLRFERILAAPAATVWQYLVDPELRARWFMSGPTD
                     LQVGGAFGLTMDHDRLSDEVVPTPDRYKPYVGHRWHERITRYEPPHLLAFTWEDGKAG
                     EVTFALTEIDSGTTRLVLTHTGLRGSEDALNFGGGWHAHLAVLEKRIAGISIPDFWAL
                     HAVAEREMEIALVSEA"
     misc_feature    complement(105823..106299)
                     /locus_tag="SMa0191"
                     /note="Putative hydrophobic ligand-binding SRPBCC domain
                     of an uncharacterized subgroup of CalC- and Aha1-like
                     proteins; Region: SRPBCC_CalC_Aha1-like_6; cd08899"
                     /db_xref="CDD:176908"
     misc_feature    complement(order(105895..105897,105904..105912,
                     105916..105942,105955..105957,105961..105963,
                     105967..105969,105973..105975,106006..106008,
                     106012..106014,106018..106023,106045..106050,
                     106054..106056,106072..106074,106081..106083,
                     106087..106092,106096..106098,106165..106167,
                     106171..106173,106177..106179,106183..106185,
                     106207..106209,106228..106230,106243..106248,
                     106252..106260,106285..106287,106291..106293,
                     106297..106299))
                     /locus_tag="SMa0191"
                     /note="putative hydrophobic ligand binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:176908"
     gene            complement(106326..106652)
                     /locus_tag="SMa0193"
                     /db_xref="GeneID:1235327"
     CDS             complement(106326..106652)
                     /locus_tag="SMa0193"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435348.2"
                     /db_xref="GI:193782544"
                     /db_xref="GeneID:1235327"
                     /translation="MVDEKLTLTFAALADPTRRGMLAALTSGEKPISELARPYQMTLA
                     GAAKHVAILARAGLIERRKVGRQNICRLNAGNLKEANDWLAQWQRFWNVRLDALEKAL
                     KEELSQ"
     misc_feature    complement(106428..106625)
                     /locus_tag="SMa0193"
                     /note="Arsenical Resistance Operon Repressor and similar
                     prokaryotic, metal regulated homodimeric repressors. ARSR
                     subfamily of helix-turn-helix bacterial transcription
                     regulatory proteins (winged helix topology). Includes
                     several proteins that appear to...; Region: HTH_ARSR;
                     cd00090"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(106482..106484,106572..106574,
                     106581..106586,106593..106598,106605..106607,
                     106614..106616,106620..106625))
                     /locus_tag="SMa0193"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(106443..106451,106464..106472,
                     106488..106493,106497..106502,106509..106514,
                     106518..106529,106554..106562,106599..106607,
                     106617..106622))
                     /locus_tag="SMa0193"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238042"
     misc_feature    complement(order(106551..106553,106560..106562))
                     /locus_tag="SMa0193"
                     /note="putative Zn2+ binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238042"
     gene            complement(106949..107863)
                     /locus_tag="SMa0196"
                     /db_xref="GeneID:1235328"
     CDS             complement(106949..107863)
                     /locus_tag="SMa0196"
                     /EC_number="3.1.1.17"
                     /function="Macromolecule metabolism; Macromolecule
                     degradation; degradation of polysaccharides"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconolactonase"
                     /protein_id="NP_435349.1"
                     /db_xref="GI:16262556"
                     /db_xref="GeneID:1235328"
                     /translation="MAEASIYEIHDPRFRQMIVTSAGLDELYSGCRWAEGPVWFNDAN
                     QLLWSDIPNQRILRWTPEGGVSVYRQPSNFTNGHTRDRRGRLISCEHGTRRVTRTEVD
                     GSITVLADRFEGRRLNSPNDVVVKSDGTIWFTDPTYGIMSDYEGYHADPEQPTRNVYR
                     LDPETGELSAVVTDFTQPNGLAFSPDEKILYVADSSASHDDRLPRHIRAFDLTDGGRL
                     ANGRVFCVIDKGIPDGIRTDANGNLWSSAGDGVHCFDTAGKLIGKIRVPQTVANLTFG
                     GPRRNRLFIAATRSLYSVYVAVTGSQVP"
     misc_feature    complement(106952..107842)
                     /locus_tag="SMa0196"
                     /note="Gluconolactonase [Carbohydrate transport and
                     metabolism]; Region: COG3386"
                     /db_xref="CDD:225921"
     misc_feature    complement(107246..>107395)
                     /locus_tag="SMa0196"
                     /note="Strictosidine synthase; Region: Str_synth; cl19733"
                     /db_xref="CDD:268086"
     gene            complement(107878..108825)
                     /locus_tag="SMa0197"
                     /db_xref="GeneID:1235329"
     CDS             complement(107878..108825)
                     /locus_tag="SMa0197"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; partially similar to ABC
                     transporter integral membrane protein and E. coli ribose
                     transport protein rbsC"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435350.2"
                     /db_xref="GI:193782545"
                     /db_xref="GeneID:1235329"
                     /translation="MNALIRQFGKPWVWSWLAAFIVWFLTIMVTGGAGTLGLSQAALT
                     FAAFSVIVGIGQMFVITLGPGNIDLSVPATMTLAGTVALKLMNVENGMVLPGLLLAVF
                     IGLGVGLCNYTLIKALRIPPIIATLSMSFVVQSGAIWTNRGLRIKPPSVLAEFTTTNT
                     LGVPNVAIVAVLISVLAWILLEKTIYGRWISAIGQSMPAARMAGIPVDGTRFVTYLFC
                     AVLASISGYLLACFSGGAALNMGAEYLLMSIAVVVIGGTAVAGGDSNVPGIWGASLFM
                     FLVVSMLNTYGLGAGIRLIMTGLIIISVIMLAGGRRGMR"
     misc_feature    complement(107905..108690)
                     /locus_tag="SMa0197"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(108178..108234)
                     /locus_tag="SMa0197"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(108822..109769)
                     /locus_tag="SMa0198"
                     /db_xref="GeneID:1235330"
     CDS             complement(108822..109769)
                     /locus_tag="SMa0198"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; partially similar to ribose ABC
                     transporter permease"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435351.1"
                     /db_xref="GI:16262558"
                     /db_xref="GeneID:1235330"
                     /translation="MTFRLSSDAIRLVIPALSLSLLLAAVFWLQPRAMSYIGLNLLFN
                     LAVPIALATIAQMLVMAVNDLDLSMGAFVSFVACVTATFLRDAPAIGILILAGAVAAY
                     AAIGVVIHLRNLPSIVVTLGMSFVWGGLAVLLLPAPGGQAPDWVRWLMTVKPPLAPMA
                     IVASIIIAVIAHFIVKRSSLGVLIRGVGGNQRSVERAGWSIVAARATAYALAGLFAVL
                     AGIALVGLTTSADANIALRYTLLSIAGVILGGGEFTGGRVSPIGAVIGALTLTLASSF
                     LSFLRISPDWQIGAQGAILIIVLALRLMLNRLERREKRR"
     misc_feature    complement(108867..109634)
                     /locus_tag="SMa0198"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(109140..109196)
                     /locus_tag="SMa0198"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(109766..111229)
                     /locus_tag="SMa0199"
                     /db_xref="GeneID:1235331"
     CDS             complement(109766..111229)
                     /locus_tag="SMa0199"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435352.1"
                     /db_xref="GI:16262559"
                     /db_xref="GeneID:1235331"
                     /translation="MMASSMDDVAKAIIAVDGAKVSFGAVKALDGVTLRVMPGECVGL
                     VGHNGAGKSTIVSVINGGLTPHHGIVTSDGERQERYGINAARDRGVRCVFQELSLCPN
                     LSIVENTRLVHRTLGGFGWRLRAAKIIEKSLDAVFPGHGIDSGRTVGDLSIAERQMVE
                     IALAFSDAGTPARLVILDEPTSSLDASLARQMLDHVRRFIAAGGSVIFISHILHEILE
                     TADRIVVMKDGRVVAERPAHRFDHHGLVEAMGSVAKAETRQRPVCDQPAAPVILSHEA
                     AGIPFTARTGEIIGLAGLAGHGQTELLLALHAARSGNWLPQGNPLVTFVAGDRRLNGV
                     FELWSILRNFSIASLGDMSRRGLVLEAGEKTRGTAWKERIEIRTPDLNNRILSLSGGN
                     QQKVLFARALATRAPIVLMDDPMRGVDVGTKQEVYAIIREEAAAGRTFIWYSTEMDEV
                     CLCDRVYVFREGRITAELGGDAVDEANIISASFEGTA"
     misc_feature    complement(109775..111214)
                     /locus_tag="SMa0199"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    complement(110528..111190)
                     /locus_tag="SMa0199"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(111071..111094)
                     /locus_tag="SMa0199"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(110597..110599,110693..110698,
                     110945..110947,111068..111076,111080..111085))
                     /locus_tag="SMa0199"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(110945..110956)
                     /locus_tag="SMa0199"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(110750..110779)
                     /locus_tag="SMa0199"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(110693..110710)
                     /locus_tag="SMa0199"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(110675..110686)
                     /locus_tag="SMa0199"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(110591..110611)
                     /locus_tag="SMa0199"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(109838..110398)
                     /locus_tag="SMa0199"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            complement(111288..112304)
                     /locus_tag="SMa0203"
                     /db_xref="GeneID:1235332"
     CDS             complement(111288..112304)
                     /locus_tag="SMa0203"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; partial homology to ABC
                     transporter"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435353.2"
                     /db_xref="GI:193782546"
                     /db_xref="GeneID:1235332"
                     /translation="MTIRKMLLASAAITCAAMPASAFADTSAKKIALSNNYAGNSWRQ
                     AMLTSWEKVTGEAVKAGIVASADAFTTAENQATEQAAQIQNMILQGYDAIVLNAASPT
                     ALNGAVKEACDAGITVVSFDGIVTEPCAWRIAVDFKEMGRSQVEYLSNKLPDGGNLLE
                     IRGLAGVFVDDEISAGIHEGVKQFPQFKIAGSVHGDWAQDVAQKAVAGILPSLPDIVG
                     VVTQGGDGYGAAQAIAATDRKMPIIVMGNREDELKWWKEQKDANGYETMSVSIAPGVS
                     TLAFWVAQQILDGKEVKKDLVVPFLRIDQDNLEANLANTQAGGVANVEYTQEDAIKVI
                     ESAK"
     misc_feature    complement(111351..112304)
                     /locus_tag="SMa0203"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    complement(111396..112217)
                     /locus_tag="SMa0203"
                     /note="Periplasmic sugar-binding component of
                     uncharacterized ABC-type transport systems that are
                     members of the pentose/hexose sugar-binding protein family
                     of the type I periplasmic binding protein superfamily;
                     Region: PBP1_ABC_sugar_binding_like_1; cd06300"
                     /db_xref="CDD:107295"
     misc_feature    complement(order(111495..111497,111564..111566,
                     111786..111788,111939..111941,112179..112181))
                     /locus_tag="SMa0203"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107295"
     gene            112578..113825
                     /locus_tag="SMa0204"
                     /db_xref="GeneID:1235333"
     CDS             112578..113825
                     /locus_tag="SMa0204"
                     /function="Miscellaneous; Not classified regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="sensor histidine kinase"
                     /protein_id="NP_435354.1"
                     /db_xref="GI:16262561"
                     /db_xref="GeneID:1235333"
                     /translation="MLHSAPAAMFDHYLGISRLLAGQLDFRSAIRSVAAEVAHIIPHD
                     HLDVCVLLEDGNYHTAYETGIETAWGDLAGAPVVNSPIRSLLWGEVDFLLADDAMTDP
                     RFHFDGAFKRPIVEQSLRSRLHVPMKVQGAIIAALSCSSQEAGAYTMEDVERARIIAD
                     LLTPYFFALRAAEQAQRSAIVEAEARAREEGLRLGALKLTEALEQERQRIGMDLHDQT
                     LADLTRLARRIDRLSRNGEVAPEALEPVSRSLQHCMQDLRQIIEQAKPSVLQLFGLTQ
                     AIEHHLDRSTRDTGSIIEWGLADETNGALERLEPTVIVALFRIAQEAINNAVRHAAPL
                     AVKVRLDADDDRLSIEISDDGTGLAKTRGRIGEGIDNMKTRARLISARFTIGPGHNNR
                     GTVVRVVLPLAPHDSGSIEERAE"
     misc_feature    112623..113114
                     /locus_tag="SMa0204"
                     /note="FOG: GAF domain [Signal transduction mechanisms];
                     Region: FhlA; COG2203"
                     /db_xref="CDD:225113"
     misc_feature    112803..113783
                     /locus_tag="SMa0204"
                     /note="Signal transduction histidine kinase [Signal
                     transduction mechanisms]; Region: COG4585"
                     /db_xref="CDD:226951"
     misc_feature    113193..113384
                     /locus_tag="SMa0204"
                     /note="Histidine kinase; Region: HisKA_3; pfam07730"
                     /db_xref="CDD:254390"
     misc_feature    113523..113777
                     /locus_tag="SMa0204"
                     /note="Histidine kinase-like ATPases; This family includes
                     several ATP-binding proteins for example: histidine
                     kinase, DNA gyrase B, topoisomerases, heat shock protein
                     HSP90, phytochrome-like ATPases and DNA mismatch repair
                     proteins; Region: HATPase_c; cd00075"
                     /db_xref="CDD:238030"
     misc_feature    order(113541..113543,113553..113555,113562..113564,
                     113628..113630,113634..113636,113640..113642,
                     113646..113651,113673..113684,113730..113732,
                     113736..113738,113754..113759,113763..113765)
                     /locus_tag="SMa0204"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    113553..113555
                     /locus_tag="SMa0204"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238030"
     misc_feature    order(113640..113642,113646..113648,113673..113675,
                     113679..113681)
                     /locus_tag="SMa0204"
                     /note="G-X-G motif; other site"
                     /db_xref="CDD:238030"
     gene            113822..114544
                     /locus_tag="SMa0206"
                     /db_xref="GeneID:1235334"
     CDS             113822..114544
                     /locus_tag="SMa0206"
                     /function="Miscellaneous; Not classified regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="Response regulator"
                     /protein_id="NP_435355.1"
                     /db_xref="GI:16262562"
                     /db_xref="GeneID:1235334"
                     /translation="MKVLIVEDDPLHRSYLHEAVNAALPECDTVIEAENGTVGEKLAR
                     EHKSAHIVMDLQMASRNGIEAARTIWKERPETRILFWSNYSDEAYVRGVSRIVPDGAA
                     YGYVLKSASDERLKLALRSIFIESQCVIDREVRGLQQKSLGQTNGFNDSEYEILVDIA
                     LGLTDRAIARRRGLSLRSVQNRLQQLYDKLDVYQAASDDNDDGRFNLRARAITIAFLR
                     KLLNYSALERAEAELQEWLDGK"
     misc_feature    113822..114490
                     /locus_tag="SMa0206"
                     /note="Response regulator containing a CheY-like receiver
                     domain and an HTH DNA-binding domain [Signal transduction
                     mechanisms / Transcription]; Region: CitB; COG2197"
                     /db_xref="CDD:225107"
     misc_feature    113831..114190
                     /locus_tag="SMa0206"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    order(113840..113845,113981..113983,114005..114007,
                     114065..114067,114134..114136,114143..114148)
                     /locus_tag="SMa0206"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    113981..113983
                     /locus_tag="SMa0206"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    order(113990..113995,113999..114007)
                     /locus_tag="SMa0206"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    114143..114151
                     /locus_tag="SMa0206"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    114275..114397
                     /locus_tag="SMa0206"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cl17315"
                     /db_xref="CDD:266624"
     misc_feature    order(114311..114319,114341..114346,114350..114355,
                     114359..114373)
                     /locus_tag="SMa0206"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:99777"
     gene            114669..115757
                     /locus_tag="SMa0209"
                     /db_xref="GeneID:1235335"
     CDS             114669..115757
                     /locus_tag="SMa0209"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435356.1"
                     /db_xref="GI:16262563"
                     /db_xref="GeneID:1235335"
                     /translation="MLKSIDLMYQAMLAELRQRSLDAAWSADFPSDGRFTPLTVKQRR
                     YWYFDRPDGKGGRTRDYVGPASDPEIAKRVEEFKAQKDDLQARRRMVSTLTREGGMVA
                     PDRMSGDVIEALASGGLFRLRGILIGTIAFHTYAGVLSVRLPGHSIMTGDADVAQDFA
                     VSREVGDSMPPILQLLQSVDPTFRPVPHRSGQAAFSSFQNKNSYKVEFLTNRSSDDYM
                     DQPARMPALGGASADPLRFLDFLIRDPVRTVVLHKSGIPVTVPDPSRYAVHNLIVASR
                     RHNDGQSAVKRDKDIRQAGILFEAILQTRRSSDLALVYNEAWQRGDAWRAGIRAGAAM
                     LPDEGRKHLKACLRTGAVEIDEDVSLPF"
     misc_feature    114669..115712
                     /locus_tag="SMa0209"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5397"
                     /db_xref="CDD:227684"
     gene            complement(115852..116118)
                     /locus_tag="SMa0210"
                     /db_xref="GeneID:1235336"
     CDS             complement(115852..116118)
                     /locus_tag="SMa0210"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435357.2"
                     /db_xref="GI:193782547"
                     /db_xref="GeneID:1235336"
                     /translation="MDVQKAGMARLLLAAPDVRDSAWMIHDLTFLKLCEVYEHACLRR
                     DVLRCAASIDDAALLKSEEECKSLEAAAIAYIRERQKFSGLGSH"
     gene            complement(116261..116455)
                     /locus_tag="SMa0211"
                     /db_xref="GeneID:1235337"
     CDS             complement(116261..116455)
                     /locus_tag="SMa0211"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435358.1"
                     /db_xref="GI:16262565"
                     /db_xref="GeneID:1235337"
                     /translation="MLGDWDMDDRDTNHNGEKNSASDLLEIAAQLAALAEDIKTLAAM
                     PIEQISTLIEPGDRPEASSE"
     gene            complement(116673..117515)
                     /gene="kduI"
                     /locus_tag="SMa0214"
                     /db_xref="GeneID:1235338"
     CDS             complement(116673..117515)
                     /gene="kduI"
                     /locus_tag="SMa0214"
                     /note="4-deoxy-L-threo-5-hexosulose-uronate
                     ketol-isomerase; catalyzes the interconversion of
                     4-deoxy-L-threo-5-hexosulose uronate to
                     3-deoxy-D-glycero-2,5-hexodiulosonate"
                     /codon_start=1
                     /transl_table=11
                     /product="5-keto-4-deoxyuronate isomerase"
                     /protein_id="NP_435359.2"
                     /db_xref="GI:193782548"
                     /db_xref="GeneID:1235338"
                     /translation="MTISVSVRQVVGPEDAARRNTQGLRDGFVIEALFQPGRANLTYS
                     HLDRMIVGGVVPAADRLVIDRVAETGTQRFLDRREAAIINIGGSGTVSVGDKDHVLGF
                     QEALYVGMGGGALGFASDDANAPALFYVLSAPAHRSCPTVHITRDMAKKLSLGSAEES
                     NARTINQYVHPDVCESCQLLVGLTMFEPGSVWNTMPAHVHDRRMEVYLYFGMQEATRI
                     FHFMGEPGETRHVVLKNHEAVLSPGWSIHSGAGTGRYAFIWAMAGDNMSFTDMDKVPM
                     EALR"
     misc_feature    complement(116676..117503)
                     /gene="kduI"
                     /locus_tag="SMa0214"
                     /note="5-keto 4-deoxyuronate isomerase [Carbohydrate
                     transport and metabolism]; Region: KduI; COG3717"
                     /db_xref="CDD:226240"
     gene            complement(117547..118287)
                     /locus_tag="SMa0216"
                     /db_xref="GeneID:1235339"
     CDS             complement(117547..118287)
                     /locus_tag="SMa0216"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; similar to ABC sugar transport
                     ATP binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435360.1"
                     /db_xref="GI:16262567"
                     /db_xref="GeneID:1235339"
                     /translation="MMSTPNLLELHNISKSFGALTALRNLSFHIGEGEVVGLLGDNGA
                     GKSTTVNLISGIHKPTDGYLSVDGKKTTFSCRSDSADAGIETIYQHTALVDSLSITRN
                     IFMGRELTDRFGFLRQREMRDIAMEVLQNAVHISGIDSPDTLVGNLSGGQKQAVAIAR
                     AVYFKKRVLLLDEPTSALSVRETEALLNQVLKLKAENVSSVLVTHNLYHAYQVCDRFV
                     IMSHGTKVFDVQKADTTISQLTEYVVLT"
     misc_feature    complement(117604..118278)
                     /locus_tag="SMa0216"
                     /note="ABC-type branched-chain amino acid transport
                     systems, ATPase component [Amino acid transport and
                     metabolism]; Region: LivG; COG0411"
                     /db_xref="CDD:223488"
     misc_feature    complement(117610..118266)
                     /locus_tag="SMa0216"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    complement(118147..118170)
                     /locus_tag="SMa0216"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(order(117673..117675,117769..117774,
                     118021..118023,118144..118152,118156..118161))
                     /locus_tag="SMa0216"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(118021..118032)
                     /locus_tag="SMa0216"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(117817..117846)
                     /locus_tag="SMa0216"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(117769..117786)
                     /locus_tag="SMa0216"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(117751..117762)
                     /locus_tag="SMa0216"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    complement(117667..117687)
                     /locus_tag="SMa0216"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     gene            complement(118284..119363)
                     /locus_tag="SMa0217"
                     /db_xref="GeneID:1235340"
     CDS             complement(118284..119363)
                     /locus_tag="SMa0217"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; start codon changed based on
                     homology and codon usage."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435361.2"
                     /db_xref="GI:193782549"
                     /db_xref="GeneID:1235340"
                     /translation="MGARRRARPVPRSPTIECQTVTPVLAESAAPRSRTQRQSILKQI
                     MGMPAGAIFLVFMTLQIVCIAGALLYPDEFRYLSPQNLTILMKAIPVLGCLALGAGVL
                     MIAGEFDLSIGSVYTFTAVLMASLVNAGLSAFIAAPIAILTGLLIGSLNGHITLRFGL
                     PSFIVTLGGLLFWRGAVLLYNGAVQVRFDPEPVFTSLFSGTLFGVNAAFIWIVLFVTG
                     FHLLLHRHRFGNHVFATGGNRGAAEAIGINTSRVKLIAFAIAGGMAAVAGILATARVG
                     SVQPGQGAGLELQAIAACVIGGLSLRGGRGSIIGIFLGVLLIHTITDVLLLLRAPGFY
                     LDMFIATLIVLAAIFNHLIERRGLA"
     misc_feature    complement(118314..119099)
                     /locus_tag="SMa0217"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    complement(118590..118646)
                     /locus_tag="SMa0217"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            complement(119373..120323)
                     /locus_tag="SMa0218"
                     /db_xref="GeneID:1235341"
     CDS             complement(119373..120323)
                     /locus_tag="SMa0218"
                     /function="Cell processes; Transport of small molecules;
                     carbohydrates, organic acids, alcohols"
                     /note="glimmer prediction; start codon changed based on
                     homology and codon usage pattern"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435362.2"
                     /db_xref="GI:193782550"
                     /db_xref="GeneID:1235341"
                     /translation="MKLTRLRTAALAAGLATLLTSTALAADVKATMIIYLDPSVQFFN
                     PVVKGAQDAAAQFGVDLDVQYANNDPVRQNDLIESATASGVDGIAVAISSSDAFDESI
                     CAAVKAGIIVIGFNNDDLDGAKGNCRQAYVGMDELASGYELGNRMIKEFGLKSGDVVF
                     NPREIPEASFAVARGGGIEKAMTENGIKVETVRAGLDPAEAQNIIAQFLIANPNVKAL
                     FGTGSVTSTVGAGAIKDAGVDIPFGGFDLAVEIVNAVESGAMYATMDQQPYLQGYYPI
                     AQIALAKKYGLTPTDIDTGQGAFLDKTRIGSVKPLIGSYR"
     misc_feature    complement(119433..120230)
                     /locus_tag="SMa0218"
                     /note="Type 1 periplasmic binding fold superfamily;
                     Region: Periplasmic_Binding_Protein_Type_1; cl10011"
                     /db_xref="CDD:263940"
     misc_feature    complement(119484..120203)
                     /locus_tag="SMa0218"
                     /note="Periplasmic binding protein domain; Region:
                     Peripla_BP_4; pfam13407"
                     /db_xref="CDD:257732"
     gene            complement(120444..121958)
                     /locus_tag="SMa0220"
                     /db_xref="GeneID:1235342"
     CDS             complement(120444..121958)
                     /locus_tag="SMa0220"
                     /function="Small molecule metabolism; Energy metabolism,
                     carbon"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD-dependent aldehyde dehydrogenase"
                     /protein_id="NP_435363.1"
                     /db_xref="GI:16262570"
                     /db_xref="GeneID:1235342"
                     /translation="MLSNFIAPDSNDPRLRIKSRYQMLVDGKSVDAASGSTIDRVSPG
                     HAGEVVGTWPEASADDVRKAVAAARKAFDAGPWPRMSGAERSRLMFKVADLILARQEE
                     LALIESLEVGKPIAQARGEIGFCADLWSYAAGQARALEGQTHNNIGDDRLGLVLREPV
                     GVVGIITPWNFPFIIASERVPWAIGSGCTVVLKPSEFTSGTSIRLAELAREAGIPDGV
                     FNVVTGYGDPAGQVLAEDPNVDMVAFTGSVRVGTKLGEIAARTVKRVGLELGGKGPQI
                     VFADADLDAAADGIAYGVYHNAGQCCISGSRLLVQEGIRDALMERLLDISRKVAFGDP
                     LNERTKIGAMISEAHAEKVHSYVTAGITSGAELLLGGERIGREAGLYYAPTVFAGVTP
                     DMSIAREEIFGPVLSTLTFKTADEAVALANATEFGLSASVWSTNLETALQTIRRIRAG
                     RCWINSVIDGTPELPIGGYKKSGLGRELGRYGFDEYSQFKGVHVTLGRPAPWFT"
     misc_feature    complement(120477..121841)
                     /locus_tag="SMa0220"
                     /note="Gluconobacter oxydans L-sorbosone
                     dehydrogenase-like; Region: ALDH_SNDH; cd07118"
                     /db_xref="CDD:143436"
     misc_feature    complement(order(120561..120563,120675..120677,
                     120753..120755,120759..120761,121053..121055,
                     121149..121157,121197..121202,121209..121211,
                     121218..121229,121371..121376,121380..121382,
                     121425..121427,121449..121463))
                     /locus_tag="SMa0220"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143436"
     misc_feature    complement(order(121053..121055,121062..121064,
                     121155..121157,121449..121451))
                     /locus_tag="SMa0220"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143436"
     gene            122050..122778
                     /locus_tag="SMa0222"
                     /db_xref="GeneID:1235343"
     CDS             122050..122778
                     /locus_tag="SMa0222"
                     /function="Miscellaneous; Not classified regulator"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435364.1"
                     /db_xref="GI:16262571"
                     /db_xref="GeneID:1235343"
                     /translation="MVVQIGCQRMTAAKDMNLESLKIDTGETAAAQVERDLRESIIRL
                     ELAPGMRLSEQEIATRMGVSRQPVREALIALGKSKLVDIRPNRGTVVVRISARQMMEA
                     RFVREAIEVAVARRASETFDSWTRRKIDTILARQKAANEAHDHNAFRREDEQFHIAIA
                     EGAGCGLAWNAVSDIKAHMDRVCNLQLRHPDSMKKLIAEHEAIITAIDARDADAAAAA
                     MRSHLNGILADLPQIEADNPDLFE"
     misc_feature    122086..122775
                     /locus_tag="SMa0222"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    122131..122322
                     /locus_tag="SMa0222"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(122131..122133,122137..122139,122209..122214,
                     122236..122250,122254..122259,122266..122268,
                     122296..122301,122305..122316)
                     /locus_tag="SMa0222"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    122362..122724
                     /locus_tag="SMa0222"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            complement(122852..123637)
                     /locus_tag="SMa0223"
                     /db_xref="GeneID:1235344"
     CDS             complement(122852..123637)
                     /locus_tag="SMa0223"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; with tetR domain"
                     /codon_start=1
                     /transl_table=11
                     /product="TetR family transcriptional regulator"
                     /protein_id="NP_435365.2"
                     /db_xref="GI:193782551"
                     /db_xref="GeneID:1235344"
                     /translation="MRCDRRCGGVKYRSWAQILCERHAKACRFGRRREAGGWLRLKAS
                     SYILQVSYFWYIVMSSRPNKTQPPAKRVRLSREQRRRQLLDLAWHLVREEGSDALTLP
                     RLSQEAAVAKPVVYDHFGTRNGLLIALYRDFDARQTEMIDAALAGSGPTLEDRARVIA
                     TSYVDCVLAQGREMPGVLAALAGSPELEAVKRDYQLAFIEKCRRALAAFVGRRGIEPA
                     GFWAMLGAANALSDAASTGEITAEQAQDELFETIVAMIERSHP"
     misc_feature    complement(122864..123439)
                     /locus_tag="SMa0223"
                     /note="Transcriptional regulator [Transcription]; Region:
                     AcrR; COG1309"
                     /db_xref="CDD:224228"
     misc_feature    complement(123251..123391)
                     /locus_tag="SMa0223"
                     /note="Bacterial regulatory proteins, tetR family; Region:
                     TetR_N; pfam00440"
                     /db_xref="CDD:249860"
     gene            123589..125061
                     /locus_tag="SMa0224"
                     /db_xref="GeneID:1235345"
     CDS             123589..125061
                     /locus_tag="SMa0224"
                     /function="Structural elements; Cell envelope"
                     /codon_start=1
                     /transl_table=11
                     /product="Permease, MFS"
                     /protein_id="NP_435366.2"
                     /db_xref="GI:193782552"
                     /db_xref="GeneID:1235345"
                     /translation="MPMTDTSLPRTVDRTAWLGLIAILPLVLLVAMDGSILYLAMPHV
                     TSALMPTADQALWILDIYGFVVGSLLIAFGNIGDRYGRLKLIITGAAVFGAGSLGAAY
                     SQTPEQLIASRALMGLGGATLLPSGLAIVSALFPDPRLRAQAIGIFAATFAAGFAIGP
                     LIGGMLLRQFAWGAVFLINVPVVIGFMIGAPILLREVRSTVGGSIDLASLVLSFAGIL
                     LFTYSLKNAAAYGFTPTQIVAGAAGIFALALFARRQTKLEYPLLDLGLFRDRIFSIAI
                     LTGLLSLVVWSAAGYLSGVYLQSVLGIDVFAAALLTLPGAIVLTATCVATARIVERIG
                     RKTALVATHLLIGAGVFLLLFTTTETGIAVFIASTMIAGIGYGLSFSLVADIAVSAVP
                     ANRAGAAGSIAETSNELGNALGISLLGSLATLSFRLFGPGVAGTLDETLDQPGLAHQS
                     LIQAQEAFLTGMHVAIGTGGLLTLAVGMVAWLWLPSKLPE"
     misc_feature    123637..125049
                     /locus_tag="SMa0224"
                     /note="methyl viologen resistance protein SmvA;
                     Provisional; Region: PRK14995"
                     /db_xref="CDD:184957"
     misc_feature    123646..124857
                     /locus_tag="SMa0224"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(123688..123690,123697..123705,123709..123714,
                     123763..123765,123772..123777,123784..123786,
                     123796..123801,123805..123810,123946..123951,
                     123958..123963,123970..123975,123982..123984,
                     124021..124026,124033..124038,124054..124056,
                     124435..124437,124444..124449,124456..124461,
                     124468..124470,124510..124512,124522..124524,
                     124534..124536,124543..124545,124555..124557,
                     124705..124707,124714..124719,124726..124728,
                     124738..124743,124750..124752,124783..124788,
                     124795..124800,124807..124812,124819..124821)
                     /locus_tag="SMa0224"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     gene            125261..126253
                     /locus_tag="SMa0226"
                     /db_xref="GeneID:1235346"
     CDS             125261..126253
                     /locus_tag="SMa0226"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="NP_435367.2"
                     /db_xref="GI:193782553"
                     /db_xref="GeneID:1235346"
                     /translation="MSVSFPRAGFLALVMVVALAFGVPFDAARGELLARVPAAREMAV
                     CGDTLFVGTKGSSVYAVSLPGGRARRVASGFSNANGVACSRGRLFVASRSSITAFEIG
                     RGGTLSGRRDIRRDLPNSGAHSFRYIALGPDARLYVSLGSPCNICVPGGLQGTIVSMN
                     QDGSDLRRVAWGVRNSVGFDWRGGRMFFTDNGADRMGDDVPPDELNALRPGGFYGFPY
                     FGGQVPLTGFEDAMPPARQIPPVFNFQAHVAALGIHFFRSLGGDALVAQHGSWNRSVP
                     VGYQVVRVRFRGGRPVSAATFLRNVGRPVDVKEAPDGAILVSDDAGGAIHIFRR"
     misc_feature    125261..126247
                     /locus_tag="SMa0226"
                     /note="Glucose/sorbosone dehydrogenases [Carbohydrate
                     transport and metabolism]; Region: COG2133"
                     /db_xref="CDD:225044"
     misc_feature    <125612..126217
                     /locus_tag="SMa0226"
                     /note="dehydrogenase, PQQ-dependent, s-GDH family; Region:
                     non_repeat_PQQ; cl19645"
                     /db_xref="CDD:267998"
     gene            126420..127766
                     /gene="gdhA"
                     /locus_tag="SMa0228"
                     /db_xref="GeneID:1235347"
     CDS             126420..127766
                     /gene="gdhA"
                     /locus_tag="SMa0228"
                     /EC_number="1.4.1.4"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; amino acids"
                     /note="converts 2-oxoglutarate to glutamate; in
                     Escherichia coli this enzyme plays a role in glutamate
                     synthesis when the cell is under energy restriction; uses
                     NADPH; forms a homohexamer"
                     /codon_start=1
                     /transl_table=11
                     /product="glutamate dehydrogenase"
                     /protein_id="NP_435368.1"
                     /db_xref="GI:16262575"
                     /db_xref="GeneID:1235347"
                     /translation="MNVDEKLEPILAEVLRRNGGEHEFHQAVREVLESLGRVIAKHPR
                     YAENALIERICEPERQIIFRVPWVDDKGQVQINRGFRVQFNSALGPYKGGIRFHPSVN
                     IGIIKFLGFEQTFKNALTGMPIGGGKGGSDFNPRGRSDGEIMRFCQSLMTELHRHLGE
                     YTDVPAGDIGVGGREIGYMFGQYKRLTNRYEAGVLTGKALFYGGSRARKEATGYGATY
                     FVQRMIATKGLDFEGKRVTVSGSGNVAIYTMEKVIEFGGKIVACSDSNGYVVDEDGID
                     LELVKEIKEVRRERISEYARLKGAGTHYIEAGSVWDVPCDVAMPSATQNELTGKDART
                     LVKNGVLAVGEGANMPCTPEAVRIFQEAGVLFAPGKAANAGGVATSALEMQQNASRDS
                     WTFEQTEARLATIMQAIHDRCAETAEEYGTPGDYVLGANIAGFVRVAEAMDALGVI"
     misc_feature    126420..127763
                     /gene="gdhA"
                     /locus_tag="SMa0228"
                     /note="glutamate dehydrogenase; Provisional; Region:
                     PRK09414"
                     /db_xref="CDD:181834"
     misc_feature    126588..126980
                     /gene="gdhA"
                     /locus_tag="SMa0228"
                     /note="Glu/Leu/Phe/Val dehydrogenase, dimerization domain;
                     Region: ELFV_dehydrog_N; pfam02812"
                     /db_xref="CDD:251546"
     misc_feature    127005..127760
                     /gene="gdhA"
                     /locus_tag="SMa0228"
                     /note="NAD(P) binding domain of glutamate dehydrogenase,
                     subgroup 2; Region: NAD_bind_2_Glu_DH; cd05313"
                     /db_xref="CDD:133455"
     misc_feature    order(127143..127151,127209..127214,127383..127388,
                     127455..127463)
                     /gene="gdhA"
                     /locus_tag="SMa0228"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:133455"
     gene            128085..128507
                     /locus_tag="SMa0229"
                     /db_xref="GeneID:1235348"
     CDS             128085..128507
                     /locus_tag="SMa0229"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435369.1"
                     /db_xref="GI:16262576"
                     /db_xref="GeneID:1235348"
                     /translation="MSSIMVSSNLPLPFIGATDYRLLSRLAYQALSRDFDIAAELIEK
                     LERPCVLPDDQVPPDVVKIGSIVTCEVEDGPCRTFSLVYPDDVDAEKGRISVLTPVGV
                     ALLGLRPGQAVEWFSRDGQRNHLIVVRVEDDVKDELAL"
     misc_feature    128100..>128303
                     /locus_tag="SMa0229"
                     /note="ParB family; Region: ParB; pfam08775"
                     /db_xref="CDD:149741"
     misc_feature    128103..128477
                     /locus_tag="SMa0229"
                     /note="nucleoside diphosphate kinase regulator;
                     Provisional; Region: PRK05753"
                     /db_xref="CDD:180236"
     misc_feature    128253..128477
                     /locus_tag="SMa0229"
                     /note="Transcription elongation factor, GreA/GreB, C-term;
                     Region: GreA_GreB; pfam01272"
                     /db_xref="CDD:250494"
     gene            128727..129278
                     /locus_tag="SMa0232"
                     /db_xref="GeneID:1235349"
     CDS             128727..129278
                     /locus_tag="SMa0232"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435370.2"
                     /db_xref="GI:193782554"
                     /db_xref="GeneID:1235349"
                     /translation="MTRRKLERCAMSREAFCQLTAGDLNILMSMLDETGHTESFTILL
                     REKLNYASVFFREDIPENVVTLDTQVGYTVNGVRTGPHLLVRNAAGRPANSAISVRTM
                     RGLALLGLAVGERTEILGEDGWPETLAVERIVFQPESEARLKQTSTEPVQLIDHAPQV
                     VNFRPRPRKAAIPHDDDPGPSAA"
     misc_feature    128727..129134
                     /locus_tag="SMa0232"
                     /note="Uncharacterized conserved protein, YhbC family
                     [Function unknown]; Region: COG0782"
                     /db_xref="CDD:223853"
     gene            complement(129300..130691)
                     /gene="otsA"
                     /locus_tag="SMa0233"
                     /db_xref="GeneID:1235350"
     CDS             complement(129300..130691)
                     /gene="otsA"
                     /locus_tag="SMa0233"
                     /EC_number="2.4.1.15"
                     /note="glimmer prediction; Very similar to
                     trehalose-6-phosphate synthase (OtsA) of Rhizobium sp.
                     NGR234 sym plasmid. S. meliloti appears to lack OtsB"
                     /codon_start=1
                     /transl_table=11
                     /product="OtsA trehalose-6-phosphate synthase"
                     /protein_id="NP_435371.1"
                     /db_xref="GI:16262578"
                     /db_xref="GeneID:1235350"
                     /translation="MSRLVIVSNRVPVPDKGGIAPAGGLAVALKVALEEHGGIWMGWS
                     GRSSGENEPEPLAQLHQGNITYALTDLTDTDVGEYYHGFANRVLWPICHYRLDLAEYG
                     RKEMAGYFRVNRFFAHRLAPLVRPDDVIWVHDYHLIPLAAELRQMGLKNRIGFFLHIP
                     WPPADVLFTMPVHEEIMRGLSHYDVVGFQTDHDLENFAGCLRREGIGDELGGGRFSAY
                     GRVFKGGIYAIGIETAAFAEFAKKALTNKTVRKARESIEHRSLIIGVDRLDYSKGITQ
                     RIDAFERFILANPAQQGRVTYLQITPKSRSEVPEYEAMQRTVAEQAGRVNGALGAVDW
                     VPIRYINRSVGRHILAGLYRLGKVGLVTPLRDGMNLVAKEYVAAQDPDDPGVLVLSRF
                     AGAARDLKGALLVNPYDIEGTANAMARALSMPLEERKDRWKTMMDHLLEHDVSRWCRD
                     FLNDLATSPDPSG"
     misc_feature    complement(129324..130685)
                     /gene="otsA"
                     /locus_tag="SMa0233"
                     /note="Trehalose-6-Phosphate Synthase (TPS) is a
                     glycosyltransferase that catalyses the synthesis of
                     alpha,alpha-1,1-trehalose-6-phosphate from
                     glucose-6-phosphate using a UDP-glucose donor. It is a key
                     enzyme in the trehalose synthesis pathway. Trehalose is
                     a...; Region: GT1_TPS; cd03788"
                     /db_xref="CDD:99963"
     misc_feature    complement(129324..130685)
                     /gene="otsA"
                     /locus_tag="SMa0233"
                     /note="alpha,alpha-trehalose-phosphate synthase
                     [UDP-forming]; Region: trehalose_OtsA; TIGR02400"
                     /db_xref="CDD:233848"
     misc_feature    complement(order(129570..129572,129579..129584,
                     129645..129647,129876..129878,129891..129893,
                     130218..130220,130284..130286,130290..130292,
                     130452..130454,130620..130625,130662..130664))
                     /gene="otsA"
                     /locus_tag="SMa0233"
                     /note="active site"
                     /db_xref="CDD:99963"
     misc_feature    complement(129888..129914)
                     /gene="otsA"
                     /locus_tag="SMa0233"
                     /note="homotetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99963"
     gene            complement(131106..132884)
                     /locus_tag="SMa0235"
                     /db_xref="GeneID:1235351"
     CDS             complement(131106..132884)
                     /locus_tag="SMa0235"
                     /EC_number="4.2.1.9"
                     /function="Small molecule metabolism"
                     /note="catalyzes the formation of 3-methyl-2-oxobutanoate
                     from 2,3,-dihydroxy-3-methylbutanoate"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydroxy-acid dehydratase"
                     /protein_id="NP_435372.1"
                     /db_xref="GI:16262579"
                     /db_xref="GeneID:1235351"
                     /translation="MTDKPQRRLRSQDWFDNPDHIDLTALYLERFMNYGVTPEELRCG
                     KPIIGIAQSGSDLTPCNRVHMDLAKRVRDGIRDAGGIPIEFPTHPIFENCKRPTAALD
                     RNLAYLGLVEILYGYPLDGVVLTTGCDKTTPSALMAASTVDIPAIVLSGGPMLDGWHE
                     GDLVGSGTVIWRMRRKLAAGEIDREEFMQAALDSAPSVGHCNTMGTASTMNAMAEALG
                     MSLTGCGAIPAAYRERGQMAYRTGRRAVELVFEDLKPSDILTREAFLNAIRVNSAIGG
                     STNAQPHLAAMAKHAGVELYPDDWQVHGFDIPLLANIQPAGAYLGERYHRAGGTPAIM
                     WELLKAGKLDGGCRTVTGRTVAENLEGREPTDREVIRPFDEPLKEKAGFLVLKGNLFD
                     FAIMKMSVVSDDFRKRYLQEPGREGVFEGKAVVFDGSEDYHKRINDPELDIDENTILV
                     IRGAGPLGWPGSAEVVNMQPPDHLLKRGIRSLPTIGDGRQSGTADSPSILNASPESAA
                     GGGLAWLRSGDVIRIDFNLGRCDMLVSDEDIERRKADGIPAVPADATPWQRIYRKSVT
                     QLSDGAVLEGAADFRQIAKNMPRHNH"
     misc_feature    complement(131109..132884)
                     /locus_tag="SMa0235"
                     /note="dihydroxy-acid dehydratase; Provisional; Region:
                     PRK13017"
                     /db_xref="CDD:237272"
     gene            complement(132893..133774)
                     /locus_tag="SMa0237"
                     /db_xref="GeneID:1235352"
     CDS             complement(132893..133774)
                     /locus_tag="SMa0237"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; amino acids"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="NP_435373.1"
                     /db_xref="GI:16262580"
                     /db_xref="GeneID:1235352"
                     /translation="MSGKTKIAFLGTGLMGAPMARRLLGAGFSVTVWNRDAAKAEPLA
                     ADGADIAASPADAVAGAAIVFTMLTNGQAVSEVLFERGVADSLAEGRIVVDCSSIAPQ
                     IAREHARRLAEKGIRHLDAPVSGGVVGAAAGTLAIMAGGDGAAVESLKEVFAVLGRVT
                     HVGPSGAGQVCKLANQQIVAVTIGAVAEAMVLVEAGGASRAAFRDAIRGGFAESRILE
                     LHGARMVERNFAPGGASNNQLKDLNAVMAMADELSLELPLTRQVRQEFADFVESGGGE
                     QDHSGLLLQLEKLNPRN"
     misc_feature    complement(132914..133762)
                     /locus_tag="SMa0237"
                     /note="3-hydroxyisobutyrate dehydrogenase and related
                     beta-hydroxyacid dehydrogenases [Lipid metabolism];
                     Region: MmsB; COG2084"
                     /db_xref="CDD:224995"
     misc_feature    complement(133283..133762)
                     /locus_tag="SMa0237"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    complement(132926..133279)
                     /locus_tag="SMa0237"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            complement(133771..134754)
                     /locus_tag="SMa0241"
                     /db_xref="GeneID:1235353"
     CDS             complement(133771..134754)
                     /locus_tag="SMa0241"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; similar to SMB0663 of S.
                     meliloti pSymb"
                     /codon_start=1
                     /transl_table=11
                     /product="epimerase"
                     /protein_id="NP_435374.1"
                     /db_xref="GI:16262581"
                     /db_xref="GeneID:1235353"
                     /translation="MHILIIGAAGMVGRKLTQRLVKDGTLGANSVEKLTLVDVVAPER
                     PQGFAGTVVAREGDLSASGEAEKLVEGRPDVIFHLAAIVSGEAELDFDKGYRINLDGT
                     RYLFDAIRLAHDQDGYKPRLVFTSSIAVVGAPLPFPIPDDYHLTPLTSYGTQKAICEL
                     LLSDYSRRGFFDGIGIRLPTICIRPGKPNKAASGFFSNILREPLVGQEAVLPVSEDVR
                     HWHTSPRSAVGFLIHGATINLEKVGPRRNLSMPGLSATVGEQIEALRRVAGEKAVQLI
                     RREPDEMIMKMVAGWAPGFEAKRATELGFTAEKSFDEIIRVHIEDELGGKL"
     misc_feature    complement(133786..134754)
                     /locus_tag="SMa0241"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    complement(133810..134754)
                     /locus_tag="SMa0241"
                     /note="Escherichia coli Gne (a
                     nucleoside-diphosphate-sugar 4-epimerase)-like, extended
                     (e) SDRs; Region: Gne_like_SDR_e; cd05238"
                     /db_xref="CDD:187549"
     misc_feature    complement(order(134212..134223,134290..134292,
                     134302..134304,134374..134382,134464..134466,
                     134512..134520,134641..134649,134719..134730,
                     134734..134736))
                     /locus_tag="SMa0241"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187549"
     misc_feature    complement(order(134290..134292,134302..134304,
                     134374..134376,134461..134463))
                     /locus_tag="SMa0241"
                     /note="active site"
                     /db_xref="CDD:187549"
     misc_feature    complement(order(134122..134124,134158..134160,
                     134215..134217,134302..134304,134374..134376))
                     /locus_tag="SMa0241"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:187549"
     gene            134949..136394
                     /locus_tag="SMa0244"
                     /db_xref="GeneID:1235354"
     CDS             134949..136394
                     /locus_tag="SMa0244"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; C-terminus similar to actin
                     interacting protein, a eukaryotic mitochondrial protein
                     with lactate  activity; also has similarity to glycolate
                     oxidases"
                     /codon_start=1
                     /transl_table=11
                     /product="Dehydrogenase, FAD-dependent"
                     /protein_id="NP_435375.1"
                     /db_xref="GI:16262582"
                     /db_xref="GeneID:1235354"
                     /translation="MTSAGTIEDAKGPAELRLALRQMLGEDIVLSETEEMLRFCRDWH
                     GDVTTGTVAVIRPRSTQQVAAAVKACRELGLSIVPQGGNTGLVLGAIPDAPERQVVLS
                     LSRMNRIRKIDPADFSAVVESGCILSELKDAIAKMGMFFPLALGAQGSCQIGGNVSTN
                     AGGVNVLRYGMTRELVLGLEVVLPDGSILEGLSTLRKDNRGIDLKQLFIGAEGTLGII
                     TAVSITLTPYPDHVATALLGLASLEDAIRLYRRARRDCCDLMSAFEFMPPLAFTLAQE
                     AMPDLPIPISAEYPAYVLMEISGSGLVDVDDLMQRFLEGAMEEGLVLDGTIAASQTQA
                     RNLWLIREGMNEGQAKRGTHMRTDISVPLSQLASFVEEAEKAVSEALPGAVSVSYGHV
                     GDGNVHLNVLPPAGSTPEERIQLIYKAKTVVNEVLDRYTGSISAEHGIGRLKRPDFDA
                     RLPATRRKLLTALKHAVDPEMIMNPGCQLRF"
     misc_feature    135003..136388
                     /locus_tag="SMa0244"
                     /note="FAD/FMN-containing dehydrogenases [Energy
                     production and conversion]; Region: GlcD; COG0277"
                     /db_xref="CDD:223354"
     misc_feature    135105..135518
                     /locus_tag="SMa0244"
                     /note="FAD binding domain; Region: FAD_binding_4;
                     pfam01565"
                     /db_xref="CDD:250709"
     misc_feature    135633..136376
                     /locus_tag="SMa0244"
                     /note="FAD linked oxidases, C-terminal domain; Region:
                     FAD-oxidase_C; pfam02913"
                     /db_xref="CDD:251615"
     gene            136409..137119
                     /locus_tag="SMa0246"
                     /db_xref="GeneID:1235355"
     CDS             136409..137119
                     /locus_tag="SMa0246"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; C-terminus similar to bacterial
                     regulatory proteins, gntR family"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435376.2"
                     /db_xref="GI:193782555"
                     /db_xref="GeneID:1235355"
                     /translation="MAAMDFGQISRSEHLPARIAAKIGREITEGRIAPGEKLPTEHLL
                     ATTFGVSRSVVREAIAQLRNEGLVETRQGVGAFATEIERRQSLRIEQGDLANRGSFRD
                     LFQLRIPLEVEAARLAAIHHTPQDLGKIDEALQQMTGAEKWTEQGIVADLAFHRAIAA
                     ATHNEYFLLFIGFIAERISLAINAARAAAILEEIVEVTIAEHVSIRNGVSARDPVQAE
                     EAMRHHLNGAAARLDLTI"
     misc_feature    136430..137104
                     /locus_tag="SMa0246"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    136451..136639
                     /locus_tag="SMa0246"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(136454..136456,136523..136525,136529..136534,
                     136556..136570,136574..136579,136586..136588,
                     136616..136621,136625..136636)
                     /locus_tag="SMa0246"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    136712..137089
                     /locus_tag="SMa0246"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            137290..138486
                     /locus_tag="SMa0247"
                     /db_xref="GeneID:1235356"
     CDS             137290..138486
                     /locus_tag="SMa0247"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435377.1"
                     /db_xref="GI:16262584"
                     /db_xref="GeneID:1235356"
                     /translation="MSGGFLVSFEQALSAESIQPADASSAMLVGRVWSKTAGGPCPVL
                     ISEGEVFDLTPLAATISALLEIDGLVDALRDPSRFASLGSLDAFLRGEAGDLLAPADL
                     QAVKAAGVTFADSMLERVIEEQAKGDPLRAQEIRGRLAPVLGDNLKGLVAGSDKAAEV
                     KKLLQELGLWSQYLEVGIGPDAEIFTKAQPMSSVGCGAYIGIHPKSDWNNPEPEVVLA
                     VTSKGKIVGATLGNDVNLRDFEGRSALLLSKAKDNNASCSIGPFIRLFDGAFTIEDVK
                     QAEVSLVVDGKEGFKMTGISPMSAISRSPEDLVSQLLNDNHQYPDGVVFFLGTMFAPV
                     KDRRGTGLGFTHEIGDRVEISTPRLGRLVNWVDHSDRCPKWSFGLGALMKNLAERGLL
                     QAKREG"
     misc_feature    137326..138465
                     /locus_tag="SMa0247"
                     /note="Fumarylacetoacetate (FAA) hydrolase family protein
                     [General function prediction only]; Region: COG3970"
                     /db_xref="CDD:226479"
     misc_feature    137827..138381
                     /locus_tag="SMa0247"
                     /note="Fumarylacetoacetate (FAA) hydrolase family; Region:
                     FAA_hydrolase; pfam01557"
                     /db_xref="CDD:250705"
     gene            138487..139020
                     /locus_tag="SMa0249"
                     /db_xref="GeneID:1235357"
     CDS             138487..139020
                     /locus_tag="SMa0249"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP-type small permease component"
                     /protein_id="NP_435378.1"
                     /db_xref="GI:16262585"
                     /db_xref="GeneID:1235357"
                     /translation="MQKAIDTFYKLLELLLIVLLAGMAVMVFLNVVLRYGFNSGINVS
                     DEMSRYFFVWLTFIGAVVTFRENSHVGVETLVSLFGRKGRIICMILSNIVVIAVSAIF
                     FWGTWKQSPINASMAAPVTGISMLWVYGIGYFTGAGVVLIALERLVRLLTGRVTEEEI
                     AAFAGENMTLEQLAERT"
     misc_feature    138487..139005
                     /locus_tag="SMa0249"
                     /note="TRAP-type C4-dicarboxylate transport system, small
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctM; COG3090"
                     /db_xref="CDD:225632"
     gene            139020..140297
                     /locus_tag="SMa0250"
                     /db_xref="GeneID:1235358"
     CDS             139020..140297
                     /locus_tag="SMa0250"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; C-terminus with DedA domain"
                     /codon_start=1
                     /transl_table=11
                     /product="dedA-like protein"
                     /protein_id="NP_435379.1"
                     /db_xref="GI:16262586"
                     /db_xref="GeneID:1235358"
                     /translation="MTLVVFIVSLLGAMAIGVPVAFSLMFCGVVLMWYMGMFNTQIIA
                     QNMIAGADTFTLLAIPFFILAGELMNAGGLSRRIIDFAIACVGHIRGGLGIVAIMAAV
                     IMASISGSAAADTAALAAILIPMMAKAGYNVPRSAGLIAAGGVIAPVIPPSMAFIVFG
                     VAANVSITQLFMAGIVPGLIMGIALVATWLLVVRKDDIQPLPRTPMKERVGATGRALW
                     ALGMPVIILGGIKAGVVTPTEAAVVAAVYALFVGMVIYRELKPRDLPGVILQAAKTTA
                     VIMFLVCAALVSSWLITAANIPSEITGFISPLIDRPTLLMFVIMLVVLVVGTALDLTP
                     TILILTPVLMPIIKQAGIDPVYFGVLFIMNTCIGLLTPPVGVVLNVVSGVGRVPLGKV
                     IVGVTPFLVAQILVLFLLVLFPDIVIVPARWLH"
     misc_feature    139020..140294
                     /locus_tag="SMa0250"
                     /note="TRAP-type C4-dicarboxylate transport system, large
                     permease component [Carbohydrate transport and
                     metabolism]; Region: DctQ; cl17274"
                     /db_xref="CDD:266603"
     misc_feature    139038..140267
                     /locus_tag="SMa0250"
                     /note="DctM-like transporters; Region: DctM; pfam06808"
                     /db_xref="CDD:253922"
     gene            140349..141353
                     /locus_tag="SMa0252"
                     /db_xref="GeneID:1235359"
     CDS             140349..141353
                     /locus_tag="SMa0252"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; with partial homology to
                     hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="TRAP-type periplasmic solute-binding protein"
                     /protein_id="NP_435380.1"
                     /db_xref="GI:16262587"
                     /db_xref="GeneID:1235359"
                     /translation="MRKLLLATTAIAFGLSAAAPAFAEFNDRNIRVSNGINEDHPVGN
                     GIKAMQACLDQKSGGKLKLTAFWGGALGGDLQATQALRSGVQEAVVTSSSPLVGIIPA
                     LGVFDLPFLFANAQEAYTVLDGDFGDMMNEKLEAAGLVNLAYWENGFRNLSNSVRPVT
                     KWEDFEGMKVRVMQNNIFLDTFQNLGANATPMAFGEVFSALETKAIDAQENPYVTIDT
                     SKFFEVQKYVTETNHAYTPFLFLFSKPIFDSYTPEEQAALRECAVVGRDEERKVIQDL
                     NKKSLEKIKEAGLEVNTLSAEEQARIREKSMVVYEKHKAEIGAEVVDAILAKLEEIRK
                     "
     misc_feature    140349..141341
                     /locus_tag="SMa0252"
                     /note="TRAP-type C4-dicarboxylate transport system,
                     periplasmic component [Carbohydrate transport and
                     metabolism]; Region: DctP; COG1638"
                     /db_xref="CDD:224553"
     gene            141517..142197
                     /locus_tag="SMa0254"
                     /db_xref="GeneID:1235360"
     CDS             141517..142197
                     /locus_tag="SMa0254"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435381.1"
                     /db_xref="GI:16262588"
                     /db_xref="GeneID:1235360"
                     /translation="METSLYLPVKGFLEKAGYVVKGEVDGCDLVGLSDDDPPVVVICE
                     LKLRFNLELILQAVDRAAVADEVWIAARVSAKGKGREADKRYRDLCRRLGVGMLGISD
                     AGDVSVIVGSVTPMPRTNPKRRSKLMREHRRRRGDPAIGGSTRAPVMTAYRQQALGCA
                     LALTSGPLRVREIRSSVPDAGKILLANVYGWFERLDRGVYGLTAAGREALQRWPQQDM
                     QAKTAVPA"
     misc_feature    141520..142194
                     /locus_tag="SMa0254"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5482"
                     /db_xref="CDD:227769"
     gene            142327..143304
                     /locus_tag="SMa0255"
                     /db_xref="GeneID:1235361"
     CDS             142327..143304
                     /locus_tag="SMa0255"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="3'-5' exonuclease of DNA polymerase III"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA polymerase III subunit epsilon"
                     /protein_id="NP_435382.1"
                     /db_xref="GI:16262589"
                     /db_xref="GeneID:1235361"
                     /translation="MTSQLDMFARDVRPAAARAEASRARRQTSTSFSETEMLAALKAT
                     GRYRILRKLEARTVASEVRPGFPLRGVILDTETTGLDARKCEIIEIGLVSFTYNEEGE
                     IGDVVAVYGGLQQPTIAIPPDITRLTGITDAMVAGQSIDIAAVQAIVGPADLIIAHNA
                     GFDRPFCEAFSDVFVRKAWACSVSEIDWSGRGFEGTKLGYLIGQSGYFHDGHRAVDDC
                     FALLGVLEQSSGGAALPPFAELYKASQRSRVRIFAENAPFDLKDVLKARGYRWSDGSD
                     GRPKSWWIEVAEEELEAELGFLRKEIYRWDEADPPTQRLTAFDRYRARR"
     misc_feature    142423..143301
                     /locus_tag="SMa0255"
                     /note="DNA polymerase III subunit epsilon; Validated;
                     Region: PRK09182"
                     /db_xref="CDD:236397"
     misc_feature    142435..>142605
                     /locus_tag="SMa0255"
                     /note="DnaQ-like (or DEDD) 3'-5' exonuclease domain
                     superfamily; Region: DnaQ_like_exo; cl10012"
                     /db_xref="CDD:263941"
     misc_feature    142537..143004
                     /locus_tag="SMa0255"
                     /note="DEDDh 3'-5' exonuclease domain family; Region:
                     DEDDh; cd06127"
                     /db_xref="CDD:176648"
     misc_feature    order(142546..142557,142561..142563,142798..142803,
                     142807..142815,142960..142962,142975..142977)
                     /locus_tag="SMa0255"
                     /note="active site"
                     /db_xref="CDD:176648"
     misc_feature    order(142546..142557,142561..142563,142798..142803,
                     142807..142812,142960..142962,142975..142977)
                     /locus_tag="SMa0255"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:176648"
     misc_feature    order(142546..142548,142552..142554,142813..142815,
                     142960..142962,142975..142977)
                     /locus_tag="SMa0255"
                     /note="catalytic site [active]"
                     /db_xref="CDD:176648"
     gene            complement(143473..145566)
                     /locus_tag="SMa0257"
                     /db_xref="GeneID:1235362"
     CDS             complement(143473..145566)
                     /locus_tag="SMa0257"
                     /note="glimmer prediction; NADH:flavin oxidoreductase/NADH
                     oxidase PF00724; homologous to DhtM (accession #P16099)
                     from Methylophilus methylotrophus"
                     /codon_start=1
                     /transl_table=11
                     /product="methylamine"
                     /protein_id="NP_435383.1"
                     /db_xref="GI:16262590"
                     /db_xref="GeneID:1235362"
                     /translation="MSRDSRFDILFEPVKIGPVTARNRFYQVPHCSGMGYRYPNAEAH
                     LRGMKAEGGWAVVSTQEAEIHPTSDLTPANEARLWDDGDLPALSAVTERVHAHGSLAA
                     IQLVHNGLHVANRFSRMIPLAPSHAVSDSLDPVQARAMDKADITDMRRWYRNAALRAK
                     KAGFDIVYLYAGHDMSVLQHFLSRRHNDRSDEYGGSFENRLRLFREILDDVREAIGDT
                     CALAVRLAVDELMGPSGITCEGEGKDIISALGELPDLWDVNLSDWSNDSQTARFSEEG
                     YQEPYIRFVKSVTTKPVVGVGRYTSPDSMVRVVKQGILDFIGAARPSIADPFLPKKIE
                     EGRIDDIRECIGCNICTSGDNTNVPMRCTQNPTVGEEWRKGWHPETIARSEAPEPALI
                     IGGGPAGLEAARALAQRGVDVMLAEGGGEWGGRVARECRLPGLATWGRVRDWRIGQLS
                     TRVNAELYLHSPLSAADILQYGIPHVAIATGASWRTDGVGRTHRMALDFLSEGILVSP
                     DAILSEGAEAVPSDGPVVVFDDDCFYMGSVLAELLARRGRTVTFVTPESQVSPWSRNT
                     LEQARIQKRLIGLGVEIVTAMALAGRTKDQLELSCVYSGRSRPVDCATLVPVTARLPD
                     ETLWLELKAREAEWADAGIKTITRLGDCLAPGLIAAAVYSGHQYARTYQEQVDKDRVP
                     FMREDIARLYGLRSG"
     misc_feature    complement(144454..145560)
                     /locus_tag="SMa0257"
                     /note="Trimethylamine dehydrogenase (TMADH) and histamine
                     dehydrogenase (HD) FMN-binding domain.  TMADH is an
                     iron-sulfur flavoprotein that catalyzes the oxidative
                     demethylation of trimethylamine to form dimethylamine and
                     formaldehyde. The protein forms a...; Region:
                     TMADH_HD_FMN; cd02929"
                     /db_xref="CDD:239239"
     misc_feature    complement(143554..145539)
                     /locus_tag="SMa0257"
                     /note="mycofactocin system FadH/OYE family oxidoreductase
                     2; Region: mycofact_OYE_2; TIGR03997"
                     /db_xref="CDD:234436"
     misc_feature    complement(order(144514..144516,144601..144609,
                     144673..144675,144679..144681,144895..144897,
                     145048..145050,145057..145059,145255..145257,
                     145384..145389,145474..145485))
                     /locus_tag="SMa0257"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239239"
     misc_feature    complement(order(144475..144477,144481..144486,
                     144493..144495,144505..144510,144517..144519,
                     144526..144528,144535..144537,144604..144609,
                     144895..144897,145042..145044,145048..145053,
                     145057..145062,145255..145257,145297..145299,
                     145357..145362,145384..145386,145465..145467,
                     145474..145476,145480..145482))
                     /locus_tag="SMa0257"
                     /note="active site"
                     /db_xref="CDD:239239"
     misc_feature    complement(order(144454..144459,144499..144501,
                     144508..144510,145012..145017,145153..145155,
                     145201..145203,145300..145302,145309..145314,
                     145318..145320,145327..145332,145336..145338,
                     145423..145425))
                     /locus_tag="SMa0257"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239239"
     misc_feature    complement(145042..145044)
                     /locus_tag="SMa0257"
                     /note="putative catalytic residue [active]"
                     /db_xref="CDD:239239"
     misc_feature    complement(order(144481..144483,144517..144519,
                     144526..144528,144535..144537))
                     /locus_tag="SMa0257"
                     /note="4Fe-4S cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239239"
     misc_feature    complement(<144295..144393)
                     /locus_tag="SMa0257"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     gene            complement(145822..146667)
                     /locus_tag="SMa0259"
                     /db_xref="GeneID:1235363"
     CDS             complement(145822..146667)
                     /locus_tag="SMa0259"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435384.1"
                     /db_xref="GI:16262591"
                     /db_xref="GeneID:1235363"
                     /translation="MTAQDLYRIRDFVPDFDTIAAEFAERSWAVSARADVRADIRYGS
                     GVREVIDLILPERVQAGAPLHVFVHGGYWRSGEKINYRFVAAPVLAAGGIAALVEYDL
                     MPGKRLDVLVDQVRRSVLWLQAHAGDFGADPARLTVSGHSAGAHLASFLAATGPEEAY
                     PPSLPTLQGLLLLSGIYDLSGIPDSFLRHEAEMTPMEAAAWSPLTSSQLPCPLRIIAY
                     GADETAPFQNQAAGLCELLRAQDKSAELLPVPDLNHMSIVLDLADTDGVLGRQLHDLV
                     AQPTR"
     misc_feature    complement(<146215..>146487)
                     /locus_tag="SMa0259"
                     /note="Esterases and lipases (includes fungal lipases,
                     cholinesterases, etc.)  These enzymes act on carboxylic
                     esters (EC: 3.1.1.-). The catalytic apparatus involves
                     three residues (catalytic triad): a serine, a glutamate or
                     aspartate and a histidine.These...; Region:
                     Esterase_lipase; cl19094"
                     /db_xref="CDD:267447"
     misc_feature    complement(145906..146472)
                     /locus_tag="SMa0259"
                     /note="alpha/beta hydrolase fold; Region: Abhydrolase_3;
                     pfam07859"
                     /db_xref="CDD:254474"
     gene            complement(146683..148146)
                     /gene="gabD3"
                     /locus_tag="SMa0260"
                     /db_xref="GeneID:1235364"
     CDS             complement(146683..148146)
                     /gene="gabD3"
                     /locus_tag="SMa0260"
                     /EC_number="1.2.1.16"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; pool of unassigned individual reversible
                     reactions"
                     /note="glimmer prediction; similar to E. coli GabD
                     (accession P25526) and A. tumefaciens AttK (accession
                     AAD43988); Aldehyde  family, PF00171"
                     /codon_start=1
                     /transl_table=11
                     /product="GabD3 succinate-semialdehyde dehdyrogenase"
                     /protein_id="NP_435385.1"
                     /db_xref="GI:16262592"
                     /db_xref="GeneID:1235364"
                     /translation="MTFHAKFSGYADPALHAAGLYIGGKWQSGSGITVLDPSTGNLLA
                     EVADASIEDAQRAVDAADAAAAGWRATPARQRSEILRRWYQLMTQHAEELATLIALEN
                     GKALADARGEVAYAAEFFRWYAEEATRIPGEFRHTPSGSHNILVDHEPIGIAVLITPW
                     NFPAAMATRKIGPALAAGCTVILKPASETPLTAYAMARLGEEAGVPPGVVNVLTTSNP
                     GGITNAMLADPRVRKLSFTGSTGVGRVLLAEAAKSVVSCSMELGGNAPFIVFDDADLE
                     VALDGAMIAKMRNAGEACTAANRFYVQAGIHDAFVAGLTARMKSLKLGPGYDPETQCG
                     PMITQNAVRKIDRLVSEALAAGARATTGGKPLTENGYFYPPTVLENVPVNASIAREEI
                     FGPVAPVYKFESDDEAIRLANNTEYGLAAYIYSRDLKRAMKVGKRIETGMLGINRGLM
                     SDPAAPFGGVKQSGLGREGGVTGILEFMEPKYFAVDY"
     misc_feature    complement(146692..148047)
                     /gene="gabD3"
                     /locus_tag="SMa0260"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    complement(order(146692..146712,146746..146748,
                     146761..146763,146779..146784,146791..146793,
                     146809..146829,146833..146835,146842..146844,
                     146848..146850,146860..146865,146869..146871,
                     147073..147075,147211..147213,147223..147225,
                     147394..147396,147403..147405,147415..147417,
                     147451..147453,147700..147702,147715..147723,
                     147739..147765,147769..147774,147781..147783,
                     147904..147906,147931..147933))
                     /gene="gabD3"
                     /locus_tag="SMa0260"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    complement(order(146776..146778,146890..146892,
                     146968..146970,146974..146976,147265..147267,
                     147361..147369,147409..147414,147421..147423,
                     147430..147441,147586..147591,147595..147597,
                     147640..147642,147664..147678))
                     /gene="gabD3"
                     /locus_tag="SMa0260"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    complement(order(147265..147267,147274..147276,
                     147367..147369,147664..147666))
                     /gene="gabD3"
                     /locus_tag="SMa0260"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            complement(148163..149362)
                     /locus_tag="SMa0263"
                     /db_xref="GeneID:1235365"
     CDS             complement(148163..149362)
                     /locus_tag="SMa0263"
                     /EC_number="1.1.1.-"
                     /note="glimmer prediction; similar to Agrobacterium
                     tumefaciens AttL (accession AAD43989); iron-containing
                     alcohol  family, PF00465"
                     /codon_start=1
                     /transl_table=11
                     /product="alcohol dehydrogenase"
                     /protein_id="NP_435386.1"
                     /db_xref="GI:16262593"
                     /db_xref="GeneID:1235365"
                     /translation="MNLFGTLRAPRELLFGAGQRHALGGIAAKLGHRALIVTDTRLAV
                     DADLLALVRRLEEAGLEVMVDSSTLPDVPVESAIVSAAAASGFAPDLVIGIGGGSCLD
                     MAKCVTLLLTHGGRPQDYYGEYAVPGPVMPLIAIPTTAGTGSEVTPVAVLSDAERSLK
                     VGISSPHLIPAVSICDPELTLSCPPGLTAIAGADALTHAIEAFTAIRREPVPGIAQQR
                     VFVGKNELSDHFALSAITLLWQGLERACKDGADAGARETVMLGATLAGLAFGVAGTAA
                     AHAIQYPVGALTHTAHGLGVACLMPYVMTWNAPLIRDELAQIAHAAGLGGPDEVIPAL
                     VSLFERIGIPATLRDLGLEEDRIDWVAEQSSGIARLIQNNPRPLNPHEMRNLVAAAHC
                     GDRSRLN"
     misc_feature    complement(148202..149335)
                     /locus_tag="SMa0263"
                     /note="Dehydroquinate synthase-like (DHQ-like) and
                     iron-containing alcohol dehydrogenases (Fe-ADH); Region:
                     DHQ_Fe-ADH; cl02872"
                     /db_xref="CDD:261488"
     misc_feature    complement(order(148487..148489,148517..148519,
                     148529..148531,148769..148771,148781..148783,
                     148802..148804,148826..148828,148880..148885,
                     148940..148942,148946..148951,149048..149050,
                     149057..149059,149066..149074,149246..149248))
                     /locus_tag="SMa0263"
                     /note="active site"
                     /db_xref="CDD:173927"
     misc_feature    complement(order(148487..148489,148826..148828,
                     148940..148942,148946..148951,149066..149074,
                     149246..149248))
                     /locus_tag="SMa0263"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:173927"
     misc_feature    complement(order(148487..148489,148529..148531,
                     148781..148783))
                     /locus_tag="SMa0263"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:173927"
     gene            complement(149384..150388)
                     /locus_tag="SMa0265"
                     /db_xref="GeneID:1235366"
     CDS             complement(149384..150388)
                     /locus_tag="SMa0265"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="NP_435387.1"
                     /db_xref="GI:16262594"
                     /db_xref="GeneID:1235366"
                     /translation="MRLPPARLRNLSVALLEKRGVPADSARLQANLLLEAELRGLPSH
                     GLQRLPLLLSRLDKGLANPTTRGNGTWRRASFLSVDGERGLGPVVMMDAMRVTRRILK
                     ETGLAIAAIRNANHMGMLAYYAEAAARDGLIGIVMSTSEALVHPFGGTQALIGTNPVA
                     IGIPAAGHPFVLDLATSIVSMGKINNHAMRGLAIPPGWAVDRDGRATTDPHAAQAGAI
                     APFGDAKGYGLGLAIELLVAALAGSNLAPDVNGTLDDIHPANKGDLLILIDPSAGAGS
                     IPALAAYLDRLRLSRPLDPTQPVAIPGDGARARRAAAAKTGIELPQPLFDHLTALEAA
                     "
     misc_feature    complement(149396..150388)
                     /locus_tag="SMa0265"
                     /note="Malate/L-lactate dehydrogenases [Energy production
                     and conversion]; Region: COG2055"
                     /db_xref="CDD:224966"
     gene            150483..151175
                     /locus_tag="SMa0267"
                     /db_xref="GeneID:1235367"
     CDS             150483..151175
                     /locus_tag="SMa0267"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory protein,
                     gntR family, PF00392"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435388.1"
                     /db_xref="GI:16262595"
                     /db_xref="GeneID:1235367"
                     /translation="MVVAIAAERASRGAGIRPTSVVEGVYDSIYHRLMSLDIAPGARI
                     PIDVLARELGVSQTPIREALSRLEREGLVRKEHLIGYSAAPQWTRKQFEDLYAFRLLI
                     EPEAARLAAANMTPEALQQLENSAADMGHGEAPVDRNTRYSRFARADAQFHDEILKIA
                     GNDVIRSTLSNQHVHLHIFRLMFHIRVTQEALEEHESLLAAFRARDPQAAYDAMRVHI
                     ERSRDRLLSAFE"
     misc_feature    150528..151172
                     /locus_tag="SMa0267"
                     /note="Transcriptional regulators [Transcription]; Region:
                     GntR; COG1802"
                     /db_xref="CDD:224715"
     misc_feature    150540..150725
                     /locus_tag="SMa0267"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cl17414"
                     /db_xref="CDD:266669"
     misc_feature    order(150540..150542,150546..150548,150615..150617,
                     150618..150623,150645..150659,150663..150668,
                     150675..150677,150705..150710,150714..150725)
                     /locus_tag="SMa0267"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    150762..151142
                     /locus_tag="SMa0267"
                     /note="This entry represents the C-terminal ligand binding
                     domain of many members of the GntR family; Region: FCD;
                     smart00895"
                     /db_xref="CDD:214892"
     gene            151172..152764
                     /locus_tag="SMa0270"
                     /db_xref="GeneID:1235368"
     CDS             151172..152764
                     /locus_tag="SMa0270"
                     /note="glimmer prediction; ABC transporter family,
                     PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435389.1"
                     /db_xref="GI:16262596"
                     /db_xref="GeneID:1235368"
                     /translation="MNAALPSNAVAPPPNRAVAALAAEGLGKAYGPITVLSDVTLEVH
                     AGEVHAIIGENGAGKSTLMKLLSGHVVPTAGHLLLEGKSVEFRNAVEAENAGIVLVHQ
                     EILLASDLTVAENLYLGREVGRGLLVNDKAMNSRAAELLARVGSAARPRDRVGELPLA
                     QRQLVQIARALLDERKVIIFDEPTAVLANDEVAALLDIVRSLRDHGVAVLYISHRLDE
                     VQALADRITVLRDGRMIGTWPAAGLGQREMAELMVGRELDMLYPHKRSATTAAPILSV
                     TNLAIDHGSQTVSFSVSPGEVLGIGGMVGAGRTELIEGLMGLRPSEAESIVLNGREIG
                     SRSVRTLMDAGLVYLTEDRKGKGLLLEEKLGPNLTLQALDTINPGVFLDKQGELSRLR
                     KAVADYDIRVRSMRLEASQLSGGNQQKLLLAKVMMADPSVIIIDEPTRGIDIGNKSQI
                     YDFIDGMVRAGKACIVISSEMPELVGLADRVLVMRAGRIVAELRGDEINEENVVYAAT
                     TGGCADVGEEKHDRSDSNTRTN"
     misc_feature    151208..152701
                     /locus_tag="SMa0270"
                     /note="ABC-type sugar transport system, ATPase component
                     [Carbohydrate transport and metabolism]; Region: MglA;
                     COG1129"
                     /db_xref="CDD:224053"
     misc_feature    151232..151882
                     /locus_tag="SMa0270"
                     /note="First domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_I; cd03216"
                     /db_xref="CDD:213183"
     misc_feature    151328..151351
                     /locus_tag="SMa0270"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    order(151337..151342,151346..151354,151475..151477,
                     151712..151717,151811..151813)
                     /locus_tag="SMa0270"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213183"
     misc_feature    151466..151477
                     /locus_tag="SMa0270"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213183"
     misc_feature    151640..151669
                     /locus_tag="SMa0270"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213183"
     misc_feature    151700..151717
                     /locus_tag="SMa0270"
                     /note="Walker B; other site"
                     /db_xref="CDD:213183"
     misc_feature    151724..151735
                     /locus_tag="SMa0270"
                     /note="D-loop; other site"
                     /db_xref="CDD:213183"
     misc_feature    151799..151819
                     /locus_tag="SMa0270"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213183"
     misc_feature    151979..152638
                     /locus_tag="SMa0270"
                     /note="Second domain of the ATP-binding cassette component
                     of monosaccharide transport system; Region:
                     ABC_Carb_Monos_II; cd03215"
                     /db_xref="CDD:213182"
     gene            152730..153725
                     /locus_tag="SMa0271"
                     /db_xref="GeneID:1235369"
     CDS             152730..153725
                     /locus_tag="SMa0271"
                     /note="glimmer prediction; ABC-2 type transporter PF01061"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435390.1"
                     /db_xref="GI:16262597"
                     /db_xref="GeneID:1235369"
                     /translation="MTVATATLAPTNEGARIRWADLAPFIALAVIVLFGALVNPNFVS
                     SANLINVITRSAFIAIIAVGATFVISSGGLDLSVGSMMAFVTGIMIMAMNHLAPAFGA
                     WAIPMGAGVALLVGALCGLFNGLIVTVGRIEPFIVTLGTMGIFRAFITFMTDGGSLPI
                     DRSLREAYRPVYFGSFFGIPYPVLITFVVVMAGAFLLYKTKYGRRLKSAGSNVEVARF
                     SGVNVAGVRTGAYVIQGFCVAVAAICYVPRLGAATPTTGQLWELQVITAVVIGGTLLR
                     GGRGRIGGTVAGALILEVIANVMVLSDLVSEYLVAAVQGAIIIIAMLAHRFTANR"
     misc_feature    152892..153701
                     /locus_tag="SMa0271"
                     /note="Transmembrane subunit (TM) of Escherichia coli AraH
                     and related proteins. E. coli AraH is the TM of a
                     Periplasmic Binding Protein (PBP)-dependent ATP-Binding
                     Cassette (ABC) transporter involved in the uptake of the
                     monosaccharide arabinose. This group...; Region:
                     TM_PBP1_transp_AraH_like; cd06579"
                     /db_xref="CDD:119321"
     misc_feature    153369..153425
                     /locus_tag="SMa0271"
                     /note="TM-ABC transporter signature motif; other site"
                     /db_xref="CDD:119321"
     gene            153755..154720
                     /locus_tag="SMa0273"
                     /db_xref="GeneID:1235370"
     CDS             153755..154720
                     /locus_tag="SMa0273"
                     /function="Cell processes; Transport of small molecules"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435391.1"
                     /db_xref="GI:16262598"
                     /db_xref="GeneID:1235370"
                     /translation="MKSIIRKAGLLLSTATLVLAQPLGTAQAQEKRIVAVSIPAATHG
                     WTGGVVYHAEQAEKEVEAAFPNVDVVLSTASSATAQVSALEDLSATRKLDALVILPFT
                     SEELTGPVEQIKKNGTFISVVDRGLTDPTIQDLYVAGDNIAVGANTARWLSDKLGGQG
                     EIVVLRGIPTVIDDERIKGFSDVIDKTNIKILDIQYANWNQDEAFKLMQDYLAKYPKI
                     DAVWANDDDMLLGVIEAVDRAGRKDIKYALGGNGMKQVIEMVKEGNERTPVSTPYPPS
                     MIKSAIYMTAAQFAGQAPMRGSFLLGAPLITPENADQFYFPDSPF"
     misc_feature    153758..154717
                     /locus_tag="SMa0273"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     RbsB; COG1879"
                     /db_xref="CDD:224791"
     misc_feature    153851..154672
                     /locus_tag="SMa0273"
                     /note="Periplasmic sugar-binding domain of uncharacterized
                     ABC-type transport systems; Region:
                     PBP1_ABC_sugar_binding_like_3; cd06311"
                     /db_xref="CDD:107306"
     misc_feature    order(153887..153889,154124..154126,154280..154282,
                     154505..154507,154568..154570)
                     /locus_tag="SMa0273"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:107306"
     gene            154841..155428
                     /locus_tag="SMa0275"
                     /db_xref="GeneID:1235371"
     CDS             154841..155428
                     /locus_tag="SMa0275"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; ThiJ/PfpI family, PF01965"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435392.1"
                     /db_xref="GI:16262599"
                     /db_xref="GeneID:1235371"
                     /translation="MSGKKILMLTGEFTEEYEIYVFQKGMEAVGHTVHVVCPDKKAGD
                     RIKTSLHDFEGDQTYTEKLGHYADINKTFSEVRPEEYDAVYAAGGRGPEYIRTDKRVQ
                     DMVRHFHDTGKPIFTICHGVQILMAVPGVLKGRKVAGLGACEPEVTAVGGTYIDVEPT
                     GAYVDGNMVSAKGWTGLAAFMRECLNVLGTKITHT"
     misc_feature    154853..155407
                     /locus_tag="SMa0275"
                     /note="intracellular protease, PfpI family; Region: PfpI;
                     TIGR01382"
                     /db_xref="CDD:233389"
     misc_feature    154853..155404
                     /locus_tag="SMa0275"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain found in a subgroup of proteins similar to PfpI
                     from Pyrococcus furiosus; Region: GATase1_PfpI_1; cd03169"
                     /db_xref="CDD:153243"
     misc_feature    155195..155197
                     /locus_tag="SMa0275"
                     /note="conserved cys residue [active]"
                     /db_xref="CDD:153243"
     gene            complement(155598..155948)
                     /locus_tag="SMa0277"
                     /db_xref="GeneID:1235372"
     CDS             complement(155598..155948)
                     /locus_tag="SMa0277"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435393.1"
                     /db_xref="GI:16262600"
                     /db_xref="GeneID:1235372"
                     /translation="MEKHRIYSVSVASVYPHYVAKAEKKGRTKAEVDEIICWLTGYGP
                     QALDDQLAKNTSLENFFAQAPRMNPSRSLITGVICGVRVEEIQDTTMREIRYLDKLID
                     ELAKGKAMDKILRK"
     misc_feature    complement(155601..155945)
                     /locus_tag="SMa0277"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4898"
                     /db_xref="CDD:227235"
     gene            complement(156190..156489)
                     /locus_tag="SMa5016"
                     /db_xref="GeneID:6435254"
     CDS             complement(156190..156489)
                     /locus_tag="SMa5016"
                     /note="Has similarity to a short region in the carboxy-
                     termini of proteins annotated as aldehyde dehydrogenases;
                     Possible ORF fragment"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000332.1"
                     /db_xref="GI:193782556"
                     /db_xref="GeneID:6435254"
                     /translation="MVGFNGAKMSGYGAKGGLAHLATYLYTKSATFNARSHDFRSSGP
                     GGTQDFRSGYDDLHRPLASLARPGGIPSGTGVVGRARPDSRSIRLDRIIDLDDMQ"
     gene            complement(156800..157411)
                     /locus_tag="SMa0279"
                     /db_xref="GeneID:1235374"
     CDS             complement(156800..157411)
                     /locus_tag="SMa0279"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; weak homologies to
                     phosphatidylethanolamine N-methyltransferase (accession
                     Q05197) from Rhodobacter sphaeroides"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435395.1"
                     /db_xref="GI:16262602"
                     /db_xref="GeneID:1235374"
                     /translation="MGIYRDVILPRLCDLSMRNERLRPYRERVIGAAQGRVLEIGVGS
                     GLNLPFYGPVVGEVLALEPSAGLVAMAREAPRSDLPVSFIDASAEAIPLDDKSVDTVV
                     TTWTLCTIPDAAAALTEMRRVLRPGGKLLFVEHGLAPDRGVRWWQDTLTPVWRRISGG
                     CHLNRPIRSMIECGGFRMERVETGYMQGPKPMTFMYEGSARPE"
     misc_feature    complement(157013..157306)
                     /locus_tag="SMa0279"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(157100..157102,157148..157156,
                     157223..157228,157274..157294))
                     /locus_tag="SMa0279"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(157557..158345)
                     /locus_tag="SMa0280"
                     /db_xref="GeneID:1235375"
     CDS             complement(157557..158345)
                     /locus_tag="SMa0280"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435396.1"
                     /db_xref="GI:16262603"
                     /db_xref="GeneID:1235375"
                     /translation="MLDRTIPHNLARKAVLYRMVMPGHTCPYGLKTKDLLQRSGYEVD
                     DHHLTTREETDAFKAQHGVPTTPQVFIDGQRVGGYDDLRRFLGKPVADPKATTYRPVI
                     VLFTLTALTAMAASHAVNGTPFTLRAAEWFIAFSMVVLAMMKLQNVESFATMFLNYDL
                     LAMRWIPYSYIYPYAEGLAGVLMVAGALNWLSVPVAMFIGTVGAVSVFKAVYIDKREL
                     KCACVGGSSNVPLGFISLTENLMMIAMAVWMAAGSIGLIATHAM"
     misc_feature    complement(158070..158273)
                     /locus_tag="SMa0280"
                     /note="Glutaredoxin and related proteins
                     [Posttranslational modification, protein turnover,
                     chaperones]; Region: GrxC; COG0695"
                     /db_xref="CDD:223767"
     misc_feature    complement(<157590..157979)
                     /locus_tag="SMa0280"
                     /note="Methylamine utilisation protein MauE; Region: MauE;
                     pfam07291"
                     /db_xref="CDD:115916"
     gene            158400..158804
                     /locus_tag="SMa0281"
                     /db_xref="GeneID:1235376"
     CDS             158400..158804
                     /locus_tag="SMa0281"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory protein,
                     merR family, PF00376; homologous to MerR from Thiobacillus
                     ferrooxidans (accession S18590)"
                     /codon_start=1
                     /transl_table=11
                     /product="MerR family transcriptional regulator"
                     /protein_id="NP_435397.1"
                     /db_xref="GI:16262604"
                     /db_xref="GeneID:1235376"
                     /translation="MVQSQDLQELTIGKLAAAGGVGVETIRFYQRKGLLATPKRLEGV
                     RRYGGEDVRRLRFIKQAQAAGFTLEEIGQLLALDAGHNRSAARELAKKKLEQLDARIG
                     ELNRAREALRKLVSECAEDKTGPCPILASFGV"
     misc_feature    158427..158795
                     /locus_tag="SMa0281"
                     /note="Helix-Turn-Helix DNA binding domain of the MerR1
                     transcription regulator; Region: HTH_MerR1; cd04783"
                     /db_xref="CDD:133410"
     misc_feature    158430..158792
                     /locus_tag="SMa0281"
                     /note="Hg(II)-responsive transcriptional regulator;
                     Region: MerR; TIGR02051"
                     /db_xref="CDD:131106"
     misc_feature    order(158430..158438,158478..158480,158526..158534)
                     /locus_tag="SMa0281"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133410"
     misc_feature    order(158568..158570,158577..158579,158589..158594,
                     158619..158621,158646..158651,158658..158660,
                     158667..158669,158679..158681,158697..158699,
                     158709..158711,158718..158723,158742..158744,
                     158757..158762,158775..158777,158781..158783)
                     /locus_tag="SMa0281"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:133410"
     misc_feature    order(158646..158648,158751..158753,158775..158777)
                     /locus_tag="SMa0281"
                     /note="mercury binding site [ion binding]; other site"
                     /db_xref="CDD:133410"
     gene            complement(159165..159389)
                     /locus_tag="SMa0285"
                     /db_xref="GeneID:1235377"
     CDS             complement(159165..159389)
                     /locus_tag="SMa0285"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435398.2"
                     /db_xref="GI:193782557"
                     /db_xref="GeneID:1235377"
                     /translation="MSASAQLAKMAIEKGHGETSHIVWMKMGGLKDWELKPNILEGDW
                     TFVTKNSVDFQGPNTSPAPRDNIPKRCSSR"
     gene            complement(159590..160051)
                     /locus_tag="SMa0286"
                     /db_xref="GeneID:1235378"
     CDS             complement(159590..160051)
                     /locus_tag="SMa0286"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; ORF also predicted in the
                     Rhizobium sp. NGR234 sym plasmid sequence - gene y4E0
                     (accession P55438)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435399.1"
                     /db_xref="GI:16262606"
                     /db_xref="GeneID:1235378"
                     /translation="MSLFCGSGGRRRAVIHLFSRDLAQGKVPAGHTSCQTPSFRSTMA
                     ATSWRGPVHSSPSILRARAASRPRSDCLPSAPQGPTGNSAHTPLGGPVARGLDGSHEF
                     LAIDLVPVMRDASERLDLAAAREIVTASPDVLGGTPVIRGTPVPVYDVAAS"
     misc_feature    complement(<159599..159679)
                     /locus_tag="SMa0286"
                     /note="Protein of unknown function (DUF433); Region:
                     DUF433; cl01030"
                     /db_xref="CDD:260756"
     gene            complement(160062..160508)
                     /locus_tag="SMa0287"
                     /db_xref="GeneID:1235379"
     CDS             complement(160062..160508)
                     /locus_tag="SMa0287"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435400.1"
                     /db_xref="GI:16262607"
                     /db_xref="GeneID:1235379"
                     /translation="MNKGSTKAKRQENSRCENEEPTRKPGTSIAEWIVAGVSCLALLA
                     VLGYLILDGLSGRNGAADIIVLPAEVTAMNDGYVVEFAANNRAGKSVAAVEIKGELRG
                     GEEVVEESGVTIDYIPQKSERKGALIFRSDPEGYELRIFASGYSEP"
     misc_feature    complement(160065..160427)
                     /locus_tag="SMa0287"
                     /note="TIGR02588 family protein; Region: TIGR02588"
                     /db_xref="CDD:131637"
     gene            complement(160505..161341)
                     /locus_tag="SMa0288"
                     /db_xref="GeneID:1235380"
     CDS             complement(160505..161341)
                     /locus_tag="SMa0288"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435401.1"
                     /db_xref="GI:16262608"
                     /db_xref="GeneID:1235380"
                     /translation="MTPAEGVVGPTPREFWIGLGRAFAGALIFAVPVLMTMEAWALGF
                     HLHPLRLALLLVATVPTLVLLHKYGGFRKSVGLRDRIADAFVALLVAAIAASAILFSF
                     GIVDADMPLREIVGKVAVQIVPGSLGASLARAQLGPSPLEGDAVPEPAYAGELFLMVV
                     GALFLSVNIAPTEEVVLIAYKMNPWHEIALALGTLGLMHVFVYELEFRGTHNPEPGAG
                     FVNIFFRYTIVGYCLVMLVNFYILWTFGRTDGVGFSETLSAVVVLSFPGALGAAVARL
                     IL"
     misc_feature    complement(160508..161305)
                     /locus_tag="SMa0288"
                     /note="putative integral membrane protein TIGR02587;
                     Region: TIGR02587"
                     /db_xref="CDD:131636"
     gene            161616..161984
                     /locus_tag="SMa0291"
                     /db_xref="GeneID:1235381"
     CDS             161616..161984
                     /locus_tag="SMa0291"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435402.1"
                     /db_xref="GI:16262609"
                     /db_xref="GeneID:1235381"
                     /translation="MVLFCSDPHISPETNPENAVSEFISYLFAILVVGPLQAEISERL
                     RGVPSTEIVQAGRACVAAEAPRLLQRAQEDWGWAAANAVGVSVGLIDPASLLAGQNAD
                     CDRLVQVLSQSSGGNGDDEA"
     gene            complement(162273..162668)
                     /locus_tag="SMa0293"
                     /db_xref="GeneID:1235383"
     CDS             complement(162273..162668)
                     /locus_tag="SMa0293"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435404.4"
                     /db_xref="GI:193782558"
                     /db_xref="GeneID:1235383"
                     /translation="MESVTILLAEDETLLLLDFEDALKEAGFMVLAVTSGKKAVEHLK
                     AAESSIAGIVTDIRFAESPSGWDVTRIAREIDPEMPVVYISGDSAPDWASQGVPKSIM
                     IEKPFVMSQMIVAISQLLNDRRAGAAALE"
     misc_feature    complement(162309..162650)
                     /locus_tag="SMa0293"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cd00156"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(162351..162356,162414..162416,
                     162474..162476,162501..162503,162636..162641))
                     /locus_tag="SMa0293"
                     /note="active site"
                     /db_xref="CDD:238088"
     misc_feature    complement(162501..162503)
                     /locus_tag="SMa0293"
                     /note="phosphorylation site [posttranslational
                     modification]"
                     /db_xref="CDD:238088"
     misc_feature    complement(order(162474..162479,162483..162485,
                     162489..162494))
                     /locus_tag="SMa0293"
                     /note="intermolecular recognition site; other site"
                     /db_xref="CDD:238088"
     misc_feature    complement(162348..162356)
                     /locus_tag="SMa0293"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     gene            complement(163041..164855)
                     /locus_tag="SMa0298"
                     /db_xref="GeneID:1235384"
     CDS             complement(163041..164855)
                     /locus_tag="SMa0298"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; N-terminal half of  ORF is
                     similar to ABC transporter family, PF00005; start codon
                     changed based on homology and location of S-D consensus."
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435405.1"
                     /db_xref="GI:16262612"
                     /db_xref="GeneID:1235384"
                     /translation="MKNLIEVRNLNIAYGGPSGWTNVVQDVSFEIAPGEAFGLVGESG
                     CGKSTVAYRLLGYGTINSLVQTGEVLFDGTDLLKLDAASLMRLRGNRIAFVPQNPTTS
                     LSPGMRVGSQICEMIATHKALPDGMTMERRIVELFTLVGLPDVGHRYPHELSGGQQQR
                     VTIAMAVACNPDLLVLDEPTTGLDVTTQRQIIQLLADLRSRIGMAMLYVTHDLALLAQ
                     IADRVGVMYAGQLVEVAPCDKLLSAPAHPYSRGLIASIPTNDGTDRQARSLRGMLRRD
                     EMSTGCKFEPRCDFATGACRATPQLLELIEDARSVACMRWREATAPLAPSVTAKAVAR
                     TAVRSESLLSVTELSLSYQQPGLFNRLLGRTSPAVVREINLNLAAGEVVALVGGSGSG
                     KSTIARAISARLPPRAGIIRLDGTALAPSLKDRSVEELRQIQYIFQNPDASLNPRGLR
                     LFERTQELDDPCLYRNVERREDLVADQKLRIDEKCAGCYSKPPLDSKRTITSHARPPF
                     RGRRPYRASAVPSPAAVRARSAIHAPKTGHPSRSRLPASSAAISLPKHWYATPPRQIT
                     TARRSRSDQCRDLARDRAQASRRSALRRSAADRTANSC"
     misc_feature    complement(163044..164855)
                     /locus_tag="SMa0298"
                     /note="ATPase components of various ABC-type transport
                     systems, contain duplicated ATPase [General function
                     prediction only]; Region: COG1123"
                     /db_xref="CDD:224048"
     misc_feature    complement(164151..164846)
                     /locus_tag="SMa0298"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    complement(164712..164735)
                     /locus_tag="SMa0298"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(order(164223..164225,164322..164327,
                     164565..164567,164709..164717,164721..164726))
                     /locus_tag="SMa0298"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(164565..164576)
                     /locus_tag="SMa0298"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(164370..164399)
                     /locus_tag="SMa0298"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(164322..164339)
                     /locus_tag="SMa0298"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(164304..164315)
                     /locus_tag="SMa0298"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(164217..164237)
                     /locus_tag="SMa0298"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    complement(163971..164162)
                     /locus_tag="SMa0298"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; pfam08352"
                     /db_xref="CDD:254752"
     misc_feature    complement(<163515..163832)
                     /locus_tag="SMa0298"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    complement(163674..163697)
                     /locus_tag="SMa0298"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(order(163542..163544,163671..163679,
                     163683..163688))
                     /locus_tag="SMa0298"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    complement(163542..163553)
                     /locus_tag="SMa0298"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     gene            complement(164858..165745)
                     /locus_tag="SMa0299"
                     /db_xref="GeneID:1235385"
     CDS             complement(164858..165745)
                     /locus_tag="SMa0299"
                     /function="Cell processes; Transport of small molecules"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435406.1"
                     /db_xref="GI:16262613"
                     /db_xref="GeneID:1235385"
                     /translation="MSVITTIPARRFSRFNAERWRATPGPFKVGAVILVAHALFAILG
                     VFWTPYGFAEMGAGLPLSGASWQHPMGLDQIGRDVFSRFMHGAHIVLMLSFAGTMLGM
                     VAGTTLGLLSGYIGGWFDEVTQRIVEAMISIPFLALALVMIIAAGPALAGKPVLIVFV
                     VGLVYAPRIVRIARAAAMDIATREYVAVAELRGEGTWSIVFREILPNAANVLLVEFSL
                     RLSYAPILIGALGFLGFGIRPPTPEWGLMISENRNLLIASPVTVFGPGLGLASLVIGF
                     NLFTDGLSRMLGQRPVAGA"
     misc_feature    complement(164876..165736)
                     /locus_tag="SMa0299"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppC; COG1173"
                     /db_xref="CDD:224094"
     misc_feature    complement(164957..165475)
                     /locus_tag="SMa0299"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(164960..164965,164972..164977,
                     165005..165010,165050..165055,165062..165073,
                     165092..165094,165101..165106,165146..165148,
                     165197..165199,165206..165211,165221..165223,
                     165227..165232,165239..165241,165245..165247,
                     165251..165256,165317..165319,165323..165328,
                     165335..165364,165368..165379,165407..165409,
                     165422..165427,165434..165439))
                     /locus_tag="SMa0299"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(165056..165073,165317..165361))
                     /locus_tag="SMa0299"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(164975..164977,165005..165007,
                     165014..165016,165053..165055,165269..165271,
                     165317..165319))
                     /locus_tag="SMa0299"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(165125..165127,165137..165142,
                     165158..165196))
                     /locus_tag="SMa0299"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(165742..166695)
                     /locus_tag="SMa0300"
                     /db_xref="GeneID:1235386"
     CDS             complement(165742..166695)
                     /locus_tag="SMa0300"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; similar to genes in
                     Agrobacterium tumefaciens (ophB, S77573; accD, BAA87748;
                     agaB, AAB88467) that are present on the Ti plasmid"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435407.1"
                     /db_xref="GI:16262614"
                     /db_xref="GeneID:1235386"
                     /translation="MSVLRLLASRILFSVLTLLLVSVLIFLILEALPGDVATRILGRD
                     ATAKALELLRSQLDLDQPALVRYFQWLGDFLRGDLGVSIATGRPITDVLGPRIVNTLL
                     LSLFAFAIYLVLALVPAIIQATNRGKAVDNIISVITLVLLSLPDFLLATILLFLFAVA
                     VPILPALATISEASTWQETLRAMVLPAVTLAIMMAVYAIRVLRDSLIEVLRSDYVRLA
                     ELKGLRPTAVLFRHALPNAIVPALNVTALNFGFLIGGVVIVERVFSYPGFGTLLIDAL
                     QLRDIPLIKATVMISAVVYVAANLVADVLAVLLQPRLRTSR"
     misc_feature    complement(165745..166686)
                     /locus_tag="SMa0300"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    complement(165805..166407)
                     /locus_tag="SMa0300"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(165811..165816,165823..165828,
                     165832..165837,165844..165849,165877..165882,
                     165913..165918,165925..165936,165955..165957,
                     165964..165969,166009..166011,166060..166062,
                     166069..166074,166084..166086,166090..166095,
                     166102..166104,166108..166110,166114..166119,
                     166234..166236,166240..166245,166252..166281,
                     166285..166296,166324..166326,166342..166347,
                     166354..166359))
                     /locus_tag="SMa0300"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(165919..165936,166234..166278))
                     /locus_tag="SMa0300"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(165847..165849,165877..165879,
                     165886..165888,165916..165918,166132..166134,
                     166234..166236))
                     /locus_tag="SMa0300"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(165988..165990,166000..166005,
                     166021..166059))
                     /locus_tag="SMa0300"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(166692..167360)
                     /locus_tag="SMa0301"
                     /db_xref="GeneID:1235387"
     CDS             complement(166692..167360)
                     /locus_tag="SMa0301"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435408.1"
                     /db_xref="GI:16262615"
                     /db_xref="GeneID:1235387"
                     /translation="MTVFALTTFLNSFADALDRDARTVSRSHAARLRRLADQLPPMND
                     VPQGRVPIQAACEAELAAHDQSAIARALATLLPFVHITRSKSYLANPPSSDFGENYGY
                     GVICGPSSGPPALIKDPDIALGLMFLGPKTHYPLHHHPADELYYTVTGPSFWRAGEAD
                     WTRRGIDEIIHHPPWLPHATLSAEGPLVLLYIWEGDLETDAAFIPDTVTADAALSSMG
                     LDAT"
     misc_feature    complement(166773..>166985)
                     /locus_tag="SMa0301"
                     /note="Cupin domain; Region: Cupin_2; cl17218"
                     /db_xref="CDD:266563"
     gene            complement(167430..168956)
                     /locus_tag="SMa0302"
                     /db_xref="GeneID:1235388"
     CDS             complement(167430..168956)
                     /locus_tag="SMa0302"
                     /note="glimmer prediction; bacterial extracellular
                     solute-binding protein, family 5, PF00496; similar to S.
                     meliloti ORF23 (CAB01955)"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435409.1"
                     /db_xref="GI:16262616"
                     /db_xref="GeneID:1235388"
                     /translation="MKRHLLKGTALAVTMAACSFGATVAFAQEGCVRVLGYESDGEKQ
                     TMDPAALIGTDSVYHIRAVYEPLVDRSNTMQPVPALAESWESNADATEWTFHLRKGVK
                     FHDGSDFDAKDVVYSYRRLLDPAVSPGGFSTLAFLDADGITAIDDHTVRFKVKEPVVE
                     LPMLIATKYALMVPEGAKSEDLRVKGNGTGPFMQETFTINGAVRVMRRNPTYWRAGLP
                     KSECLEITTSLEPTSRLSALLSGTVDLSLTVDPASLITLKDNPAVELAATPGATSLYI
                     AVWTDTPPFDSVKVREAMKLVMDRQKILDTVLLGYGEVGADTPIPPSSPFGLGTPAKT
                     ADIEKATALLAEAGHPDGIDFDLYTSDSYPGMMLLAQVYAQMAAPAGIRVNVITSPAE
                     GYWDTIWLKKPAVISYTSARPPAEALTLSLNSKSEWNETHWTRDDFDALVVKAGQTAD
                     EKQRNDLYRDAQRIVADEGGMILPVFSSVVAGLRKGCSGYEPNVDVNRIDYAELTCAD
                     "
     misc_feature    complement(167472..168956)
                     /locus_tag="SMa0302"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    complement(167487..168878)
                     /locus_tag="SMa0302"
                     /note="The substrate-binding component of an
                     uncharacterized ABC-type
                     nickel/dipeptide/oligopeptide-like import system contains
                     the type 2 periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like_17; cd08503"
                     /db_xref="CDD:173868"
     gene            169064..169942
                     /locus_tag="SMa0303"
                     /db_xref="GeneID:1235389"
     CDS             169064..169942
                     /locus_tag="SMa0303"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory
                     helix-turn-helix protein, LysR family, PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435410.1"
                     /db_xref="GI:16262617"
                     /db_xref="GeneID:1235389"
                     /translation="MVRRNLPPLTTLRAFEAAARLMSFKAAAEELRVTQSAVSHQVAS
                     LERNLGTPLFVRLPGRVELSQEGTVYFPVVQDALDKIALTTDLIRKTNTSASLTVQVY
                     VTVAVRWLIPRLQAFKEASPEIAVNLDASLLDWEFNPDRADVGFIYTRAPNRPNLTYT
                     LLRRERLVGVCSPAIARAIKTAEDLRHFSFLSVSGTTDDAETWAASVGVAGLSQKSSP
                     LFDSNLLAIEAAANGQGVVVVPQFLVEGDIANGNLVAPLASDVMQPGGWYLVHLQRRG
                     NEKAIRKFLQWIQSQT"
     misc_feature    169064..169936
                     /locus_tag="SMa0303"
                     /note="DNA-binding transcriptional activator GcvA;
                     Provisional; Region: PRK11139"
                     /db_xref="CDD:182990"
     misc_feature    169088..169264
                     /locus_tag="SMa0303"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    169352..169927
                     /locus_tag="SMa0303"
                     /note="The C-terminal substrate domain of LysR-type GcdR,
                     TrPI, HvR and beta-lactamase regulators, and that of other
                     closely related homologs; contains the type 2 periplasmic
                     binding fold; Region: PBP2_GcdR_TrpI_HvrB_AmpR_like;
                     cd08432"
                     /db_xref="CDD:176123"
     misc_feature    order(169352..169372,169376..169429,169433..169453)
                     /locus_tag="SMa0303"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176123"
     misc_feature    order(169367..169372,169376..169378,169724..169732,
                     169790..169792)
                     /locus_tag="SMa0303"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176123"
     gene            complement(170035..171675)
                     /locus_tag="SMa0306"
                     /db_xref="GeneID:1235390"
     CDS             complement(170035..171675)
                     /locus_tag="SMa0306"
                     /EC_number="4.3.1.3"
                     /function="Small molecule metabolism; Amino acid
                     biosynthesis; histidine"
                     /note="glimmer prediction; phenylalanine and histidine
                     ammonia-lyase, PF00221"
                     /codon_start=1
                     /transl_table=11
                     /product="histidine ammonia-lyase"
                     /protein_id="NP_435411.1"
                     /db_xref="GI:16262618"
                     /db_xref="GeneID:1235390"
                     /translation="MRIDSLFHSVVGACLLFSSPVMADVLLNGRNATPEMIVRVAKGE
                     AVTVDGESLDKVERAYAVLLQGAKEGQEIYGLTVGVGWNKDRKMVDATGELTPELMEA
                     SREFNEGLLRAHSVGVGPDAAVPVVRAAMAVRLNNILTGGPGVQPHVAEMLLAFLNKG
                     ITPTMPSRGSVGQADMTLLSHIGLAMLGEGDVDYQGRRMSAAEALKAAGIEPLKPFGK
                     DGLAILSSNAYAAGLAALAIHDAEQLLSTSRLVYALSLEGLNGNVSPLLEDVAALRPF
                     PSHLSSTTELRALLEGSYLWQADDKRILQDPLSFRTAPYLLGSFADSLARTKALVQIQ
                     INSSDDNPGIVVGVEPKSDLFQARRGYVEGGAVLPTANFEPLPWIIAFEELGIVLAHH
                     TTASSERVLKLNNPTHTKLARYLGTENTHHAFLVVEAPLMALATENRALAQPTSFDSR
                     PIAGGVEDVGTNAPLVVERIRAQIDNSFTILSMEMLHAAQAADLRLKGHPERKLSTAT
                     TSFHDAFRQRVPFLDRDRSMTPDIAAGTAFLKEYALTN"
     misc_feature    complement(170104..171603)
                     /locus_tag="SMa0306"
                     /note="Aromatic amino acid lyase; Region: Lyase_aromatic;
                     pfam00221"
                     /db_xref="CDD:249692"
     misc_feature    complement(170191..171588)
                     /locus_tag="SMa0306"
                     /note="Phenylalanine ammonia-lyase (PAL) and histidine
                     ammonia-lyase (HAL); Region: PAL-HAL; cd00332"
                     /db_xref="CDD:176460"
     misc_feature    complement(order(170569..170571,170653..170655,
                     170743..170745,170752..170754,171001..171003,
                     171013..171027,171346..171348,171355..171357,
                     171436..171438,171442..171444,171448..171456))
                     /locus_tag="SMa0306"
                     /note="active sites [active]"
                     /db_xref="CDD:176460"
     misc_feature    complement(order(170248..170253,170260..170262,
                     170269..170274,170290..170292,170299..170319,
                     170350..170361,170365..170382,170386..170388,
                     170392..170403,170407..170412,170416..170421,
                     170452..170454,170461..170463,170470..170472,
                     170482..170484,170494..170496,170503..170505,
                     170524..170526,170536..170538,170545..170550,
                     170554..170574,170578..170580,170641..170649,
                     170662..170667,170674..170679,170686..170691,
                     170698..170700,170707..170712,170728..170733,
                     170740..170745,170749..170757,170761..170763,
                     170839..170841,170848..170850,170854..170859,
                     170866..170871,171124..171126,171133..171135,
                     171169..171174,171256..171258,171319..171342,
                     171349..171351,171436..171441))
                     /locus_tag="SMa0306"
                     /note="tetramer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176460"
     STS             170629..171274
                     /standard_name="D10Bir17"
                     /db_xref="UniSTS:141482"
     gene            complement(172016..173002)
                     /locus_tag="SMa0307"
                     /db_xref="GeneID:1235391"
     CDS             complement(172016..173002)
                     /locus_tag="SMa0307"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; N-terminus contains bacterial
                     reg"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435412.1"
                     /db_xref="GI:16262619"
                     /db_xref="GeneID:1235391"
                     /translation="MSRSAIKSISIMQVIDHFNLRSFDLNLLVAFDAMMEEMSVTRAA
                     QRLKIQQPAMSHNISTLRTLFQDELFIRVGQVMKPTARALNLSGPVRQALRQAQAAVL
                     MADVFDPATEQRTFRLGLSSEVELLLLPDLTARLRDIAPGIRILARGGDAAEVDAMLD
                     AGVIDLSVGCSYLPDSRHHCEPLYQSSVLCCFNPQLLEISNPVSLDAYMAAQHAVISQ
                     TDSLHGCVKDALEHAGAELEVVAAAPDFMSILATARSSAVIATVSSRIAARYGPLLGL
                     QVSPVPLALSFPPVAMVWPLHMDSDLGCAWLRQQIREAMLRTTETNVADIAA"
     misc_feature    complement(172070..172948)
                     /locus_tag="SMa0307"
                     /note="leucine transcriptional activator; Reviewed;
                     Region: leuO; PRK09508"
                     /db_xref="CDD:181918"
     misc_feature    complement(172754..172930)
                     /locus_tag="SMa0307"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(172061..172660)
                     /locus_tag="SMa0307"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     similar to DntR, which is involved in the catabolism of
                     dinitrotoluene; contains the type 2 periplasmic binding
                     fold; Region: PBP2_DntR_like_2; cd08464"
                     /db_xref="CDD:176153"
     misc_feature    complement(order(172133..172135,172334..172336,
                     172445..172447,172619..172621,172631..172636,
                     172640..172642))
                     /locus_tag="SMa0307"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176153"
     misc_feature    complement(order(172196..172198,172238..172240,
                     172247..172252,172259..172264,172271..172285,
                     172367..172369,172556..172558,172562..172576,
                     172580..172585,172592..172597,172601..172606,
                     172613..172618,172625..172630,172637..172639))
                     /locus_tag="SMa0307"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176153"
     gene            173063..174022
                     /locus_tag="SMa0308"
                     /db_xref="GeneID:1235392"
     CDS             173063..174022
                     /locus_tag="SMa0308"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435413.1"
                     /db_xref="GI:16262620"
                     /db_xref="GeneID:1235392"
                     /translation="MPSRRSILKSALTGLIVAPFVAPSVTFAKAPFAVVQAPGYYRLK
                     IGSVEVTALSDGTVALPLAKLYTNTSEHDAQNALKDAFLPDMVPTSVNAFLVNTGERL
                     VLIDAGTGGYLGASLGKLVSNIEASGYKVGDIDDVILTHIHTDHSGGLMSNGKRTFPN
                     ATLRVNEREAKFWLSSANAMTATGTVKQHFGEADQCVTPYVKAGKFETFADNAAPVPG
                     LGSILYAGHTPGHSAITLESESQKIVFWGDITHGDILQFDEPGVAIEFDIDQKAAVAA
                     RNTAFKQAVEGKYLVAGAHIAFPGIGHVREDSKNYDWLPINYA"
     misc_feature    173336..173947
                     /locus_tag="SMa0308"
                     /note="Metallo-beta-lactamase superfamily; Region:
                     Lactamase_B; smart00849"
                     /db_xref="CDD:214854"
     gene            complement(174273..175004)
                     /locus_tag="SMa0310"
                     /db_xref="GeneID:1235393"
     CDS             complement(174273..175004)
                     /locus_tag="SMa0310"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory
                     helix-turn-helix protein, LysR family, PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435414.1"
                     /db_xref="GI:16262621"
                     /db_xref="GeneID:1235393"
                     /translation="MRLTEAGNRLHETLSQPMAEVRSAFENVAGDARPSGLLRIAVTS
                     IAEQFLSGPLIASFAETHPGITIDVTVTDDVFDIVAAGFDAGVRLGEVIEQDMVAVPL
                     TKEEREVVVATPRYFELHGTPRHPRELVRHRCVGWRPSPSAAPYRWEFEEDGIPFDVA
                     VEPQITTNDLHLMIRTALAGGGITFALEETFRPYIVRGELITALDDYLPPFPGFFLYF
                     PNRRNMAPKLRALIDHVRAYRPTPS"
     misc_feature    complement(174291..175004)
                     /locus_tag="SMa0310"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(174300..174905)
                     /locus_tag="SMa0310"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_5; cd08474"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(174363..174365,174444..174446,
                     174495..174497,174687..174689,174696..174698,
                     174738..174740,174855..174857,174867..174869))
                     /locus_tag="SMa0310"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(174468..174470,174477..174482,
                     174501..174515,174606..174608,174792..174812,
                     174816..174818,174828..174830,174837..174842,
                     174846..174851,174861..174866))
                     /locus_tag="SMa0310"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176163"
     gene            175343..175876
                     /locus_tag="SMa0312"
                     /db_xref="GeneID:1235394"
     CDS             175343..175876
                     /locus_tag="SMa0312"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435415.1"
                     /db_xref="GI:16262622"
                     /db_xref="GeneID:1235394"
                     /translation="MAFGICAAPVAAQDSSCPREGADAPLALHADWIMKGWERHEGDG
                     KFEFSQKLNRYYDLENTKGVFYDNFAPGSTQLFDNSARYGANWEALQNAARSVRHGLT
                     GGHDVIVSDTVASTTLGFVGRIDRLDGAVVAFDGRSQLGWTCTGGEWKIRHELNYAWV
                     VEPETIQSFLGKTEPAQ"
     gene            175873..176124
                     /locus_tag="SMa0314"
                     /db_xref="GeneID:1235395"
     CDS             175873..176124
                     /locus_tag="SMa0314"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435416.1"
                     /db_xref="GI:16262623"
                     /db_xref="GeneID:1235395"
                     /translation="MTSQTLSHPYVGMWETTDGRIRHQLLPNGRYDEARGSRESAYRG
                     RYEVSGNHIEYWDDTGFTADGDFVDDVLHHAGMVLYRKQ"
     misc_feature    175894..176118
                     /locus_tag="SMa0314"
                     /note="Agrobacterium tumefaciens protein Atu4866; Region:
                     Atu4866; pfam11512"
                     /db_xref="CDD:151949"
     gene            176207..177469
                     /locus_tag="SMa0316"
                     /db_xref="GeneID:1235396"
     CDS             176207..177469
                     /locus_tag="SMa0316"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435417.1"
                     /db_xref="GI:16262624"
                     /db_xref="GeneID:1235396"
                     /translation="MTMTHIEQQLENLASPGDRQKHLRGLAVLKQIGGENFGGPVSQL
                     ASFSEDLARFTIQYPYGDVLSRDGLDLRTRQILTAATLLAHGSAQSQLSFHLYGLLNA
                     GGTRADVVDLLFISAGLLGFPTAINAVPIVRDILADRDETKNVAGAQTSPAVPDMPSD
                     RFAVLDRIAPDFVNWREHTLGEEIFGAVHLEPRLAHLASAAMLAARGKVGASFDAHIV
                     SALAAGATDSDIVEMVIQLSVYSGFPAALNAAGRARNVLAAPERPQASTQKGVDTTKD
                     DEKRFMRGVATLAETSGGSGADVVDSFKDVAPGLGRLIVAHCYGDIFCRPALDPKVRE
                     LGAISALAAQGTVAAEKPLGVHIDAALNLGATPEEIVETLFNIIPYAGYPLIEKALLI
                     AHDRISLFDEKQVDGSPSDHRTLDMCSG"
     misc_feature    176261..176626
                     /locus_tag="SMa0316"
                     /note="Carboxymuconolactone decarboxylase family; Region:
                     CMD; cl00460"
                     /db_xref="CDD:260437"
     misc_feature    176684..176983
                     /locus_tag="SMa0316"
                     /note="Uncharacterized homolog of
                     gamma-carboxymuconolactone decarboxylase subunit [Function
                     unknown]; Region: COG0599"
                     /db_xref="CDD:223672"
     misc_feature    177098..177418
                     /locus_tag="SMa0316"
                     /note="Uncharacterized homolog of
                     gamma-carboxymuconolactone decarboxylase subunit [Function
                     unknown]; Region: COG0599"
                     /db_xref="CDD:223672"
     gene            177973..178974
                     /locus_tag="SMa0319"
                     /db_xref="GeneID:1235397"
     CDS             177973..178974
                     /locus_tag="SMa0319"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory
                     helix-turn-helix protein, AraC family, PF00165"
                     /codon_start=1
                     /transl_table=11
                     /product="AraC family transcriptional regulator"
                     /protein_id="NP_435418.1"
                     /db_xref="GI:16262625"
                     /db_xref="GeneID:1235397"
                     /translation="MANIEASRQNVSPPIPAVAGNPIYPAVLVPELNEVIARPDRTSP
                     LGLEQYIAGRTLVSGDTPAWSDMFVQVYSRLNKQEPFLVPAVAEPLIVWVMSGEAVVE
                     ERDLDGDWVANTVTVGDFFLTRSPTPYEMRWRSVDAAPFQVMHLYLSVPLFERVAYDV
                     LGCAAPPALRDISGGRDTQLSHLLALVHQELTAEGKGSQLFIQGLAQSLAVHLIRNYA
                     ANEADDRQNALTGFKLRRAVAHLEEHLAEPFNLAQLAETVGMSEFHFSRLFKKATGLS
                     PSRYFIRQRVARAQLLLQETDTSIIEIGMSVGYSSPSHFAQVFRRETGLPPSHYRRG"
     misc_feature    178213..178629
                     /locus_tag="SMa0319"
                     /note="Cupin; Region: Cupin_6; pfam12852"
                     /db_xref="CDD:257350"
     misc_feature    178609..178968
                     /locus_tag="SMa0319"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    178693..178812
                     /locus_tag="SMa0319"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    178855..178968
                     /locus_tag="SMa0319"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            179119..179868
                     /locus_tag="SMa0320"
                     /db_xref="GeneID:1235398"
     CDS             179119..179868
                     /locus_tag="SMa0320"
                     /note="glimmer prediction; short chain  motif, PF00106"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain alcohol dehydrogenase-related
                     dehydrogenase"
                     /protein_id="NP_435419.1"
                     /db_xref="GI:16262626"
                     /db_xref="GeneID:1235398"
                     /translation="MTSLNGKIALVTGASSGIGAATAAKLAEAGAKVGIAARRTDKLE
                     DLKKKIEAKGGEALVIEMDVVDTTSVEAGVKKLVDAYGSIDILVNNAGLMPLSDIDQF
                     KVDEWQRMVDVNVKGLLNTTAAVLPQMIKQHSGHVFNMSSIAGRKVFKGLSVYCATKH
                     AVTAFSDGLRMEVGQKHGIRVTCIQPGAVATELYDHITDPGYRQQMDELATQMTFLQG
                     EDIGDTIVFAAQAPAHVDVAELFVLPVEQGW"
     misc_feature    179119..179865
                     /locus_tag="SMa0320"
                     /note="Short-chain alcohol dehydrogenase of unknown
                     specificity [General function prediction only]; Region:
                     COG4221"
                     /db_xref="CDD:226674"
     misc_feature    179128..179859
                     /locus_tag="SMa0320"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(179155..179157,179161..179166,179170..179172,
                     179227..179235,179386..179394,179536..179544,
                     179581..179583,179593..179595,179674..179685)
                     /locus_tag="SMa0320"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(179458..179460,179542..179544,179581..179583,
                     179593..179595)
                     /locus_tag="SMa0320"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            179926..180474
                     /locus_tag="SMa0322"
                     /db_xref="GeneID:1235399"
     CDS             179926..180474
                     /locus_tag="SMa0322"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435420.1"
                     /db_xref="GI:16262627"
                     /db_xref="GeneID:1235399"
                     /translation="MKELPASQAYRVLEPGPIVMVSTSDNGKPNVMTMGFHTMIQHDP
                     PLIGCVIGPWDHSYQALRKTGECVIAVPGLDLAETVVDVGNCSGDRVDKLQRYGLMTQ
                     PARDVSAPLLRDCLANIECRVVDTRLLDPYNLFILEATRIWINENRKERRMMHHRGDG
                     TFTVDGGTLDLKDRMVRWRHLP"
     misc_feature    179968..180429
                     /locus_tag="SMa0322"
                     /note="Conserved protein/domain typically associated with
                     flavoprotein oxygenases, DIM6/NTAB family [General
                     function prediction only]; Region: COG1853"
                     /db_xref="CDD:224766"
     gene            180525..180809
                     /locus_tag="SMa0323"
                     /db_xref="GeneID:1235400"
     CDS             180525..180809
                     /locus_tag="SMa0323"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; similar to Smc00411 of S.
                     meliloti chromosome"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435421.1"
                     /db_xref="GI:16262628"
                     /db_xref="GeneID:1235400"
                     /translation="MSAYLIVDLDIHDMKSIEDYRSKALPLVAKAGGKLIAIDESPLE
                     LEGWIATNMLIIEFPDKDAIRQLFASPEYAPLAAQRQAAAASRIIAINGV"
     misc_feature    180525..180752
                     /locus_tag="SMa0323"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5470"
                     /db_xref="CDD:227757"
     gene            180910..181212
                     /locus_tag="SMa0325"
                     /db_xref="GeneID:1235401"
     CDS             180910..181212
                     /locus_tag="SMa0325"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435422.1"
                     /db_xref="GI:16262629"
                     /db_xref="GeneID:1235401"
                     /translation="MADLTNVAYFTAKPGRSGELGDELLQLVTPSRNEEGCLRYEIHQ
                     SNDVPDVWMVLEDWRHASDFKLHMNTPYVQAFMAKVPDLCVEDVEICGYQQRSPQV"
     misc_feature    180910..181209
                     /locus_tag="SMa0325"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            181233..182072
                     /locus_tag="SMa0326"
                     /db_xref="GeneID:1235402"
     CDS             181233..182072
                     /locus_tag="SMa0326"
                     /note="glimmer prediction; short chain  motif, PF00106"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain alcohol dehydrogenase-related
                     dehydrogenase"
                     /protein_id="NP_435423.1"
                     /db_xref="GI:16262630"
                     /db_xref="GeneID:1235402"
                     /translation="MSTQNPKVWLVTGCSTGFGRYIAEHLLEVGEKVVVTARKADKIA
                     DLEQKGDALILPLDVIDRDQCQKVVDAAEAHFGRIDVLINNAGIGFFGAIEETDESNA
                     RRLFDVNFFGTANTIHSVLPHMRARRSGTIVNLTSIGGLVGYTGVGYYCATKFAVEGL
                     SDTLRNEVAPLGINVMTVEPSAFRTEWAGSSNEVSASIEDYEATAGEARRAYHTSVGK
                     QAGDPARAAKAIREAVLAQQPPHHLPLGNDAADAALKKAEDLKANVLAWEALSRSADF
                     PAN"
     misc_feature    181245..182060
                     /locus_tag="SMa0326"
                     /note="short chain dehydrogenase; Provisional; Region:
                     PRK06180"
                     /db_xref="CDD:180446"
     misc_feature    181251..181970
                     /locus_tag="SMa0326"
                     /note="17beta hydroxysteroid dehydrogenase-like, classical
                     (c) SDRs; Region: 17beta-HSD-like_SDR_c; cd05374"
                     /db_xref="CDD:187632"
     misc_feature    order(181269..181271,181275..181286,181344..181346,
                     181401..181409,181485..181496,181554..181556,
                     181635..181643,181680..181682,181692..181694,
                     181779..181781,181785..181793)
                     /locus_tag="SMa0326"
                     /note="NADP binding site [chemical binding]; other site"
                     /db_xref="CDD:187632"
     misc_feature    order(181557..181559,181641..181643,181680..181682,
                     181692..181694)
                     /locus_tag="SMa0326"
                     /note="active site"
                     /db_xref="CDD:187632"
     misc_feature    order(181641..181649,181662..181664,181680..181682,
                     181773..181778,181794..181796,181833..181835,
                     181842..181844)
                     /locus_tag="SMa0326"
                     /note="steroid binding site; other site"
                     /db_xref="CDD:187632"
     gene            182145..182906
                     /locus_tag="SMa0329"
                     /db_xref="GeneID:1235403"
     CDS             182145..182906
                     /locus_tag="SMa0329"
                     /note="glimmer prediction; N-terminus motif - short chain
                     dehydrogenase, PF00106; C-terminus motif - short chain
                     dehydrogenase/reductase C-terminus, PF00678"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain alcohol dehydrogenase-related
                     dehydrogenase"
                     /protein_id="NP_435424.1"
                     /db_xref="GI:16262631"
                     /db_xref="GeneID:1235403"
                     /translation="MSKRFDGKVAIVTGGGSGIGAAIANRLLEEGASVMMSGRTEKRL
                     SDVASKMPADRSGIFVANVSSRPDCDALVAATVERFGRIDTVVNAAGMNFVGTIQETS
                     DQDWDECIASDLSGVFYMSRAAVPHLKETKGSIVNIGSVSSLGGGWSHAAYNAAKGGV
                     ANLTRSAACDLGKFGVRANTVAPGLTVTGMVEAIMDDDALLEKAWDRIPLRRAGQPAS
                     AVAFLASDEAAWITGIVLPVDGGQTCTDGGPEWGK"
     misc_feature    182151..182870
                     /locus_tag="SMa0329"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    182220..182861
                     /locus_tag="SMa0329"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(182256..182264,182325..182333,182409..182417,
                     182478..182480,182556..182564,182601..182603,
                     182613..182615,182691..182702,182706..182711)
                     /locus_tag="SMa0329"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(182481..182483,182562..182564,182601..182603,
                     182613..182615)
                     /locus_tag="SMa0329"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(182962..183186)
                     /locus_tag="SMa5017"
                     /db_xref="GeneID:6435255"
     CDS             complement(182962..183186)
                     /locus_tag="SMa5017"
                     /note="Predicted membrane protein; Has similarity to the
                     carboxy-terminal half of DoxX family proteins; Together
                     with the adjacent gene, SMa0333, may comprise a
                     pseudogene"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000333.1"
                     /db_xref="GI:193782559"
                     /db_xref="GeneID:6435255"
                     /translation="MTEIVGSIALILGFQTRIVALILALFSVATALTFHNNLSDLNQF
                     IHFFKNIAMAGGLLQVVAFGAGRYSLDARR"
     misc_feature    complement(182965..>183183)
                     /locus_tag="SMa5017"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            complement(183183..183395)
                     /locus_tag="SMa0333"
                     /db_xref="GeneID:1235404"
     CDS             complement(183183..183395)
                     /locus_tag="SMa0333"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435425.1"
                     /db_xref="GI:16262632"
                     /db_xref="GeneID:1235404"
                     /translation="MSYSDTIAQRVETLSHSALINGVAPLAGRVLLAAIFLLSGISKI
                     SDPAGTIGYINMVGLPFPPLSYGAPY"
     misc_feature    complement(<183204..183326)
                     /locus_tag="SMa0333"
                     /note="DoxX; Region: DoxX; pfam07681"
                     /db_xref="CDD:254354"
     gene            complement(183576..184352)
                     /gene="fabG"
                     /locus_tag="SMa0335"
                     /db_xref="GeneID:1235405"
     CDS             complement(183576..184352)
                     /gene="fabG"
                     /locus_tag="SMa0335"
                     /note="Catalyzes the first of the two reduction steps in
                     the elongation cycle of fatty acid synthesis"
                     /codon_start=1
                     /transl_table=11
                     /product="3-ketoacyl-ACP reductase"
                     /protein_id="NP_435426.1"
                     /db_xref="GI:16262633"
                     /db_xref="GeneID:1235405"
                     /translation="MSTSNILDGKVVIVTGASSGIGRAIAIRAAEHGAKAVIVSDVVE
                     APREGGEPTASEIRKLGAESVFVKADVSRKVDNDALVAAAEEFGGVDVMVANAGITLK
                     TDGAEVPEDDYRRLMSVNLDGPLFGAQAAARQMKALNKQGSIVLMASMGGISGAGITV
                     AYSTSKGGVVLMAKSLADALGPDGIRVNAVAPGTIDTELLRTSPGIAQASEGFRQRTP
                     LRRLGKPAEVGDAVAFLGSDLSSYVSGTALLVDGGLLAVI"
     misc_feature    complement(183582..184334)
                     /gene="fabG"
                     /locus_tag="SMa0335"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Provisional; Region: fabG; PRK07231"
                     /db_xref="CDD:235975"
     misc_feature    complement(183591..184334)
                     /gene="fabG"
                     /locus_tag="SMa0335"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    complement(order(183768..183779,183855..183857,
                     183867..183869,183906..183914,184059..184067,
                     184233..184238,184290..184292,184296..184301,
                     184305..184307))
                     /gene="fabG"
                     /locus_tag="SMa0335"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    complement(order(183855..183857,183867..183869,
                     183906..183908,183993..183995))
                     /gene="fabG"
                     /locus_tag="SMa0335"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            complement(184339..184821)
                     /locus_tag="SMa0337"
                     /db_xref="GeneID:1235406"
     CDS             complement(184339..184821)
                     /locus_tag="SMa0337"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435427.1"
                     /db_xref="GI:16262634"
                     /db_xref="GeneID:1235406"
                     /translation="MSDHHEASYEALKAVVRRNTLEVQSGGNFELFDELFADDFLDHT
                     PQPGGTPDKEGARRLYHALREAFPDFHAEIHWQAVDGDIVTTFKTYHGTHQGVVLGSR
                     QRAARSSSKPSTPCAFATARSSNTGGSPTSTIFCSNSTRCPPRPPKCRNIKDHHDEHQ
                     "
     misc_feature    complement(<184519..184782)
                     /locus_tag="SMa0337"
                     /note="Nuclear transport factor 2 (NTF2-like) superfamily.
                     This family includes members of the NTF2 family,
                     Delta-5-3-ketosteroid isomerases, Scytalone Dehydratases,
                     and the beta subunit of Ring hydroxylating dioxygenases.
                     This family is a classic example of...; Region: NTF2_like;
                     cl09109"
                     /db_xref="CDD:263720"
     gene            complement(184847..185620)
                     /locus_tag="SMa0339"
                     /db_xref="GeneID:1235407"
     CDS             complement(184847..185620)
                     /locus_tag="SMa0339"
                     /note="glimmer prediction; N-terminus motif - short chain
                     de"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain alcohol dehydrogenase-related
                     dehydrogenase"
                     /protein_id="NP_435428.1"
                     /db_xref="GI:16262635"
                     /db_xref="GeneID:1235407"
                     /translation="MSSLFSNKVVTVTGAGSGIGRAIALGLARDGATVHLADRDADGL
                     TQTAELIRAEDGRAFTTELDVASELQVVGWIEQIGSTSGRLDAAFNNAGITGPAKRIE
                     DYPLEDFQRVIAVNLQSVFLGMKYQIPLIKRNGGGSIVNTASIAALTGPGGMSAYAAS
                     KHGVQGLTRVVAMENAAHGIRVNAIAPGWTETPMVAANSQQNPAFAALAQNAIPAKRG
                     GKPEEIAAAAIWLASDAASYVTGHMLTVDGGMTIGGFEL"
     misc_feature    complement(184871..185614)
                     /locus_tag="SMa0339"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    complement(184880..185587)
                     /locus_tag="SMa0339"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(185042..185047,185051..185062,
                     185138..185140,185150..185152,185189..185197,
                     185276..185278,185342..185350,185426..185434,
                     185501..185509,185564..185575,185579..185581))
                     /locus_tag="SMa0339"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    complement(order(185138..185140,185150..185152,
                     185189..185191,185273..185275))
                     /locus_tag="SMa0339"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            complement(185692..186300)
                     /gene="wrbA2"
                     /locus_tag="SMa0340"
                     /db_xref="GeneID:1235408"
     CDS             complement(185692..186300)
                     /gene="wrbA2"
                     /locus_tag="SMa0340"
                     /function="Miscellaneous; Not classified regulator"
                     /note="stationary phase that binds TrpR repressor"
                     /codon_start=1
                     /transl_table=11
                     /product="TrpR binding protein WrbA"
                     /protein_id="NP_435429.1"
                     /db_xref="GI:16262636"
                     /db_xref="GeneID:1235408"
                     /translation="MTRVLVLYYSSYGHIETMAGAVAEGARSTGAEVTIKRVPETVPI
                     EVADKAHFKLNQAAPVATVAELADYDAIIVGTGTRFGRMSSQMAVFLDQAGGLWARGA
                     LNGKVGGAFVSTGTQHGGQETTLFSIITNLMHFGMVIVGLPYSHQGQMSVDEIVGGAP
                     YGATTVAGGDGSRQPSQIDLAGAFHQGEIVARTAAALVAARN"
     misc_feature    complement(185737..186300)
                     /gene="wrbA2"
                     /locus_tag="SMa0340"
                     /note="NAD(P)H:quinone oxidoreductase; Provisional;
                     Region: PRK03767"
                     /db_xref="CDD:179647"
     gene            186524..186718
                     /locus_tag="SMa0341"
                     /db_xref="GeneID:1235409"
     CDS             186524..186718
                     /locus_tag="SMa0341"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435430.1"
                     /db_xref="GI:16262637"
                     /db_xref="GeneID:1235409"
                     /translation="MAKGLLGGGEMKFYPQDALTQAGGRFSQSDAPFSAHVVTDRELI
                     TGQNPASAPAVAQELLKRLK"
     misc_feature    <186524..186715
                     /locus_tag="SMa0341"
                     /note="Putative intracellular protease/amidase [General
                     function prediction only]; Region: ThiJ; COG0693"
                     /db_xref="CDD:223765"
     misc_feature    <186545..186712
                     /locus_tag="SMa0341"
                     /note="Type 1 glutamine amidotransferase (GATase1)-like
                     domain; Region: GAT_1; cl00020"
                     /db_xref="CDD:260141"
     gene            complement(186903..187337)
                     /locus_tag="SMa0343"
                     /db_xref="GeneID:1235410"
     CDS             complement(186903..187337)
                     /locus_tag="SMa0343"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435431.1"
                     /db_xref="GI:16262638"
                     /db_xref="GeneID:1235410"
                     /translation="MEKTPDTFVDLGRGTPAWFTFAARILPVGILGQLLSAGLALFRD
                     SSLWGLHAALGGALSFPAVSLVAGALFVSRLRGFGWWAGLTFLLYLLQVILAAGGMPL
                     LLSFHPVNGAFLLAASLVLLANVERRRSQSLAEDNATAKPGK"
     gene            complement(187341..187958)
                     /locus_tag="SMa0346"
                     /db_xref="GeneID:1235411"
     CDS             complement(187341..187958)
                     /locus_tag="SMa0346"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; similar to General stress
                     protein 14 (P80871) from Bacillus subtilis"
                     /codon_start=1
                     /transl_table=11
                     /product="NAD(P)H dehydrogenase"
                     /protein_id="NP_435432.1"
                     /db_xref="GI:16262639"
                     /db_xref="GeneID:1235411"
                     /translation="MRRNLLLVATQETTVTKTLILLFHPDLKRSKANAALAGAAAKLD
                     GVEVADMQAAYPDSMDMFRDGEREARRLLAADRIVLQFPIQWYSTPPLMKAWQDGVLT
                     RMFYVTYETEGRALEGTPLMLAATAGNVPESYRPGGRNMFTMEALLAPLRATAHRCGL
                     SCTAPFIIYQADKLEAEELEAAASNYAATLKNWIAGPLVTRQEAV"
     misc_feature    complement(187374..187910)
                     /locus_tag="SMa0346"
                     /note="Putative NADPH-quinone reductase (modulator of drug
                     activity B) [General function prediction only]; Region:
                     MdaB; COG2249"
                     /db_xref="CDD:225158"
     gene            188006..188893
                     /locus_tag="SMa0347"
                     /db_xref="GeneID:1235412"
     CDS             188006..188893
                     /locus_tag="SMa0347"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; N-terminus - bacterial
                     regulatory helix-turn-helix protein, LysR family, PF00126;
                     C-terminus - NodD transcription activator carboxy terminal
                     region, PF01046; start codon changed based on codon usage
                     and similarity."
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435433.1"
                     /db_xref="GI:16262640"
                     /db_xref="GeneID:1235412"
                     /translation="MNLRSLDLNLLVVLDALLDEAHVSRAADRLGLSQPAASAALQRC
                     RHLFRDELLERGRGTMRLTSRAEALRAPLKSLLASMMELIGPPEIPLTEIRQVLRITM
                     ADYPALFVIAQLQRELQPSAPGIDLVIQSWHGGDAARSALVDGTADLAVSVFTAPDDD
                     LHREELLTEHYVVVMRAGHPAAEAFDLNAWLSYPHILVSGRGDTTTPLDAELSRFGLS
                     RRVGLVVPNFQMVPSLLQDSDMIAMLPSRATPSGGSLVSFLPPIPVPGFQLHMAWHRR
                     RAKDAALQHVARILGALLR"
     misc_feature    188063..188890
                     /locus_tag="SMa0347"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    <188069..188206
                     /locus_tag="SMa0347"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    188294..188857
                     /locus_tag="SMa0347"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulators that involved in the
                     catabolism of nitroaromatic/naphthalene compounds and that
                     of related regulators; contains the type 2 periplasmic
                     binding fold; Region: PBP2_Nitroaromatics_like; cd08417"
                     /db_xref="CDD:176109"
     misc_feature    order(188312..188314,188318..188323,188333..188335,
                     188510..188512,188618..188620,188810..188812)
                     /locus_tag="SMa0347"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:176109"
     misc_feature    order(188315..188317,188324..188329,188336..188341,
                     188348..188353,188357..188362,188369..188374,
                     188378..188392,188396..188398,188585..188587,
                     188669..188683,188690..188695,188702..188707,
                     188714..188716)
                     /locus_tag="SMa0347"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176109"
     gene            complement(189202..189798)
                     /locus_tag="SMa0349"
                     /db_xref="GeneID:1235413"
     CDS             complement(189202..189798)
                     /locus_tag="SMa0349"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435434.1"
                     /db_xref="GI:16262641"
                     /db_xref="GeneID:1235413"
                     /translation="MTTYAIIGAGAIGSALAERFTAAQIPAIIANSRGPASLSSVTDR
                     FGASVKAVELKDALQADVVILAVPYDSIADIVTQVSDWGGQIVVDASNAIDFPAFKPR
                     DLGGRLSTEIVSELVPGAKVVKAFNTLPAAVLAADPDKGTGSRVLFLSGNHSDANRQV
                     AELISSLGFAPVDLGTLAASGPIQQFGRPLVALNLLKD"
     misc_feature    complement(189217..189798)
                     /locus_tag="SMa0349"
                     /note="Predicted dinucleotide-binding enzymes [General
                     function prediction only]; Region: COG2085"
                     /db_xref="CDD:224996"
     misc_feature    complement(189523..189792)
                     /locus_tag="SMa0349"
                     /note="NADP oxidoreductase coenzyme F420-dependent;
                     Region: F420_oxidored; pfam03807"
                     /db_xref="CDD:252177"
     gene            complement(189834..190730)
                     /locus_tag="SMa0352"
                     /db_xref="GeneID:1235414"
     CDS             complement(189834..190730)
                     /locus_tag="SMa0352"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; start codon changed based on
                     codon usage and homology. N-terminus is similar to
                     Pirin-protein (NP_003653) from humans"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435435.1"
                     /db_xref="GI:16262642"
                     /db_xref="GeneID:1235414"
                     /translation="MSHISTADIEQVILPSSRDLGGFSVRRALPAPMRQMVGPFIFLD
                     SFGPVRFGEGEGIDTRPHPHIGLSTLTYLLEGELTHRDSERYVQAIRPGEVNVMVAGA
                     GIVHSERTPEHQRATGGKLAGLQSWIALPKKSEETAPLFQHLDAGSLPTVSGEGIGMK
                     LLAGNLHGRQSPATVFSDLFAAEVHLEAGARYRIDGEHVERAIFVVAGALEIVGQDGN
                     FGQDRLLVFKPGSEIVVKATGPARFLAFGGEPLPEKRFIRWNFVATDQERIRHAADLW
                     RERGFPGVPDDDEFIPLPENFR"
     misc_feature    complement(189885..190706)
                     /locus_tag="SMa0352"
                     /note="Pirin-related protein [General function prediction
                     only]; Region: COG1741"
                     /db_xref="CDD:224655"
     misc_feature    complement(190347..190667)
                     /locus_tag="SMa0352"
                     /note="Pirin; Region: Pirin; pfam02678"
                     /db_xref="CDD:251469"
     misc_feature    complement(189885..190187)
                     /locus_tag="SMa0352"
                     /note="Pirin C-terminal cupin domain; Region: Pirin_C;
                     pfam05726"
                     /db_xref="CDD:253351"
     gene            190833..191747
                     /locus_tag="SMa0353"
                     /db_xref="GeneID:1235415"
     CDS             190833..191747
                     /locus_tag="SMa0353"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial helix-turn-helix
                     regulatory protein, LysR family, PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435436.1"
                     /db_xref="GI:16262643"
                     /db_xref="GeneID:1235415"
                     /translation="MSDPGQPTLDQLRVFIAVVETGSFAAAARKLNRATSVISYTIAN
                     LEAQLGVTLFDRLSTKKPQLTLEGRTVLAEARSVSNGIDNLRAKVKSMLRGIEPEVHL
                     ALDVMLPASRVMDALKAFRKEFPSVSLRLYVEALGAVTQIVLNRTATVGISGPLDVDV
                     LGLERIGVGFVQLVPVAAPDHPLAGGSHAPGAARSHIQLVLTDRSPLTQGHEFAVVGT
                     HTWRLADLGAKHMLLKEGIGWGNMPEPMVRDDLADGRLVQLDLPDCKGGPYRLQAIYR
                     TDTPPGPAGRFLIEHFQAQDAKTPTTAW"
     misc_feature    190851..191732
                     /locus_tag="SMa0353"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    190857..191039
                     /locus_tag="SMa0353"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    191112..191723
                     /locus_tag="SMa0353"
                     /note="LysR substrate binding domain; Region:
                     LysR_substrate; pfam03466"
                     /db_xref="CDD:251977"
     misc_feature    order(191172..191177,191181..191186,191193..191195,
                     191205..191207,191211..191231,191490..191507,
                     191523..191528,191532..191537)
                     /locus_tag="SMa0353"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            191922..192416
                     /locus_tag="SMa0355"
                     /db_xref="GeneID:1235416"
     CDS             191922..192416
                     /locus_tag="SMa0355"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory
                     helix-turn-helix protein, LysR family, PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435437.2"
                     /db_xref="GI:193782560"
                     /db_xref="GeneID:1235416"
                     /translation="MKGPGTPTFDQLKVFLTVVDVGSFAGAARKLNRATSVVSYTIAN
                     LEAQLGFALFDRDSTRRPCLTEAGRIVLSETRSVANGVNRLRAKAQGLLQGLEPSLSI
                     ALDAMLPASRVLDALKGFRSEFPTIPLQIRTEQFRALSMLVRQGDIVIRHEYGRRCNG
                     GPLA"
     misc_feature    191940..>192401
                     /locus_tag="SMa0355"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    191946..192128
                     /locus_tag="SMa0355"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    192201..>192383
                     /locus_tag="SMa0355"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     gene            complement(193272..193553)
                     /locus_tag="SMa0357"
                     /db_xref="GeneID:1235418"
     CDS             complement(193272..193553)
                     /locus_tag="SMa0357"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435439.1"
                     /db_xref="GI:16262646"
                     /db_xref="GeneID:1235418"
                     /translation="MVDARPVGDYPNLRQLAFLHVSHDWRGKKLALRLYQLCKDTVVG
                     SGAEGFYISSTPTRRTVEFYLRQGAKLMARPDTTLVSIEPDDIHLAHWF"
     misc_feature    complement(193275..>193553)
                     /locus_tag="SMa0357"
                     /note="Predicted acetyltransferase [General function
                     prediction only]; Region: COG3153"
                     /db_xref="CDD:225695"
     gene            complement(193562..193807)
                     /locus_tag="SMa0359"
                     /db_xref="GeneID:1235419"
     CDS             complement(193562..193807)
                     /locus_tag="SMa0359"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435440.1"
                     /db_xref="GI:16262647"
                     /db_xref="GeneID:1235419"
                     /translation="MTMGTIIRPLQRAEVELVWQIERREVVQEIYEVADGRLHLRPQF
                     YDTREWPDGEPEIYTPILFDCFDHDGVFLGALLEKNL"
     misc_feature    complement(<193565..193804)
                     /locus_tag="SMa0359"
                     /note="Predicted acetyltransferase [General function
                     prediction only]; Region: COG3153"
                     /db_xref="CDD:225695"
     gene            complement(193804..194493)
                     /locus_tag="SMa0360"
                     /db_xref="GeneID:1235420"
     CDS             complement(193804..194493)
                     /locus_tag="SMa0360"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_435441.2"
                     /db_xref="GI:193782561"
                     /db_xref="GeneID:1235420"
                     /translation="MSDPFPDEVDEALWDEACRRAEAVREFLKHRPGKMTAADVALLA
                     TEVETSRATAYRLIKLFRAGGTVMSLVDRKRGRPEGHRVLDDKREEIIRTTINRHYLT
                     RNRPTVSQLVRDVQTNCISAGLKRPHRRTIKARLEEIEPQRRAKRRGETEIVKQTQAV
                     PGVFAASRPLQVVQVDHTKADIFVVDEETRQPIGRPWLTLAMDVCSRMVTGFYLTMDA
                     PSRLSTRGVAP"
     misc_feature    complement(194263..194439)
                     /locus_tag="SMa0360"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     gene            195082..196866
                     /locus_tag="SMa0364"
                     /db_xref="GeneID:1235421"
     CDS             195082..196866
                     /locus_tag="SMa0364"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435442.1"
                     /db_xref="GI:16262649"
                     /db_xref="GeneID:1235421"
                     /translation="MDHATKSEATRGSSALPYSDGRSTAAPFHRVRHGLFTAAFSIIP
                     FSFIVLFAASAGGQSAAVNGLAPQDAVEIHLPGWHTLFGDAAKAALPNGTFTIGSAGA
                     LELPGIGRVPAAGLHASELAKLIADRLQARSGSHDSPVTIVEPRRPALEGQRVSPPAK
                     QPAMVEREAMQALGGERSSVEALLRDLAAARKEAEAAREEERAAHQAARDASILHRRH
                     LAAERQRAAKLTQELTAARVDLETMKTQLKQETNAAHDWKAAVAMIKAAREAAARERS
                     ERAALEEELRAARREIEAARNGAQMVASEREEPLRHDMVPATGALDTMGVAADGAGAQ
                     ARKAADTMAERESALEQQRQRAEGLARDLTVLRRDMDSLQAKVAGAIRSKAAALRARR
                     AGEAALVDAKRALVEERQKIGVYARDLALALQSAAALESRAKLAAAEQAAAAQARKIA
                     EAAAKRAGEALALELEAGKSLARELDTARRERDAAKEELTQVLAQHTSLKGERAWANG
                     RELSAARQQHDGKKARTERRVEDVDEPKTRAGNHASERAKTARATGTRSVRELGARKG
                     RTLETRKPLKIALPNALLPKRWLAPGLW"
     misc_feature    195115..>195642
                     /locus_tag="SMa0364"
                     /note="Periplasmic protein involved in polysaccharide
                     export, contains    SLBB domain of b-grasp fold [Cell
                     wall/membrane/envelope biogenesis]; Region: Wza; COG1596"
                     /db_xref="CDD:224512"
     misc_feature    195274..195471
                     /locus_tag="SMa0364"
                     /note="Polysaccharide biosynthesis/export protein; Region:
                     Poly_export; pfam02563"
                     /db_xref="CDD:251377"
     gene            196912..197808
                     /locus_tag="SMa0367"
                     /db_xref="GeneID:1235422"
     CDS             196912..197808
                     /locus_tag="SMa0367"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435443.1"
                     /db_xref="GI:16262650"
                     /db_xref="GeneID:1235422"
                     /translation="MVMRKYLTVALLITVAIGPASALDIGVGVSVGGTGVSAGVRTGK
                     NGTSAGVSTSVGGIGGAKAGTAAGKSGGSSIGASGNLGGIGVGAGVGVGKNGTSAGIG
                     AGIGGAKAGASVGTSGGSSIRASGNVGRASGGVSTGSVPGAGLSGTGPGNAPSGLAAR
                     SGSPATGTASRILGAAPEKGVRPSIALPRILWPLKSRRRHERGEWSYPLRFPAPIAAI
                     TGTPRAVVRVCRQAIAQAASALGGVRVRAVSAGPLHRGRRGTLTAPLDVRIDYAGQGG
                     REVRQARIRCRLDTSGRVIAVI"
     gene            197906..198172
                     /locus_tag="SMa0369"
                     /db_xref="GeneID:1235423"
     CDS             197906..198172
                     /locus_tag="SMa0369"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435444.1"
                     /db_xref="GI:16262651"
                     /db_xref="GeneID:1235423"
                     /translation="MYPEMPRAISRSTMDVETDDKSQTIVRGILALAHGLGMRVTAEG
                     VETADQANWLRNQGCDRLQGNLFSAPIPAGSMEKFLRQSSMASQ"
     misc_feature    <197930..198124
                     /locus_tag="SMa0369"
                     /note="EAL domain. This domain is found in diverse
                     bacterial signaling proteins. It is called EAL after its
                     conserved residues and is also known as domain of unknown
                     function 2 (DUF2).  The EAL domain has been shown to
                     stimulate degradation of a second...; Region: EAL;
                     cd01948"
                     /db_xref="CDD:238923"
     gene            complement(199105..200004)
                     /locus_tag="SMa0372"
                     /db_xref="GeneID:1235425"
     CDS             complement(199105..200004)
                     /locus_tag="SMa0372"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory
                     helix-turn-helix protein, LysR family, PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435446.1"
                     /db_xref="GI:16262653"
                     /db_xref="GeneID:1235425"
                     /translation="MNDYKALRTFLLAAEKRNFAQVARELDMTPAAVTRAIAALEAEL
                     GVQLFVRTTRQVSLTTDGAIFAAQLQPAVKTIEDARREVMNAHKADEGRLRISAPTWF
                     GKAVLPPILSAFKERYPKMSFEISLSDGLVNIVDDDYDLAIRISSQPSDKFTIWRKIR
                     VVPRILVAAPGSRFVDMQHPNELTPDDCLAYSGDSRRENWVLSDGGSSITISAGRAFS
                     ANNGEVLADIAADGAGVAMLPGFHIFEHLRTGRLVHVFKGWAPPDLWLTLYYPPYQAL
                     PPRIASFSKFFEEQVPAHMVMLD"
     misc_feature    complement(199123..199998)
                     /locus_tag="SMa0372"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(199819..199992)
                     /locus_tag="SMa0372"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(199156..199731)
                     /locus_tag="SMa0372"
                     /note="The C-terminal substrate binding domain of
                     LysR-type transcriptional regulator CrgA and its related
                     homologs, contains the type 2 periplasmic binding domain;
                     Region: PBP2_CrgA_like; cd08422"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(199207..199209,199288..199290,
                     199339..199341,199519..199521,199525..199527,
                     199570..199572,199687..199689,199699..199701))
                     /locus_tag="SMa0372"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176114"
     misc_feature    complement(order(199312..199314,199321..199326,
                     199345..199359,199444..199446,199624..199644,
                     199648..199650,199660..199662,199669..199674,
                     199678..199683,199693..199698))
                     /locus_tag="SMa0372"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176114"
     gene            200116..201048
                     /locus_tag="SMa0374"
                     /db_xref="GeneID:1235426"
     CDS             200116..201048
                     /locus_tag="SMa0374"
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase/lyase"
                     /protein_id="NP_435447.1"
                     /db_xref="GI:16262654"
                     /db_xref="GeneID:1235426"
                     /translation="MIKDIKGLHHVTSMASDARQNNRFFTDTLGLRRVKQTVNFDDPS
                     VYHLYYGDETGSAGTVMTYFPFPNMMLGRPGVGEVGETQFSVPKGSLKFWQDRFTTQG
                     VDGLERDTVFGADRLRFMGPDGDSFALIESADDKRAPWLADGIPDDAAIRGFAGARFS
                     LHDSAATEELLGFMGYERAEKEGDVVRFIISNGNGADTIDLLALPKTPFARQGAGSVH
                     HIAFAVDNREKQLEVRKALMDTGYQVTPVIDRDYFWAIYFRTPGGILFEVATNEPGFN
                     RDEDTAHLGEALKLPVRYEEYRGQIQANLVPLAA"
     misc_feature    200134..200505
                     /locus_tag="SMa0374"
                     /note="N-terminal domain of Sphingobium chlorophenolicum
                     2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and
                     similar proteins; Region: PcpA_N_like; cd08346"
                     /db_xref="CDD:211356"
     misc_feature    order(200143..200145,200149..200151)
                     /locus_tag="SMa0374"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:211356"
     misc_feature    200572..201039
                     /locus_tag="SMa0374"
                     /note="C-terminal domain of Sphingobium chlorophenolicum
                     2,6-dichloro-p-hydroquinone 1,2-dioxygenase (PcpA), and
                     similar proteins; Region: PcpA_C_like; cd08347"
                     /db_xref="CDD:176695"
     misc_feature    order(200770..200772,200914..200916)
                     /locus_tag="SMa0374"
                     /note="Zn binding site [ion binding]; other site"
                     /db_xref="CDD:176695"
     gene            201366..202055
                     /locus_tag="SMa0376"
                     /db_xref="GeneID:1235427"
     CDS             201366..202055
                     /locus_tag="SMa0376"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="NP_435448.1"
                     /db_xref="GI:16262655"
                     /db_xref="GeneID:1235427"
                     /translation="MSKLEVLTPANSQLIFIDQQPQMAFGVQSIDRQTLKNNVVGLAK
                     AAKIFNVPTTITTVETQSFSGNTFPELLAVFPENDLLERTSMNSWDDQNVRDALAKNA
                     ANGRKKIVVSGLWTEVCNTTFALSALHDVPEYEIYMVADASGGTSSDAHKYAMDRMVQ
                     AGVIPVTWQQVLLEWQRDWARKETYDAVTTLVKEHSGAYGMGIDYAYTMVHGAEERVK
                     HGKRIGPNPAK"
     misc_feature    201405..201896
                     /locus_tag="SMa0376"
                     /note="YcaC related amidohydrolases; E.coli YcaC is an
                     homooctameric hydrolase with unknown specificity. Despite
                     its weak sequence similarity, it is structurally related
                     to other amidohydrolases and shares conserved active site
                     residues with them; Region: YcaC_related; cd01012"
                     /db_xref="CDD:238494"
     misc_feature    order(201417..201419,201612..201614,201720..201722)
                     /locus_tag="SMa0376"
                     /note="catalytic triad [active]"
                     /db_xref="CDD:238494"
     misc_feature    order(201426..201428,201435..201437,201573..201575)
                     /locus_tag="SMa0376"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:238494"
     misc_feature    201705..201710
                     /locus_tag="SMa0376"
                     /note="conserved cis-peptide bond; other site"
                     /db_xref="CDD:238494"
     gene            202120..202407
                     /locus_tag="SMa5018"
                     /db_xref="GeneID:6435256"
     CDS             202120..202407
                     /locus_tag="SMa5018"
                     /note="pfam07235, DUF1427, Protein of unknown function
                     (DUF1427); This family consists of several bacterial
                     proteins of around 100 residues in length; The function of
                     this family is unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000334.1"
                     /db_xref="GI:193782562"
                     /db_xref="GeneID:6435256"
                     /translation="MKVYLLSLGAGLLVGIVYSLLNVRSPAPPVIALVGLLGILVGEQ
                     IIPFAKTLWRSEPAAISWLHQIKPHMFGHLPKGSDRIEIAHQAKARVEERS"
     misc_feature    202120..202350
                     /locus_tag="SMa5018"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4317"
                     /db_xref="CDD:226767"
     gene            202407..204389
                     /locus_tag="SMa0380"
                     /db_xref="GeneID:1235428"
     CDS             202407..204389
                     /locus_tag="SMa0380"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hydrolase"
                     /protein_id="NP_435449.1"
                     /db_xref="GI:16262656"
                     /db_xref="GeneID:1235428"
                     /translation="MATRRSFLGGASSLAFANFFSPAKAADPNQTGVDTMHPDLILHN
                     GRVTTLDRTNPNATAIAIKDGLFLEVGSDSEVMALAGSGTKIVDLKGKGVLPGLIDNH
                     THVVRGGLNYNMELRWDGVRSLADAMDMLKRQVAITPAPQWVRVVGGFTEHQFAEKRL
                     PTIEEINAVAPDTPVFLLHLYDRALLNGAALRAVGYTRDTPNPPGGEITRDANGNPTG
                     LLLAKPNAGILYSTLAKGPKLPLDYQVNSTRHFMRELNRLGVTGVIDAGGGFQNYPDD
                     YEVIQKLSDENQMTVRLAYNLFTQKPKEEKQDFLNWTQSVKYKQGNDYFRHNGAGEML
                     VFSAADFEDFRQPRPEMAPEMEGELEEVLRVLAENRWPWRLHATYDETISRALDVFEK
                     VNKDIPLEGLNWFFDHAETISDRSIDRIAALGGGIATQHRMAYQGEYFAERYGHGVAE
                     ATPPIRRMLDKGVNVSAGTDATRVASYNPWVSLSWMVTGKTVGGMQLYPRANCLDRET
                     ALRMWTEKVTWFSNEEGKKGRIEKGQFADLVVPDKDFFSCAEDEISFIVSELTMVGGK
                     IVYGAGDFKTLDENEIPPAMPDWSPVRKFGGYAAWGEPERAGARSLRRTAISTCGCAS
                     DCGVHGHDHAGAWTSKLPIADLKGFFGALGCSCWAV"
     misc_feature    202509..204122
                     /locus_tag="SMa0380"
                     /note="Predicted metal-dependent hydrolase with the
                     TIM-barrel fold [General function prediction only];
                     Region: COG1574"
                     /db_xref="CDD:224490"
     misc_feature    202581..204026
                     /locus_tag="SMa0380"
                     /note="YtcJ_like metal dependent amidohydrolases. YtcJ is
                     a Bacillus subtilis ORF of unknown function. The
                     Arabidopsis homolog LAF3 has been identified as a factor
                     required for photochrome A signalling; Region: YtcJ_like;
                     cd01300"
                     /db_xref="CDD:238625"
     misc_feature    order(202710..202712,202716..202718,203532..203534,
                     203628..203630,203814..203816)
                     /locus_tag="SMa0380"
                     /note="active site"
                     /db_xref="CDD:238625"
     gene            204550..204993
                     /locus_tag="SMa5019"
                     /db_xref="GeneID:6435257"
     CDS             204550..204993
                     /locus_tag="SMa5019"
                     /note="Predicted membrane protein; Similar to S; meliloti
                     SMa1817"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000335.1"
                     /db_xref="GI:193782563"
                     /db_xref="GeneID:6435257"
                     /translation="MTYHSQLSNPIRSGVARVVGSPVVRTVSLLALCAAYIQGPLTKI
                     FDFNGALAEMDHFGLHPAPFFAVAVIVFELTASAMVISGLLRWAGALALAGFTLLATF
                     IALRFWEMAPGMDRMMATNAFFEHLGLAGAFVFVAAFDLTKGAGK"
     misc_feature    204604..204966
                     /locus_tag="SMa5019"
                     /note="Predicted membrane protein [Function unknown];
                     Region: COG2259"
                     /db_xref="CDD:225168"
     gene            204990..206588
                     /locus_tag="SMa0383"
                     /db_xref="GeneID:1235429"
     CDS             204990..206588
                     /locus_tag="SMa0383"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435450.1"
                     /db_xref="GI:16262657"
                     /db_xref="GeneID:1235429"
                     /translation="MSAAKSSGGTFAPLAQPVFAVLWTATVLGNTGSFMRDVASAWLM
                     TDLSASPAAVAMVQAAGTLPIFLLAIPAGVLTDILDRRKFLIAVQLLLASVSISLMVL
                     SQTGMLSVSSLIGLTFLGGIGAALMGPTWQAIVPELVKREDVKSAVALNSLGINIARS
                     IGPAAGGLLLAAFGAGITYGADVASYIVVIAALVWWPRAKNANDALQENFFGAFRAGL
                     RYTRSSTPLHVVLLRAAIFFAFASAVWALLPLVARQLLGGDAGFYGILLGAVGAGAIG
                     GALVMPKLRERLSSDGLLLGAALITAAVMGVLALAPPKVVAIIVLLFLGGAWITALTT
                     LNGTAQSVLPNWVRGRGLAVYLTVFNGAMTAGSLGWGAVGEAVGIQSTLIIGAIGLLI
                     AGLIMHRVKLPAGDADLVPSNHWPEPLVAEPIAHDRGPVLILIEYKVEKQHRTAFLHA
                     IDHLSRERRRDGAYGWGVTEDSADPEKIVEWFMVESWAEHLRQHKRVSNADADLQGKV
                     LAYHVGPDKPVVRHFMTINRPGAA"
     misc_feature    205014..206579
                     /locus_tag="SMa0383"
                     /note="Transmembrane secretion effector; Region: MFS_3;
                     pfam05977"
                     /db_xref="CDD:253487"
     misc_feature    205044..206192
                     /locus_tag="SMa0383"
                     /note="The Major Facilitator Superfamily (MFS) is a large
                     and diverse group of secondary transporters that includes
                     uniporters, symporters, and antiporters. MFS proteins
                     facilitate the transport across cytoplasmic or internal
                     membranes of a variety of...; Region: MFS; cd06174"
                     /db_xref="CDD:119392"
     misc_feature    order(205086..205088,205095..205103,205107..205112,
                     205161..205163,205170..205175,205182..205184,
                     205194..205199,205203..205208,205359..205364,
                     205371..205376,205383..205388,205395..205397,
                     205431..205436,205443..205448,205464..205466,
                     205701..205703,205710..205715,205722..205727,
                     205734..205736,205776..205778,205788..205790,
                     205800..205802,205809..205811,205821..205823,
                     205962..205964,205971..205976,205983..205985,
                     205995..206000,206007..206009,206040..206045,
                     206052..206057,206064..206069,206076..206078)
                     /locus_tag="SMa0383"
                     /note="putative substrate translocation pore; other site"
                     /db_xref="CDD:119392"
     repeat_region   complement(207549..208846)
                     /standard_name="ISRm3"
                     /note="SMa3002; predicted by homology"
                     /rpt_family="ISRm3"
     gene            complement(207586..208788)
                     /locus_tag="SMa0384"
                     /db_xref="GeneID:1235430"
     CDS             complement(207586..208788)
                     /locus_tag="SMa0384"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm3 transposase"
                     /protein_id="NP_435451.1"
                     /db_xref="GI:16262658"
                     /db_xref="GeneID:1235430"
                     /translation="MAIEKELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELD
                     DHLDVERLEGGPANRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDF
                     DDKIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYP
                     LVFFDAIRVKIRDEGFVRNKAVYVALAVLADGSKEILGLWIEQTEGAKFWLRVMNELK
                     NRGCQDILIAVVDGLKGFPEAITAVFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPAL
                     RAIYRARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYT
                     TNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAV
                     IFGERFFN"
     misc_feature    complement(207652..208782)
                     /locus_tag="SMa0384"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; pfam00872"
                     /db_xref="CDD:250193"
     misc_feature    complement(207601..208719)
                     /locus_tag="SMa0384"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(209020..210132)
                     /gene="hisC3"
                     /locus_tag="SMa0387"
                     /db_xref="GeneID:1235431"
     CDS             complement(209020..210132)
                     /gene="hisC3"
                     /locus_tag="SMa0387"
                     /EC_number="2.6.1.9"
                     /note="catalyzes the formation of
                     3-(imidazol-4-yl)-2-oxopropyl phosphate and L-glutamate
                     from L-histidinol phosphate and 2-oxoglutarate"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol-phosphate aminotransferase"
                     /protein_id="NP_435452.1"
                     /db_xref="GI:16262659"
                     /db_xref="GeneID:1235431"
                     /translation="MAIPSRPIREEIRSIAPYNAGLTLEEVRAKYHVDEVAKLSSNEN
                     PLGPSPALRRLFPDIGELARLYPDPQGRALCARLAASFDVENNQVILGNGSEDLIAVI
                     CRSVVRAGDTVVTLYPSFPLHEDYTTLMGGKVDRVTVTPDLSVDMDALLAAIARKPRM
                     LMFSNPMNPVGSWLTPLQLAKVVAALDPETLIVVDEAYAEYAAGDDYPSAAEVLKVTG
                     LNWVVLRTFSKAYGLAGLRIGYGIVSDGSLCDFFNRARTPFNTNAIAQVSALAAFDDT
                     YHLNRSVELALVERERMKKELATMGYRIAPSKCNFLFFDARTEATPVAEALLRRGVIV
                     KPWKQPRFETYIRVSIGSPVENDHFIHALKEVEAVG"
     misc_feature    complement(209026..210132)
                     /gene="hisC3"
                     /locus_tag="SMa0387"
                     /note="histidinol-phosphate aminotransferase; Provisional;
                     Region: PRK05166"
                     /db_xref="CDD:179950"
     misc_feature    complement(209038..210021)
                     /gene="hisC3"
                     /locus_tag="SMa0387"
                     /note="Aspartate aminotransferase family. This family
                     belongs to pyridoxal phosphate (PLP)-dependent aspartate
                     aminotransferase superfamily (fold I). Pyridoxal phosphate
                     combines with an alpha-amino acid to form a compound
                     called a Schiff base or aldimine...; Region: AAT_like;
                     cd00609"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(209422..209424,209446..209451,
                     209455..209457,209539..209541,209629..209631,
                     209773..209775,209845..209853))
                     /gene="hisC3"
                     /locus_tag="SMa0387"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:99734"
     misc_feature    complement(order(209329..209331,209338..209340,
                     209422..209430,209560..209562,209743..209745,
                     209842..209844))
                     /gene="hisC3"
                     /locus_tag="SMa0387"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:99734"
     misc_feature    complement(209446..209448)
                     /gene="hisC3"
                     /locus_tag="SMa0387"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99734"
     gene            210263..211030
                     /locus_tag="SMa0389"
                     /db_xref="GeneID:1235432"
     CDS             210263..211030
                     /locus_tag="SMa0389"
                     /note="glimmer prediction; N-terminus - short chain
                     motif, PF00106; C-terminus - short chain
                     dehydrogenase/reductase C-terminus motif, PF00678"
                     /codon_start=1
                     /transl_table=11
                     /product="short chain alcohol dehydrogenase-related
                     dehydrogenase"
                     /protein_id="NP_435453.2"
                     /db_xref="GI:193782564"
                     /db_xref="GeneID:1235432"
                     /translation="MTSPIFDLSGRRALVTGASRGIGQSIAVALAEAGAHVAVTARTV
                     EGLAETRALIEKTGRRAVALAQDVRDVEACASVTRAAAEGLGGLDILVNNAGFENVRP
                     SFDVDEALWDTIVSTNLKGAFFCAQAAGRIMADANGGAIVNLCSLTSYVGIPTAVPYG
                     ASKSGLLGVTRALATEWAAHNIRVNAIAPGYFRTAMTAGFYEDEDWQSRMLEKIPQRR
                     FGKESDIGGVAVFLCSDAAAYITGHCIPADGGYLASI"
     misc_feature    210278..211024
                     /locus_tag="SMa0389"
                     /note="2-deoxy-D-gluconate 3-dehydrogenase; Provisional;
                     Region: PRK06935"
                     /db_xref="CDD:180761"
     misc_feature    210278..211021
                     /locus_tag="SMa0389"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(210311..210313,210317..210322,210326..210328,
                     210383..210391,210542..210550,210692..210700,
                     210737..210739,210749..210751,210827..210838)
                     /locus_tag="SMa0389"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(210614..210616,210698..210700,210737..210739,
                     210749..210751)
                     /locus_tag="SMa0389"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            211336..212469
                     /locus_tag="SMa0391"
                     /db_xref="GeneID:1235433"
     CDS             211336..212469
                     /locus_tag="SMa0391"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; ABC transporter PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435454.1"
                     /db_xref="GI:16262661"
                     /db_xref="GeneID:1235433"
                     /translation="MGAVAAGLRPTGSVNPGAVSVKDVGMAFGDVHAVRNASFDLPKG
                     RFLTILGPSGSGKTTLLRMIAGFDRPTHGEIFINGRPVSAVPPHKRAIGMVFQKLALF
                     PHMTAAENVAFPLKMRRHDARTIPEKVERYLDLVRLGGYGDRRINELSGGQQQRVAIA
                     RALVFEPDLLLLDEPLAALDRKLREEMQLEFRRIQKELGVTTINVTHDQREALVVSDE
                     IIIMNGGAIQQKARPVDAYRAPSNAFVANFIGVTNFLEGRIVELTSTQAVFETNGVRL
                     VGIAADAALAPGLSCSGALRAEQIRIAPMGGRLDELETLVDGQVVDCIFEGDRVVYEI
                     RVPDLAGVLMRVFDHDPESHLQFGPGDEVRLGWNARDMHVFQK"
     misc_feature    211378..212466
                     /locus_tag="SMa0391"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    211390..212085
                     /locus_tag="SMa0391"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    211486..211509
                     /locus_tag="SMa0391"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(211495..211500,211504..211512,211624..211626,
                     211852..211857,211954..211956)
                     /locus_tag="SMa0391"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    211615..211626
                     /locus_tag="SMa0391"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    211780..211809
                     /locus_tag="SMa0391"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    211840..211857
                     /locus_tag="SMa0391"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    211864..211875
                     /locus_tag="SMa0391"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    211942..211962
                     /locus_tag="SMa0391"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    212215..212460
                     /locus_tag="SMa0391"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            212503..213618
                     /locus_tag="SMa0392"
                     /db_xref="GeneID:1235434"
     CDS             212503..213618
                     /locus_tag="SMa0392"
                     /function="Cell processes; Transport of small molecules"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435455.1"
                     /db_xref="GI:16262662"
                     /db_xref="GeneID:1235434"
                     /translation="MSHEKFLSAQIGRRTLLASMAAAGASAGLSTLGVSRAFAQEPEK
                     PAEIIVRAWGGSWVDALKAGVSDSFTKMTGIAVRHDLTEDNEIQPKVWAAVAQKRVPP
                     IHINWDTTTNATKSALRGVTEDLSDLPNLKNATDLAKPVGLDGYPIVNTYGYVYVLAY
                     RPSAFPNGAPKSWKDLLDPKLKGRIALYNDGIGFHFPAQVAGGGKLEDIPANMQPAWD
                     FISKIKEQQPLLGEDPDFTTWFQKGEIDAACTISTNAREAKKNGIEIAWVVPEEGAKF
                     DTDGLWIPKGLPENELYWAKQYINHALTKEAQQIWLDGLGLPGVIPGITPPADLVGDP
                     SYPTTEEDFKQLIRISAKVQVENESQWFAKFKEIMQG"
     misc_feature    212701..213516
                     /locus_tag="SMa0392"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_8; pfam13416"
                     /db_xref="CDD:257741"
     gene            213683..214627
                     /locus_tag="SMa0394"
                     /db_xref="GeneID:1235435"
     CDS             213683..214627
                     /locus_tag="SMa0394"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; binding-protein-dependent
                     transport systems inner membrane component, PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435456.1"
                     /db_xref="GI:16262663"
                     /db_xref="GeneID:1235435"
                     /translation="MRAPRAAYPLTWRVMDVLERLAAIVWPSSFQRGLPYLMLMPALV
                     LVGLLVLGLVQIGDTSLRTLDTNTFLMSESYTLANYQRVLTESFFATVAGRSLVGSVI
                     VTVITLLLAFPYAYLMVRTPSSALRKFLLVALFLPFFIGQVVRAYGWLIILGNQGMVN
                     EALGLVGVPPIRLLYNYPAVLFGLVQYMLPFAVLMLAPALTAIPSELEAAAASLGAGW
                     TRTFRHIVLPLSRPGLVGAGLVVLTLSLTDFAIPAILGGGTQDFIANAIYDQFFRTSD
                     QGMGATLSLMLVAVGSMLVGVVFMLFGAGTLAMTGDRK"
     misc_feature    213908..>214585
                     /locus_tag="SMa0394"
                     /note="ABC-type Fe3+ transport system, permease component
                     [Inorganic ion transport and metabolism]; Region: ThiP;
                     COG1178"
                     /db_xref="CDD:224099"
     misc_feature    213968..214564
                     /locus_tag="SMa0394"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(214007..214012,214019..214024,214037..214039,
                     214070..214081,214085..214114,214121..214126,
                     214130..214132,214235..214237,214241..214243,
                     214247..214249,214253..214255,214262..214267,
                     214271..214273,214283..214288,214295..214297,
                     214346..214348,214388..214393,214400..214402,
                     214421..214432,214439..214444,214481..214486,
                     214514..214519,214526..214531,214535..214540,
                     214547..214552,214559..214564)
                     /locus_tag="SMa0394"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(214088..214132,214421..214438)
                     /locus_tag="SMa0394"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(214130..214132,214220..214222,214439..214441,
                     214475..214477,214484..214486,214514..214516)
                     /locus_tag="SMa0394"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(214298..214336,214352..214357,214367..214369)
                     /locus_tag="SMa0394"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            214624..215424
                     /locus_tag="SMa0396"
                     /db_xref="GeneID:1235436"
     CDS             214624..215424
                     /locus_tag="SMa0396"
                     /function="Cell processes; Transport of small molecules"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435457.1"
                     /db_xref="GI:16262664"
                     /db_xref="GeneID:1235436"
                     /translation="MTGSKSKSFVLWAFVTTALLMLSAPTVVVLGASFTAGNIITFPP
                     DGLSLKWYGAIAQASDLRQAFVRSLIVATICTLVSIPVGTLAGIALAKYRVRFARSIQ
                     IYLLLPFTIPLIGSGIGMMLVLGNMGVLGKLWPVGIACAVINLPFMIWAVTASASNLS
                     PDLELAAANCGAPPLQRFLYITLPAVLPGVITGSLLMFILALNEFLVSLLLVDARSVT
                     LPVQIYNSIRSIITPDLAAISVVFIACAGLAIALLDRLVGLDIFLKSK"
     misc_feature    214624..215397
                     /locus_tag="SMa0396"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    214816..215373
                     /locus_tag="SMa0396"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(214864..214869,214876..214881,214894..214896,
                     214924..214935,214939..214968,214975..214980,
                     214984..214986,215047..215052,215056..215058,
                     215062..215064,215071..215076,215080..215082,
                     215092..215097,215104..215106,215155..215157,
                     215197..215202,215209..215211,215230..215241,
                     215248..215253,215290..215295,215323..215328,
                     215335..215340,215344..215349,215356..215361,
                     215368..215373)
                     /locus_tag="SMa0396"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(214942..214986,215230..215247)
                     /locus_tag="SMa0396"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(214984..214986,215032..215034,215248..215250,
                     215284..215286,215293..215295,215323..215325)
                     /locus_tag="SMa0396"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(215107..215145,215161..215166,215176..215178)
                     /locus_tag="SMa0396"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            215421..216791
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /db_xref="GeneID:1235437"
     CDS             215421..216791
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /EC_number="1.1.1.23"
                     /function="Small molecule metabolism; Amino acid
                     biosynthesis; histidine"
                     /note="catalyzes the oxidation of L-histidinol to
                     L-histidinaldehyde and then to L-histidine in histidine
                     biosynthesis; functions as a dimer"
                     /codon_start=1
                     /transl_table=11
                     /product="histidinol dehydrogenase"
                     /protein_id="NP_435458.3"
                     /db_xref="GI:187729962"
                     /db_xref="GeneID:1235437"
                     /translation="MTLRPQLARYKDKTMTSVSFYEYSKLNAEEKAALLRRSETDISG
                     FIEKVAPILEAVRTEGDKALARFGRELDKADVTEANLKVTAAEFDAAFKLVDASVLES
                     VQFGIDNIRKFHEEQKPEAMWLKEIRPGAFAGDRFTPIQSVALYVPRGKGSFPSVTMM
                     TSVPAVVAGVPNLAIVTPPAPDGSVDAATLVAARLAGVETVYKAGGAQAVAAVAYGTE
                     TVKPALKIVGPGSPWVVAAKRSLSGVIDTGLPAGPSEVMILADDTVHGGLAALDLLIE
                     AEHGPDSSAYLVTHSGRVAEEALAALPEHWARMTEQRTAFSKTVLSGKTGGIVLTSSI
                     EESYEFVNAYAPEHLELLSEQPFIHLGHITEASEILMGTHTPVSIANFSLGPNAVLPT
                     SRWARTFGPLSVTDFVKRSSIGYVTAPAYPEFARHSHNLAIYEGFSSHALAVSPVRDA
                     YLKKGA"
     misc_feature    215493..216776
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="Histidinol dehydrogenase [Amino acid transport and
                     metabolism]; Region: HisD; COG0141"
                     /db_xref="CDD:223219"
     misc_feature    215556..216740
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="Histidinol dehydrogenase, HisD, E.C 1.1.1.23.
                     Histidinol dehydrogenase catalyzes the last two steps in
                     the L-histidine biosynthesis pathway, which is conserved
                     in bacteria, archaea, fungi, and plants. These last two
                     steps are (i) the NAD-dependent...; Region: Histidinol_dh;
                     cd06572"
                     /db_xref="CDD:119329"
     misc_feature    order(215631..215633,215856..215858,215862..215867,
                     215889..215891,215952..215954,216033..216038,
                     216042..216044,216105..216113,216117..216122,
                     216255..216257)
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(215712..215717,215724..215729,215733..215735,
                     215742..215747,215754..215759,215766..215771,
                     215793..215795,215799..215801,215811..215825,
                     215832..215834,215838..215840,215874..215888,
                     216090..216092,216135..216137,216147..216149,
                     216219..216224,216231..216236,216240..216248,
                     216252..216257,216474..216476,216489..216491,
                     216498..216503,216507..216533,216537..216539,
                     216543..216548,216552..216566,216570..216572,
                     216576..216578,216606..216611,216615..216629,
                     216633..216638,216645..216668,216711..216716,
                     216720..216740)
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(215880..215882,215886..215888,216180..216182,
                     216255..216257,216459..216464,216549..216551,
                     216561..216566,216582..216584,216723..216725,
                     216729..216731,216738..216740)
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="product binding site; other site"
                     /db_xref="CDD:119329"
     misc_feature    order(215886..215888,216180..216182,216246..216248,
                     216255..216257,216459..216464,216549..216551,
                     216561..216566,216582..216584,216723..216725,
                     216729..216731,216738..216740)
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:119329"
     misc_feature    order(216246..216248,216255..216257,216561..216563,
                     216738..216740)
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="zinc binding site [ion binding]; other site"
                     /db_xref="CDD:119329"
     misc_feature    216459..216464
                     /gene="hisD2"
                     /locus_tag="SMa0398"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:119329"
     gene            216795..217808
                     /locus_tag="SMa0400"
                     /db_xref="GeneID:1235438"
     CDS             216795..217808
                     /locus_tag="SMa0400"
                     /note="zinc-binding  motif, PF00107"
                     /codon_start=1
                     /transl_table=11
                     /product="Dehydrogenase, Zn-dependent"
                     /protein_id="NP_435459.1"
                     /db_xref="GI:16262666"
                     /db_xref="GeneID:1235438"
                     /translation="MKAVRLYDIRDLRVEEVAELAAPPPGFVNLEVRAAGICGSDLHN
                     YRTGQWISRRPSTAGHEFCGRVTAIGEGVSHLVRGDVVSADSRMWCGTCPACASGRSN
                     VCETLGFLGEVCDGGFAEAVQLPSRLVFRHDPKLSPHVAAMAEPLAVALHAVRRLAVP
                     DGAPVLVMGCGTIGGLSALLLSRLHQGPLLLTDLNADKAALVAEVTGGVVVALDGAAI
                     EEALPGTRLRHALDATGSIQAIARALDILSGGGALALVGIGHGKLDLDPNILVEREIS
                     LVGCHAFAGELPEAIELLADLAPALQRFIEVLPTLDDVPEAYERLLRGESNALKTIIE
                     VAG"
     misc_feature    216795..217796
                     /locus_tag="SMa0400"
                     /note="Threonine dehydrogenase and related Zn-dependent
                     dehydrogenases [Amino acid transport and metabolism /
                     General function prediction only]; Region: Tdh; COG1063"
                     /db_xref="CDD:223991"
     misc_feature    216795..217793
                     /locus_tag="SMa0400"
                     /note="Medium chain reductase/dehydrogenase
                     (MDR)/zinc-dependent alcohol dehydrogenase-like family;
                     Region: MDR; cl16912"
                     /db_xref="CDD:266485"
     misc_feature    order(216906..216914,216921..216923,217227..217229,
                     217239..217241,217299..217316,217371..217376,
                     217386..217388,217491..217496,217560..217565)
                     /locus_tag="SMa0400"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:176178"
     gene            217871..218602
                     /locus_tag="SMa0402"
                     /db_xref="GeneID:1235439"
     CDS             217871..218602
                     /locus_tag="SMa0402"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory protein,
                     gntR family, PF00392"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435460.1"
                     /db_xref="GI:16262667"
                     /db_xref="GeneID:1235439"
                     /translation="MNTLSDSASPLYEKVKDFVLGNIGSGKWARNSRLPSENELVSAL
                     GVSRMTVHRALRELTSEGHLRRIQGVGTFVAPPRPRSTLIEISNIITEIKTRGSRHRA
                     EVVVLERIARPEPELLLAFEFETVKPVDHSVVIHFENDLPVQLEERYVNPNLVSGYID
                     QDFAAVATYDYLQNATPLTEVEHLISALPANAEQARLLNVRPGDCCLILHRKTWTGPV
                     VATVNTFTYVGSRYSLGSRYLHGGK"
     misc_feature    217898..218584
                     /locus_tag="SMa0402"
                     /note="histidine utilization repressor, proteobacterial;
                     Region: his_ut_repres; TIGR02018"
                     /db_xref="CDD:188194"
     misc_feature    217898..218095
                     /locus_tag="SMa0402"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(217898..217900,217904..217906,217973..217975,
                     217979..217984,218006..218020,218024..218029,
                     218036..218038,218066..218071,218075..218086)
                     /locus_tag="SMa0402"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    218156..218569
                     /locus_tag="SMa0402"
                     /note="UTRA domain; Region: UTRA; pfam07702"
                     /db_xref="CDD:254372"
     gene            218550..219938
                     /locus_tag="SMa0403"
                     /db_xref="GeneID:1235440"
     CDS             218550..219938
                     /locus_tag="SMa0403"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435461.1"
                     /db_xref="GI:16262668"
                     /db_xref="GeneID:1235440"
                     /translation="MSAAATRSAAAICTAASDRRSYALKDPSGKNAMSQPTSRTAEIR
                     KVAKTGDGKAEQLLAELLRDLFRIEARNVAINHDQYSLNSLNGFFETEDGAFFFKFHQ
                     EEGEEAMSGEYYRADILARAGLPVDQPLLMSVIPGEQILVYRRRTDPRFSDVLRALDL
                     KDDAAARGRAVEAERRLSEAVLKVYLATLHTVGAREVAAEPIHRLFYERLVDRSAASY
                     PGGRMASFYVGKDFAFPNLTLDWETLSRCRFVVNGIEYSDSIGALFDAAHERLNPARL
                     ADAGGVVAHGDAHNANVWYEERDGGAHLSFFDPAFAGENIPALLAEVKTTFHNILAHP
                     LWLYDPAMAAGRYKASAVLDGALLRVTTDFAPSPVRRALLDVKAEALWRPLLSELKAR
                     GMLPADWRRVIRLGLFLCPTLVMNLRAGATTHNAISSLIGFSVAVMAGSEPVAGDDLI
                     SRFIDTIDPDNG"
     misc_feature    218739..219623
                     /locus_tag="SMa0403"
                     /note="Aminoglycoside 3'-phosphotransferase (APH) and
                     Choline Kinase (ChoK) family. The APH/ChoK family is part
                     of a larger superfamily that includes the catalytic
                     domains of other kinases, such as the typical
                     serine/threonine/tyrosine protein kinases (PKs)...;
                     Region: APH_ChoK_like; cl17270"
                     /db_xref="CDD:266599"
     gene            219940..221085
                     /locus_tag="SMa0404"
                     /db_xref="GeneID:1235036"
     CDS             219940..221085
                     /locus_tag="SMa0404"
                     /note="glimmer prediction; FMN-dependent  motif, PF01070"
                     /codon_start=1
                     /transl_table=11
                     /product="FMN-dependent dehydrogenase"
                     /protein_id="NP_435462.1"
                     /db_xref="GI:16262669"
                     /db_xref="GeneID:1235036"
                     /translation="MALVNIDDFRDLARRRRPKIFFDYIDGGSFEEETMRANRSDFSR
                     LTLRQNVLVEPQPQDLATAYLGKRHPLPFMLGPVGFLGLYSGKGEVKAVRAAHAAGIP
                     FCLSTFSIASLADLRIVTDGPLHFQLYVLEDRSLCEEFLRAAEYAGVDTLFVTVDTAI
                     TGIRERDVRNGFRSLTRVTPDLFARLALKPRWLAEVVLAGMPSVRAVEHRPEFGRGAL
                     EQAANLSRRIDKTLSWKDIAWLRERWAGKLVIKGVLTPADAVRARDLGCDGVVVSNHG
                     GRQLDGAPSTIRALPSIRATVGTDFCLMLDGGIRRGADVIKAIALGADGVMLGRAYAY
                     GLSAAGQAGVAEVIAILEREISISLALMGIASVEQLKALGAEAVSTL"
     misc_feature    219958..221049
                     /locus_tag="SMa0404"
                     /note="Family of homologous FMN-dependent
                     alpha-hydroxyacid oxidizing enzymes. This family occurs in
                     both prokaryotes and eukaryotes. Members of this family
                     include flavocytochrome b2 (FCB2), glycolate oxidase
                     (GOX), lactate monooxygenase (LMO), mandelate...; Region:
                     alpha_hydroxyacid_oxid_FMN; cd02809"
                     /db_xref="CDD:239203"
     misc_feature    219979..221052
                     /locus_tag="SMa0404"
                     /note="FMN-dependent dehydrogenase; Region: FMN_dh;
                     pfam01070"
                     /db_xref="CDD:250340"
     misc_feature    order(220009..220011,220255..220257,220324..220326,
                     220408..220410,220429..220431,220690..220692,
                     220762..220764,220771..220773,220927..220929)
                     /locus_tag="SMa0404"
                     /note="active site"
                     /db_xref="CDD:239203"
     misc_feature    order(220009..220011,220324..220326,220429..220431,
                     220762..220764,220771..220773)
                     /locus_tag="SMa0404"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239203"
     misc_feature    order(220255..220257,220324..220326,220408..220410,
                     220690..220692,220762..220764,220771..220773,
                     220927..220929)
                     /locus_tag="SMa0404"
                     /note="FMN binding site [chemical binding]; other site"
                     /db_xref="CDD:239203"
     misc_feature    order(220324..220326,220429..220431,220762..220764)
                     /locus_tag="SMa0404"
                     /note="putative catalytic residues [active]"
                     /db_xref="CDD:239203"
     gene            221438..221725
                     /locus_tag="SMa0405"
                     /db_xref="GeneID:1235037"
     CDS             221438..221725
                     /locus_tag="SMa0405"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, fragment"
                     /protein_id="NP_435463.2"
                     /db_xref="GI:193782565"
                     /db_xref="GeneID:1235037"
                     /translation="MTPKKCQSSESDHSGRISKIGDGSVRTALYEAANVILTRPVKGS
                     DLKGWALAVARRAGPRKARVALARKLAVVLHCMLRDRTNFIAHKGAPALAA"
     misc_feature    <221438..221554
                     /locus_tag="SMa0405"
                     /note="Transposase IS116/IS110/IS902 family; Region:
                     Transposase_20; pfam02371"
                     /db_xref="CDD:251256"
     misc_feature    <221441..221671
                     /locus_tag="SMa0405"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3547"
                     /db_xref="CDD:226077"
     gene            222078..222866
                     /locus_tag="SMa0407"
                     /db_xref="GeneID:1235038"
     CDS             222078..222866
                     /locus_tag="SMa0407"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435464.1"
                     /db_xref="GI:16262671"
                     /db_xref="GeneID:1235038"
                     /translation="MELRVGGAKPSDNSPAASKGFSDPLDSHGVPGRSKQYLIHSAFT
                     GTIGGVAMAYVDWAIKGPKIASCSCDYGCPCEFNGKPTEGLCEGLECMLIEEGWFGDL
                     RLDGLKVAAVYRWPGPVHEGGGVVRGFFDANADQAQIDALFTILGGKEQEPTTVFNIY
                     GSTIAQELEPIFAPIEFHSDIEKRTGGFRIDGHLELELEPIRNPVTGAPHRARIVLPE
                     GFEFRQAEIASGTFNANGEIAMGRQKRYGALWRAAYGPYGIIEE"
     misc_feature    222228..222851
                     /locus_tag="SMa0407"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5588"
                     /db_xref="CDD:227875"
     gene            complement(223861..224175)
                     /locus_tag="SMa0412"
                     /db_xref="GeneID:1235040"
     CDS             complement(223861..224175)
                     /locus_tag="SMa0412"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435466.2"
                     /db_xref="GI:193782566"
                     /db_xref="GeneID:1235040"
                     /translation="MIKMSVYYPADGGSKFDHDYYRTRHMPLIQERLGDACLRYEIDK
                     GLAGREPGSAPEFVAACHVYSPSLATFQEALGPHRSEIAADVANYTDIAPIVQISEVV
                     EG"
     misc_feature    complement(223864..224172)
                     /locus_tag="SMa0412"
                     /note="conserved hypothetical protein; Region: TIGR02118"
                     /db_xref="CDD:131173"
     gene            224805..226475
                     /locus_tag="SMa0414"
                     /db_xref="GeneID:1235041"
     CDS             224805..226475
                     /locus_tag="SMa0414"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; C-terminal DNA ligase motif,
                     PF01068"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435467.1"
                     /db_xref="GI:16262674"
                     /db_xref="GeneID:1235041"
                     /translation="MADNLSKDRAKRDFKKTREPSGEAQVKPSNRRRFVIQKHDATRL
                     HYDLRLELDGVFKSWAVTKGPSLDPSDKRLAVEVEDHPLDYGDFEGTVPKGQYGGGTV
                     MLWDRGYWEPEGRKSPEEALKKGDFKFTLHGKRLHGSFVLVRMRNDRDGGKRTNWLLI
                     KHRDDYSVDENGAAILEENATSVASGRSMEQIAEGTGRKPRPFMMANADVEADAVWDS
                     KHGLAAEERKKGSRRDVATSTAADLPDFIEPQLCETLARPPASDDWLHEIKFDGYRIQ
                     MRIADGKVTLKTRKGLDWTAKYPEIADAASELPDCIIDGEICALDDNGAPDFAALQAA
                     LSEGKTGNLVYFAFDLLFDGGEDLRSMRLVERKKRLEDFLAAGSDDPRIRYVDHFESG
                     GDAVLRSACKLSLEGIVSKQMDAPYQSGRTDTWAKSKCRAGHEVVIGGYATTNGKFRS
                     LLVGVHRGDHFVYVGRVGTGFGAAKVERFFPKLKALEASKSPFTGIGAPKKEKEVTWL
                     PDGRALPACRVRSSTDVVRFRRSGRSPRALRSDRSEGRASCPRRLSPV"
     misc_feature    224817..225299
                     /locus_tag="SMa0414"
                     /note="DNA ligase D, 3'-phosphoesterase domain; Region:
                     LigD_PE_dom; TIGR02777"
                     /db_xref="CDD:131824"
     misc_feature    225021..226457
                     /locus_tag="SMa0414"
                     /note="ATP-dependent DNA ligase [DNA replication,
                     recombination, and repair]; Region: CDC9; COG1793"
                     /db_xref="CDD:224706"
     misc_feature    225543..226097
                     /locus_tag="SMa0414"
                     /note="Adenylation domain of Mycobacterium tuberculosis
                     LigD and LigC-like ATP-dependent DNA ligases; Region:
                     Adenylation_DNA_ligase_LigD_LigC; cd07906"
                     /db_xref="CDD:185715"
     misc_feature    order(225603..225614,225618..225626,225669..225671,
                     225750..225752,225786..225788,225846..225848,
                     226020..226022,226029..226031,226035..226037,
                     226077..226079,226083..226085)
                     /locus_tag="SMa0414"
                     /note="active site"
                     /db_xref="CDD:185715"
     misc_feature    order(225609..225611,225618..225626,225666..225674,
                     225678..225680,225684..225686,225786..225791,
                     225798..225806,226020..226022,226083..226085,
                     226089..226091)
                     /locus_tag="SMa0414"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:185715"
     misc_feature    226104..226439
                     /locus_tag="SMa0414"
                     /note="The Oligonucleotide/oligosaccharide binding
                     (OB)-fold domain of ATP-dependent DNA ligase LigD is a
                     DNA-binding module that is part of the catalytic core
                     unit; Region: OBF_DNA_ligase_LigD; cd07971"
                     /db_xref="CDD:153440"
     misc_feature    order(226149..226151,226197..226202,226206..226223,
                     226377..226379,226383..226388,226404..226406)
                     /locus_tag="SMa0414"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:153440"
     gene            226536..227393
                     /locus_tag="SMa0417"
                     /db_xref="GeneID:1235042"
     CDS             226536..227393
                     /locus_tag="SMa0417"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435468.1"
                     /db_xref="GI:16262675"
                     /db_xref="GeneID:1235042"
                     /translation="MKPELVAEIEFAGWTADGLVRQAAFKGLREDKPAKEVQAEKPSP
                     PAKTDTPEPGPSAKTRPVRRKGAKAEVMGVLISSPDKPLWPDAGDGEPVTKEDLARYH
                     EAVGTLFDLDPGPDVPFATVVAAAREMRDRLDELGLVSFCKTTGGKGLHVVTPFAVNK
                     RKPLSWAEAKGFAHDVCEQMARDNPDLYLIKMSKSLRGGRIFLDYLRNDRMATAVAPL
                     SPRARPGATVSMPLNWTQVKSDLYPKRFTVRTVPALLAKTTAWQDYCDGERPLEQAIK
                     RLGKSRRAA"
     misc_feature    <226539..226646
                     /locus_tag="SMa0417"
                     /note="The Oligonucleotide/oligosaccharide binding
                     (OB)-fold domain is a DNA-binding module that is part of
                     the catalytic core unit of ATP dependent DNA ligases;
                     Region: OBF_DNA_ligase_family; cl08424"
                     /db_xref="CDD:263645"
     misc_feature    226734..227381
                     /locus_tag="SMa0417"
                     /note="Predicted eukaryotic-type DNA primase [DNA
                     replication, recombination, and repair]; Region: COG3285"
                     /db_xref="CDD:225823"
     misc_feature    order(226863..226865,226869..226871,226968..226970,
                     226977..226982,226986..226988,227145..227147,
                     227172..227174)
                     /locus_tag="SMa0417"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238291"
     gene            227425..228318
                     /locus_tag="SMa5020"
                     /db_xref="GeneID:6435258"
     CDS             227425..228318
                     /locus_tag="SMa5020"
                     /note="Very similar to S; meliloti SMb21696"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000336.1"
                     /db_xref="GI:193782567"
                     /db_xref="GeneID:6435258"
                     /translation="MDEETKDQSSTSTRVGATTDLPHDRITLARFREAFPRARWSDRL
                     NAWFVPGRTAEKRISRWLAEMEAEADRFADEKGRDAFAFDPIESRYLEATPATLQIQT
                     PYSRTVVNEIREIPPARWDADRRLWTVPYRSFDELRRRWPTIEAAAERSEPEARRARR
                     EAIKGTQQDEASKARMRERRRKRYPVPADDAPPSDRAIGTHVGVVFFLGTDGELADPA
                     TVTAFYFPAANSEEYVWASWRLGSLEELVTTWPARTPPNKHELERGWWIPDLGELRIA
                     RRDAQSRRRARERKEKGECSR"
     gene            228306..228824
                     /locus_tag="SMa0421"
                     /db_xref="GeneID:1235043"
     CDS             228306..228824
                     /locus_tag="SMa0421"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435469.1"
                     /db_xref="GI:16262676"
                     /db_xref="GeneID:1235043"
                     /translation="MLPVKDQQTALEEFRSLPPIAPRELVGLWKGHGIPTGHPFDGVL
                     ENLSWFGKRFTPDMRVDALLFRSGDRRLVAIDPKWIPLRLALRFHEVGRMRVARNLFS
                     YLQRGLRAKGPVASSKTMVFGGVESAAMVYDHQPIVDHFRRIHADRIMGAMTIRNDER
                     IYFFELQRVDGP"
     misc_feature    228336..228515
                     /locus_tag="SMa0421"
                     /note="GXWXG protein; Region: GXWXG; pfam14231"
                     /db_xref="CDD:258423"
     misc_feature    228633..228809
                     /locus_tag="SMa0421"
                     /note="Domain of unknown function (DUF4334); Region:
                     DUF4334; pfam14232"
                     /db_xref="CDD:258424"
     gene            228821..229255
                     /locus_tag="SMa5021"
                     /db_xref="GeneID:6435259"
     CDS             228821..229255
                     /locus_tag="SMa5021"
                     /note="Very weak similarity, possibly spurious, to domain
                     of unknown function, DUF768"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000337.1"
                     /db_xref="GI:193782568"
                     /db_xref="GeneID:6435259"
                     /translation="MKCAQPAIIYRSPPVSMIALPSSLSAAVVRVRQGAPRKGRAPCS
                     FVSRVFLKLGGVILRTISVPKGSPRQEVQAMKPEQFLERWKSEHIDSGTQQSDATRLV
                     EDLLADAEKEGISRDMLVDAAGGGLVNYIVGAIKEAVEEELW"
     misc_feature    229058..229225
                     /locus_tag="SMa5021"
                     /note="Protein of unknown function (DUF768); Region:
                     DUF768; pfam05589"
                     /db_xref="CDD:114319"
     gene            complement(229290..230330)
                     /locus_tag="SMa0424"
                     /db_xref="GeneID:1235044"
     CDS             complement(229290..230330)
                     /locus_tag="SMa0424"
                     /function="Macromolecule metabolism; Macromolecule
                     synthesis, modification; proteins and peptides-translation
                     and modification"
                     /note="glimmer prediction; DNA ligase, PF1068"
                     /codon_start=1
                     /transl_table=11
                     /product="ATP-dependent DNA ligase"
                     /protein_id="NP_435470.1"
                     /db_xref="GI:16262677"
                     /db_xref="GeneID:1235044"
                     /translation="MSRRAKPLLQDDSVAKSKPARPRDPAQPNLPFDPMAERIEPCLA
                     LLKPVPPKGPDWVFEVKWDGYRLAIHIEPKGVRIITRGGHDWTHRFPAIAEATSKLGV
                     GTAILDGEAVVLDEEGRSDFGALQRSLGGRGGKRSSTESVFFAFDLLYFDGHDLSGTE
                     LSVRRHLLEGFLDGPTGAIQSSEEVFGDGALLEKACSMGLKGIIAKHRDWPYRSGRTG
                     DWLKIKCLQSESFMIVGYEQSLTARGGLGSLLLAGRKGHDWIYVGSVGTGFNTKDAEY
                     LRKTLDRLKTSKPAVPLKGKNLVFAQPTLIAEIEFRGWTHDGSLRHASYKGLREVQDN
                     AAVFDMSERAIL"
     misc_feature    complement(229656..230216)
                     /locus_tag="SMa0424"
                     /note="Adenylation domain of Mycobacterium tuberculosis
                     LigD and LigC-like ATP-dependent DNA ligases; Region:
                     Adenylation_DNA_ligase_LigD_LigC; cd07906"
                     /db_xref="CDD:185715"
     misc_feature    complement(229317..230204)
                     /locus_tag="SMa0424"
                     /note="DNA polymerase LigD, ligase domain; Region:
                     NHEJ_ligase_lig; TIGR02779"
                     /db_xref="CDD:234009"
     misc_feature    complement(order(229665..229667,229671..229673,
                     229713..229715,229719..229721,229728..229730,
                     229893..229895,229965..229967,230001..230003,
                     230088..230090,230133..230141,230145..230156))
                     /locus_tag="SMa0424"
                     /note="active site"
                     /db_xref="CDD:185715"
     misc_feature    complement(order(229659..229661,229665..229667,
                     229728..229730,229947..229955,229962..229967,
                     230073..230075,230079..230081,230085..230093,
                     230133..230141,230148..230150))
                     /locus_tag="SMa0424"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:185715"
     misc_feature    complement(229320..229652)
                     /locus_tag="SMa0424"
                     /note="The Oligonucleotide/oligosaccharide binding
                     (OB)-fold domain of ATP-dependent DNA ligase LigD is a
                     DNA-binding module that is part of the catalytic core
                     unit; Region: OBF_DNA_ligase_LigD; cd07971"
                     /db_xref="CDD:153440"
     misc_feature    complement(order(229359..229361,229365..229370,
                     229374..229376,229518..229535,229539..229544,
                     229590..229592))
                     /locus_tag="SMa0424"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:153440"
     gene            complement(230327..231133)
                     /locus_tag="SMa0426"
                     /db_xref="GeneID:1235045"
     CDS             complement(230327..231133)
                     /locus_tag="SMa0426"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435471.1"
                     /db_xref="GI:16262678"
                     /db_xref="GeneID:1235045"
                     /translation="MALRPYWKGYLKLSLVTCPVQMMPATSESEKVRFHTLNRQTQNR
                     VVSHYVDSVTGKEVKEEDEVKGYQRGEHEYVILEDEELENVALESTKTIDISTFTPRD
                     SIEWIWLDTPYCLSPNDPVGQEAFSVIRDAMEAQNMVGISRLVISRRERAVMLEPRGK
                     GIVLWTLRYGDEVRDEDSYFEAIGDEQADSEMMPLVQQLIKKQTKDWTPKMVADPVQE
                     RLLEIIAAKKKALKPQKAQGKTAPSSSPSNVVSIMDALRKSVAAEKRATK"
     misc_feature    complement(230330..231133)
                     /locus_tag="SMa0426"
                     /note="Ku-homolog [Replication, recombination, and
                     repair]; Region: COG1273"
                     /db_xref="CDD:224192"
     misc_feature    complement(230342..231124)
                     /locus_tag="SMa0426"
                     /note="Ku-core domain, Ku-like subfamily; composed of
                     prokaryotic homologs of the eukaryotic DNA binding protein
                     Ku. The alignment includes the core domain shared by the
                     prokaryotic YkoV-like proteins and the eukaryotic Ku70 and
                     Ku80. The prokaryotic Ku...; Region: KU_like; cd00789"
                     /db_xref="CDD:238408"
     misc_feature    complement(order(230693..230695,230987..230989,
                     231032..231034,231062..231064,231119..231121))
                     /locus_tag="SMa0426"
                     /note="putative DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238408"
     misc_feature    complement(order(230354..230356,230363..230365,
                     230453..230455,230492..230500,230513..230515,
                     230525..230527,230612..230614,230618..230626,
                     230705..230707,230762..230764,230807..230809,
                     230837..230842,230846..230848,230903..230905,
                     230912..230917,230927..230932,230936..230938,
                     230942..230950,230960..230962,230978..230986,
                     230990..231001,231008..231010,231023..231034,
                     231047..231052,231056..231064,231083..231085))
                     /locus_tag="SMa0426"
                     /note="putative homodimer interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238408"
     gene            complement(231427..232443)
                     /locus_tag="SMa0429"
                     /db_xref="GeneID:1235046"
     CDS             complement(231427..232443)
                     /locus_tag="SMa0429"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435472.1"
                     /db_xref="GI:16262679"
                     /db_xref="GeneID:1235046"
                     /translation="MADRFLALSKDDRREALAVAAARTGRPIHLLEKDVWVVWTLETL
                     YSSKLGEHLVFKGGTSLSKAYGAIRRFSEDIDLTYDIRALAPDLVGDNDEALPKTRSE
                     EKRWTSEVRKRLPVWVAESVEPVIAAAVRGQSLPARIRIEGDTLYLDYEAVSSGSGYV
                     APSVMLEFGARSTGEPASIRDVGCDAAGHVDGVEFPKASPRAMHAERTFWEKATAIHV
                     FCLQERPRGDRFARHWHDVVRLDDAGFADKAFAERQLANAVAKHKSMFFAEKAADRSP
                     IDYAAAGHLVLTPSGDGLRALSEDYAKMVDDGLLLGDSEPFEQLIERCALIQERANKV
                     GTTE"
     misc_feature    complement(231475..232329)
                     /locus_tag="SMa0429"
                     /note="Nucleotidyl transferase of unknown function
                     (DUF1814); Region: DUF1814; pfam08843"
                     /db_xref="CDD:255068"
     gene            complement(232436..233029)
                     /locus_tag="SMa0431"
                     /db_xref="GeneID:1235047"
     CDS             complement(232436..233029)
                     /locus_tag="SMa0431"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435473.1"
                     /db_xref="GI:16262680"
                     /db_xref="GeneID:1235047"
                     /translation="MQNLTSQILGYAEQMPEGSPLSAKSLLHLGNRAAVDQALSRLTE
                     RGELIRAGRGIYMRPVKSRFGSRPPTVEQAVEAVAQQRGEIIVSSGAAAANALGLTTQ
                     VPVRSVYLTSGRSRTMNLGKQSVELKHVPRWQLALADRPAGVAVRALAWLGPEKAEEA
                     LSRIKRKLPPAEFGELVAAAPQFPTWLARSVGRAAHG"
     misc_feature    complement(<232619..232924)
                     /locus_tag="SMa0431"
                     /note="Domain of unknown function (DUF4095); Region:
                     DUF4095; pfam13338"
                     /db_xref="CDD:257668"
     gene            233560..234030
                     /locus_tag="SMa0433"
                     /db_xref="GeneID:1235048"
     CDS             233560..234030
                     /locus_tag="SMa0433"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435474.1"
                     /db_xref="GI:16262681"
                     /db_xref="GeneID:1235048"
                     /translation="MTKVTVIAHSPGAPVSRRALLDAIRNQASWAGKTRLQLFAPAHI
                     GAYLNKVRKELGIASRLIASLTALTKFGVLSLDGLEPGSPFLTQLMEDSSKELANGWD
                     AQVKARQVIFGDGENVVMVQRFLEDPPHTVWPGHGHCSVCRCDKTAPAIASYLA"
     gene            complement(234248..234631)
                     /locus_tag="SMa0436"
                     /db_xref="GeneID:1235049"
     CDS             complement(234248..234631)
                     /locus_tag="SMa0436"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435475.1"
                     /db_xref="GI:16262682"
                     /db_xref="GeneID:1235049"
                     /translation="MSTTPTVHFEAASTLAVVVSSHEPLLFLSDDLKIIAASASFCRA
                     FDIDPTSVPGKKLGELGQGEWAMPKLESLLKATASRSADIQAYEIDLKRPNRGTRQLV
                     VNAQTLDDGDVEHIRLLVAVTDMER"
     misc_feature    complement(234257..234571)
                     /locus_tag="SMa0436"
                     /note="PAS domain; PAS motifs appear in archaea,
                     eubacteria and eukarya. Probably the most surprising
                     identification of a PAS domain was that in EAG-like
                     K+-channels. PAS domains have been found to bind ligands,
                     and to act as sensors for light and oxygen in...; Region:
                     PAS; cd00130"
                     /db_xref="CDD:238075"
     misc_feature    complement(234257..234568)
                     /locus_tag="SMa0436"
                     /note="PAS domain; Region: PAS_9; pfam13426"
                     /db_xref="CDD:257751"
     misc_feature    complement(order(234344..234346,234359..234361,
                     234443..234454,234491..234493,234509..234511,
                     234521..234523))
                     /locus_tag="SMa0436"
                     /note="putative active site [active]"
                     /db_xref="CDD:238075"
     misc_feature    complement(order(234317..234319,234323..234325,
                     234410..234415,234422..234424,234449..234451,
                     234461..234463))
                     /locus_tag="SMa0436"
                     /note="heme pocket [chemical binding]; other site"
                     /db_xref="CDD:238075"
     gene            236016..236381
                     /locus_tag="SMa5022"
                     /db_xref="GeneID:6435260"
     CDS             236016..236381
                     /locus_tag="SMa5022"
                     /note="Amino-terminus has similarity to conserved
                     hypothetical proteins of COG5579; Carboxy-terminus has
                     similarity to a short stretch of amino acids found in
                     eukaryotic-type DNA primases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000338.1"
                     /db_xref="GI:193782569"
                     /db_xref="GeneID:6435260"
                     /translation="MAENDPFELSRLVAAQDLVFETVLAELRAGRKETRWMWFIFPQL
                     RALGRSPTANFYGIGSIEEARAYLPWTQVQSNLDPKRFTVRTVPALLAKAGAWEEYYD
                     GQRPHEQAIKRLGKHKAAA"
     misc_feature    236025..>236225
                     /locus_tag="SMa5022"
                     /note="Protein of unknown function (DUF1810); Region:
                     DUF1810; cl02370"
                     /db_xref="CDD:261260"
     misc_feature    <236217..236369
                     /locus_tag="SMa5022"
                     /note="AE_Prim_S_like: primase domain similar to that
                     found in the small subunit of archaeal and eukaryotic
                     (A/E) DNA primases. The replication machineries of A/Es
                     are distinct from that of bacteria. Primases are
                     DNA-dependent RNA polymerases which synthesis...; Region:
                     AE_Prim_S_like; cl01287"
                     /db_xref="CDD:260873"
     gene            236378..236794
                     /locus_tag="SMa5023"
                     /db_xref="GeneID:6435261"
     CDS             236378..236794
                     /locus_tag="SMa5023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000339.1"
                     /db_xref="GI:193782570"
                     /db_xref="GeneID:6435261"
                     /translation="MTFESPGGDHTKRMKKSNIPIEQLTRLRRIRGLARLMDTALRIP
                     GTRMSLGADSVLGLIPGVGDFAAAAVSLIIVNEARRLGVPNDKLVKMLVNVGFDTVAG
                     SVPVLGDVFDVYFKSNRRNLQLVLDHFGLDHADLDR"
     misc_feature    236453..236764
                     /locus_tag="SMa5023"
                     /note="Domain of unknown function (DUF4112); Region:
                     DUF4112; pfam13430"
                     /db_xref="CDD:257755"
     repeat_region   complement(236849..238167)
                     /standard_name="ISRm1"
                     /note="SMa3003; predicted by homology"
                     /rpt_family="ISRm1"
     gene            complement(236878..237708)
                     /locus_tag="SMa0444"
                     /db_xref="GeneID:1235052"
     CDS             complement(236878..237708)
                     /locus_tag="SMa0444"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /note="glimmer prediction; integrase core domain, PF00665;
                     identical to hypothetical protein 2 from R. meliloti ISRm1
                     (accession S37716)"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm1b transposase"
                     /protein_id="NP_435478.2"
                     /db_xref="GI:193782571"
                     /db_xref="GeneID:1235052"
                     /translation="MKTVCETLGVARSNIAARAAGSPSRARGRPPLPDRELVEDIKAV
                     IADMPTYGYRRVHAILRRNARKLGRSWPNAKRVYRVMKLHNLLLVRHTGAVDDRLHEG
                     QVAVERSNIRWCSDGFEIGCDNKEKVRVAFALDCCDREAIAHVATTEGIKSQDVQDLV
                     ITAVENRFGRINMLSEPIEWLTDNGSCFVARDTASLLRDIGMEPCTTPVRSPQSNGMA
                     EAFVKTFKRDYVSVNPTPDAETVMAQLPFWFEHYNNLHPHSALGYQSPREFISSQSQT
                     "
     misc_feature    complement(236887..237609)
                     /locus_tag="SMa0444"
                     /note="insertion element IS2 transposase InsD;
                     Provisional; Region: PRK14702"
                     /db_xref="CDD:237792"
     misc_feature    complement(237436..237609)
                     /locus_tag="SMa0444"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(237028..237393)
                     /locus_tag="SMa0444"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(236911..237108)
                     /locus_tag="SMa0444"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(237705..238097)
                     /locus_tag="SMa0445"
                     /db_xref="GeneID:1235053"
     CDS             complement(237705..238097)
                     /locus_tag="SMa0445"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /note="glimmer prediction; transposase, PF01527; ISRm1;
                     start codon changed based on homology"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm1a transposase"
                     /protein_id="NP_435479.1"
                     /db_xref="GI:16262686"
                     /db_xref="GeneID:1235053"
                     /translation="MTSSNFKMEVLSGPERRRRWSTAEKLAIIHETYEADATVSIVAR
                     RHGIQPNQLFAWRKLASQGALTATAAEEEVVPASEYRALQAQVKELQRLLGKKTMESE
                     ILKEALEIAGSPKKHLLRSLSLPRGILG"
     misc_feature    complement(237723..238061)
                     /locus_tag="SMa0445"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     misc_feature    complement(237729..238061)
                     /locus_tag="SMa0445"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            238528..239649
                     /locus_tag="SMa0447"
                     /db_xref="GeneID:1235054"
     CDS             238528..239649
                     /locus_tag="SMa0447"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; domain of unknown function,
                     DUF20, PF01594"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435480.1"
                     /db_xref="GI:16262687"
                     /db_xref="GeneID:1235054"
                     /translation="MSMVTQGKLIGQLLAFGALGLLAIGCTLVLWPFLSAILWAAVIC
                     FSTWPAYRLFERAVGGYRALAAAAMTVLVVVVIVAPLALLATTLADNISSLVAGVTHV
                     LEQGPPAPPDWVRGLPIAGEGLATYWEGLAHNAPAFTIELKKVIGPFADVALIGGTLF
                     GAGLLELALSIFIGFFLFLHGRRMTALTRQIAERVAGARARRLLSVVGVTVTGVVYGL
                     IGTALAQGLLAGVGFWIAGVPQALLLGCLTFVLSFVPAGPPFVWGPVALWLFMQESVW
                     WGIFVAIWGLLLVSSIDNFLRPYLLGRNTNLPVLLGLFGLIGGVLAFGLIGLFLGPTL
                     LAVAHSLFREWIAAELEERRQPPSSSTGRDQRSGPRQGG"
     misc_feature    238597..239604
                     /locus_tag="SMa0447"
                     /note="Predicted permease, member of the PurR regulon
                     [General function prediction only]; Region: yhhT; COG0628"
                     /db_xref="CDD:223701"
     gene            complement(240025..240435)
                     /locus_tag="SMa0448"
                     /db_xref="GeneID:1235055"
     CDS             complement(240025..240435)
                     /locus_tag="SMa0448"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435481.1"
                     /db_xref="GI:16262688"
                     /db_xref="GeneID:1235055"
                     /translation="MVGLLTGLELMAILGVGPVVAAGWLAATAAGAVAGAVAGGAAGG
                     LIGALTDSGVDEEDAHVFAKGVRRGGTFVTARVDDTLAPEAQAILQDLNRVDPAARWG
                     VFAQEEWTRFDENADPYTLEAVPLYDAVTASKDW"
     gene            240985..241272
                     /locus_tag="SMa0450"
                     /db_xref="GeneID:1235056"
     CDS             240985..241272
                     /locus_tag="SMa0450"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435482.1"
                     /db_xref="GI:16262689"
                     /db_xref="GeneID:1235056"
                     /translation="MVTEMSSEKMRKLIQDYQRDIAAYLAPESGISERQLLQQLASRL
                     DGQQAQDALGNGWQGWLPDDEDPAAADDGSPAPTRWWTEPEFFGTMWKLRS"
     gene            243155..243562
                     /locus_tag="SMa0453"
                     /db_xref="GeneID:1235058"
     CDS             243155..243562
                     /locus_tag="SMa0453"
                     /function="Elements of external origin; Plasmid-related
                     functions"
                     /note="glimmer prediction; homologous to possible plasmid
                     stability locus Yle from Agrobacterium tumefaciens
                     octopine-type Ti plasmid"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435484.1"
                     /db_xref="GI:16262691"
                     /db_xref="GeneID:1235058"
                     /translation="MYLVDTNIVSEARRGTPQAVSWLRSVDPLSIHLSALSLGEIMRG
                     IALKQRSDPKTAAHLTEWLRKLRHDHGDRILPITDQIAVEWGRIAAIRPRGDIDGLIA
                     ATAIVHDLILVTRNVKDFEDTDASVINPWETSA"
     misc_feature    243161..243526
                     /locus_tag="SMa0453"
                     /note="PIN domain of ribonucleases (toxins), VapC and
                     FitB, of prokaryotic toxin/antitoxin operons, Pyrococcus
                     horikoshii protein PH0500, and other similar bacterial and
                     archaeal homologs; Region: PIN_VapC-FitB; cd09881"
                     /db_xref="CDD:189051"
     misc_feature    order(243164..243172,243179..243184,243188..243196,
                     243215..243217,243224..243226,243245..243247,
                     243257..243262,243266..243274,243278..243286,
                     243323..243325,243332..243334,243374..243376,
                     243380..243388,243401..243403,243407..243412,
                     243419..243424,243437..243439,243443..243448,
                     243452..243457,243512..243514)
                     /locus_tag="SMa0453"
                     /note="oligomeric interface; other site"
                     /db_xref="CDD:189051"
     misc_feature    order(243167..243169,243272..243274,243446..243448,
                     243500..243502)
                     /locus_tag="SMa0453"
                     /note="putative active site [active]"
                     /db_xref="CDD:189051"
     misc_feature    order(243257..243262,243269..243274,243278..243283,
                     243326..243331,243338..243340,243383..243385,
                     243398..243403,243407..243415,243419..243424,
                     243440..243445,243449..243451)
                     /locus_tag="SMa0453"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:189051"
     repeat_region   245057..246355
                     /standard_name="ISRm3"
                     /note="SMa3004; predicted by homology"
                     /rpt_family="ISRm3"
     gene            245116..246318
                     /locus_tag="SMa0461"
                     /db_xref="GeneID:1235060"
     CDS             245116..246318
                     /locus_tag="SMa0461"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm3 transposase"
                     /protein_id="NP_435486.1"
                     /db_xref="GI:16262693"
                     /db_xref="GeneID:1235060"
                     /translation="MAIEKELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELD
                     DHLDVERLEGGPANRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDF
                     DDKIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYP
                     LVFFDAIRVKIRDEGFVRNKAVYVALAVLADGSKEILGLWIEQTEGAKFWLRVMNELK
                     NRGCQDILIAVVDGLKGFPEAITAVFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPAL
                     RAIYRARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYT
                     TNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAV
                     IFGERFFN"
     misc_feature    245122..246252
                     /locus_tag="SMa0461"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; pfam00872"
                     /db_xref="CDD:250193"
     misc_feature    245185..246303
                     /locus_tag="SMa0461"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(246386..248227)
                     /locus_tag="SMa0462"
                     /db_xref="GeneID:1235061"
     CDS             complement(246386..248227)
                     /locus_tag="SMa0462"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435487.1"
                     /db_xref="GI:16262694"
                     /db_xref="GeneID:1235061"
                     /translation="MVTKKKARAKQTPKRLDVMKATKNKAETANAAAFEIPEQAGKFL
                     RDTSIPQGFANPQPIVLAELQKRVTEMNLRPTVSLEQFLASANRIKPVDLPIEELSDD
                     VKESIPALKPEIRRFHGVKIPLYWFPFPWLSSVCSDRFGYMSSAATRAATKLPFNVAT
                     QALLGQLGNMMGDAGRDPNPASHNPADAGVSSLPAGFTYFAQFVDHDITFDVSSTLDA
                     DIDANTVNNMRSPALDLDSLYGRGPGLDPFLYVFPTSGPATAIKLHRGTNTPVGPGGP
                     SNNGNPSGMLQQTNWDVPRMQGTNTAVTGDPRNDENLIIVQFHHAMLRFHNAVVDLLL
                     AAAFAGDIFAEAKRIVTHHYQWAVVHDFLERICGVATVNNAIASVSAPIGSSFRMPVE
                     FAVAAYRFGHSMIRDTYWVNFNFPNATLGQVFEFNRIPRLPVFSNWVVDFNAFFDTGV
                     PVPVHNKARKIDSLMASGLESLPGFSGMMAILATRNLRRALALGLPSGQGMANSFGIA
                     PMTAAQLIFGLPPAEVAVLNASGGLLLNKTPLWYYVLREAAVLAGGNQLGAVGGRIVA
                     ETFVRILKRDASSYLNVAGGFTPILPSSTPGNFTVADLVAFVGVTQP"
     misc_feature    complement(246398..247816)
                     /locus_tag="SMa0462"
                     /note="Uncharacterized bacterial family of heme
                     peroxidases; Region: An_peroxidase_bacterial_1; cd09819"
                     /db_xref="CDD:188651"
     misc_feature    complement(order(246761..246763,246773..246775,
                     246782..246784,246821..246823,246956..246958,
                     247013..247015,247022..247024,247028..247036,
                     247043..247045,247292..247297))
                     /locus_tag="SMa0462"
                     /note="putative heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:188651"
     misc_feature    complement(order(246509..246511,246518..246523,
                     246530..246535,246545..246547,246557..246559,
                     247028..247030,247034..247036,247046..247048,
                     247100..247102,247112..247117,247124..247126))
                     /locus_tag="SMa0462"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:188651"
     gene            complement(248442..251618)
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /db_xref="GeneID:1235062"
     CDS             complement(248442..251618)
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /EC_number="4.6.1.1"
                     /function="Small molecule metabolism; Global functions"
                     /note="glimmer prediction; possible adenylate cyclase
                     domain"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate cyclase"
                     /protein_id="NP_435488.1"
                     /db_xref="GI:16262695"
                     /db_xref="GeneID:1235062"
                     /translation="MAVIRRPSRSLTPTEEIALARPEPPAEDVRKTITILIADIVDSS
                     RLSLTLDPEALRELFARYFDEMTSTIQRHGGVVDRYVGDEILAVFGVPTLHEDDALRA
                     VSAAVDMRDTLARLNHEFETGWGVQLAHRIGLNTGEVFTGIDRWGHRFLTGEAVRVAK
                     RLQEAAAANEILMGEATHKLVRHAVVVESSSPRAVKHGETFPAIIVLTVIARTTGFQR
                     RFDTPFVGRKRQLAMISTLLGDFVSNRTCHLLTVLGEAGVGKSRLVSEVAGNLAREMT
                     VAHGRCLPYGDGITYWLLADIVREIFRAGGGDSGKLSVAAIAEVLAGVDKAKLIAERI
                     AGLLGFGAGDPGTREETFWAVRRLFEVFARERPVVIVVEDLHWADPTLLDFIEHLVDF
                     SHGFPIMIVATARPELLDTRPGWGGGTPNATTIALEPLSEAESRDMVLNLLHRLPLSP
                     AVELMITRAVGGNPLFAEELVAMLVDEELLRRNEDCWVAREDLSELPVPSTIIALLAA
                     RLEGLTSQERAILTAAAVEGAVFHRSAVDELARPAPKALGDGLLSLVRRDLIRPEAPS
                     FVGEETYRFRHDMIREAAYRSLPKNARADLHERFASWLEITAKERLREFEEVVGYHLE
                     QAFQYRIALGPRGARAASLAARACERLEAAGRRALVRSDLSAAISLLERVSRLLLADD
                     PRRIALLAELSGALIESGRLDDAGRVLEEAGGLAGAAMDRRLAAHVRVQRQFLRLLHG
                     EEGGLEKAAQAAAEVIPVFEGFGDDLGLCRARRLEAWLFFNGARGEAAAAAWERAAAH
                     ARRAGNLHEYYEILTWIASSLWFGPTPAAEGIRRCEAMRAEVGESLESEAAILRQLAC
                     LNAVVGRFAIARELIAASNATYADLGLTLYVASSEHEAVVELLAGNPAAAERSARAAY
                     RALEEMGERAFRSTMAASLAVVILEQGRDEEAEDFAKLSAQLAASGDLVTQVRWRRVR
                     ARVLARRAEISAAEALAREALEIAEKTDFINDRADALVDLSHVLEASRRRDEAVAAAT
                     GAVHLYELKGNVVAAAATRLRLGKLVAM"
     misc_feature    complement(250962..251618)
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    complement(251031..251525)
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(251031..251033,251136..251141,
                     251148..251153,251163..251165,251361..251363,
                     251370..251378,251382..251384,251487..251504,
                     251508..251510))
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(251370..251372,251502..251504))
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(251031..251033,251148..251150,
                     251157..251162,251190..251192,251199..251201,
                     251379..251384,251418..251420,251430..251432,
                     251439..251444,251451..251453,251487..251489))
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(248445..250952)
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /note="Predicted ATPase [General function prediction
                     only]; Region: COG3899"
                     /db_xref="CDD:226415"
     misc_feature    complement(250416..250952)
                     /gene="cyaI2"
                     /locus_tag="SMa0464"
                     /note="AAA ATPase domain; Region: AAA_16; pfam13191"
                     /db_xref="CDD:257559"
     gene            252021..253625
                     /locus_tag="SMa0466"
                     /db_xref="GeneID:1235063"
     CDS             252021..253625
                     /locus_tag="SMa0466"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; bacterial extracellular
                     solute-binding protein, family 5, PF00496"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435489.1"
                     /db_xref="GI:16262696"
                     /db_xref="GeneID:1235063"
                     /translation="MAIEFTRRSILAAGMAHAAFVSVTGTFVIARAAKAAEQIELVTW
                     ALPSIPDTLFIPHAWTTYTGAIMSLVQEGLLGFGEDLGLETALADRWEEVDPTTIKYH
                     LRGGVKFGDGSPLAADDIVATFKYHMSPDSPSQLASFYNSVATVEATAPDEVTVKLKA
                     PNVQFAFTPAHMAGFVFKKEQLADKNIGTPEALPLGTGAYKLVEFVPTDRVILEARDD
                     YSGPKPAVKRITFKAIPDRPARLLAMQQGEIDGTFDLAISDIDQWKALGNVDVVAAPS
                     LGVYLLTLDHSAPPFDDIHVRRAVAYSVDRNGLVQALLKGNGEAATALNPPEIWSGVL
                     PPDEVRAFYATLLPNYAFDLNKAKAELAQSNHPDGFDVTIPASTADPYMVNILQSVTE
                     NLKQIGIRAHIQESDNNTWFTNYVTHDKLGMQIMAYYPDFADAANYPSLFFSSANAEK
                     GGMNGSNFNNREVDAKLKIANENADPKARADALKKVFTIANEEVAVVPIFWPASAMAI
                     NNKYKLTGYNAFWYSIPWAMRGFGPK"
     misc_feature    252021..253604
                     /locus_tag="SMa0466"
                     /note="ABC-type dipeptide transport system, periplasmic
                     component [Amino acid transport and metabolism]; Region:
                     DdpA; COG0747"
                     /db_xref="CDD:223818"
     misc_feature    252144..253559
                     /locus_tag="SMa0466"
                     /note="The substrate-binding domain of an ABC-type
                     nickel/oligopeptide-like import system contains the type 2
                     periplasmic binding fold; Region:
                     PBP2_NikA_DppA_OppA_like; cd00995"
                     /db_xref="CDD:173853"
     gene            253863..254879
                     /locus_tag="SMa0467"
                     /db_xref="GeneID:1235064"
     CDS             253863..254879
                     /locus_tag="SMa0467"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; start codon changed based on
                     homology"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435490.1"
                     /db_xref="GI:16262697"
                     /db_xref="GeneID:1235064"
                     /translation="MHRAAPSTGLTAISGGANGGSSLVVFITRRFAVTIPLLLIISFG
                     VFALIHIAPGDPVSSLLGARASDPATLAAIRARYHLDDSLLVQYGTWLSQVIRGDLGV
                     SILGNRSVTSTIADRLGVTIFLSLMSTTLVLGLGILLGALAAFRRGTGLDRTVVMFSV
                     FGISSPAFVTGIFFLYVFGVLLHWFPTFGAGTGFLDRAWHLALPALALAASTMAIVVK
                     ITRAAVIEELARDYVTFARARGVSSRRILLAYVLRNSLIPVITAAGLIVIGILAGAIY
                     VEVTFSLPGLGALMIDAVQKRDIPTIQGITLLFSAFVVLVNLAVDVIYTLIDPRIRFG
                     RVGS"
     misc_feature    253938..254867
                     /locus_tag="SMa0467"
                     /note="ABC-type dipeptide/oligopeptide/nickel transport
                     systems, permease components [Amino acid transport and
                     metabolism / Inorganic ion transport and metabolism];
                     Region: DppB; COG0601"
                     /db_xref="CDD:223674"
     misc_feature    254298..254828
                     /locus_tag="SMa0467"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(254325..254336,254340..254369,254376..254381,
                     254385..254387,254493..254498,254502..254504,
                     254508..254510,254517..254522,254526..254528,
                     254538..254543,254550..254552,254601..254603,
                     254643..254648,254655..254657,254676..254687,
                     254694..254699,254724..254729,254778..254783,
                     254790..254795,254799..254804,254811..254816,
                     254823..254828)
                     /locus_tag="SMa0467"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(254343..254387,254676..254693)
                     /locus_tag="SMa0467"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(254385..254387,254478..254480,254694..254696,
                     254718..254720,254727..254729,254778..254780)
                     /locus_tag="SMa0467"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(254553..254591,254607..254612,254622..254624)
                     /locus_tag="SMa0467"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            254921..255718
                     /locus_tag="SMa0469"
                     /db_xref="GeneID:1235065"
     CDS             254921..255718
                     /locus_tag="SMa0469"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; start codon changed based on
                     codon usage and homology; binding-protein-dependent
                     transport systems inner membrane component motif, PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435491.2"
                     /db_xref="GI:193782572"
                     /db_xref="GeneID:1235065"
                     /translation="MPVPVVVLFAALIIAAVVICAVLGERIAPDSPFLQRLGVGDTPP
                     SQDHIAGTDLLGRDVLSRVIYGARTALAGPVVVAAGAFAISTLLGLLSGYLGGLVDSA
                     IMRWVDFMFALPGPLVAIVVVGVVGGGYWTAVLVLVVLFTAPDTRIVRSAVLEQRPLA
                     YIDAARTLGISKTRILFVHILPNIAPIILAYVVLDFAFALVNLAGLSFLGLGVEPGTP
                     DWGRMLFENRTILFSNPAALLLPAGMIILTAVSMNLVGDWLFERFSK"
     misc_feature    254939..255709
                     /locus_tag="SMa0469"
                     /note="nickel ABC transporter, permease subunit NikC;
                     Region: nickel_nikC; TIGR02790"
                     /db_xref="CDD:131837"
     misc_feature    255143..255664
                     /locus_tag="SMa0469"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(255167..255172,255179..255184,255197..255199,
                     255227..255238,255242..255271,255278..255280,
                     255338..255343,255347..255349,255353..255355,
                     255362..255367,255371..255373,255383..255388,
                     255395..255397,255446..255448,255488..255493,
                     255500..255502,255521..255532,255539..255544,
                     255584..255589,255617..255622,255629..255634,
                     255638..255643,255650..255655,255662..255664)
                     /locus_tag="SMa0469"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(255245..255280,255521..255538)
                     /locus_tag="SMa0469"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(255323..255325,255539..255541,255578..255580,
                     255587..255589,255617..255619)
                     /locus_tag="SMa0469"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(255398..255436,255452..255457,255467..255469)
                     /locus_tag="SMa0469"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            255727..257562
                     /locus_tag="SMa0470"
                     /db_xref="GeneID:1235066"
     CDS             255727..257562
                     /locus_tag="SMa0470"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; ABC transporter PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435492.2"
                     /db_xref="GI:193782573"
                     /db_xref="GeneID:1235066"
                     /translation="MAREGQESPLLKVEGLAISHGDVPITLPLEIVVERGETIAIVGE
                     SGSGKSLTARAIVGILPPGINAKGAVTLDGVPLMRLAERELRTIRGSRVSMLMQDPFT
                     MLNPLMRSGDHIDEMLRDRPEFASRAVRADEVKRRLAEVGIVDEDVARRMPFQLSGGM
                     CQRVALAAALARDPELLIADEPSTALDVTTQAEIIKLLRRIQRERNMAVILITHNLRL
                     AFSTCQRIYVLYAGSMLEVGDAAAVERQPFHPYTLGLLLSEPPVDIRVPRLVAIRGSV
                     PRAADVIDSCGFADRCEWAKQICRAGKPSLAARDASRFTACIRQDEIQGELDALRSAT
                     LSATPETPRRGGTAGALVHVDALVKTFAGRRGRPICAIRDVSLHIMAGESVGLVGESG
                     SGKTTIGRCLVGLETPTDGDIRINGIAAADFGAMAKADRDRVRRTIQMIFQDPYSTLN
                     PKHSVGQALREALGASAGAPSPAPQERIASLLAEVGLSAAYATRRPASLSGGERQRVA
                     IARALAVKPAILVCDEPVSALDVSVQAQVLNLFRRLQVEHELSYLFITHDLAVVRQIA
                     ERIYVLYLGEIVEEGPTERVISNPQHPYTRRLIESIVRSAIQRAP"
     misc_feature    255748..257532
                     /locus_tag="SMa0470"
                     /note="ATPase components of various ABC-type transport
                     systems, contain duplicated ATPase [General function
                     prediction only]; Region: COG1123"
                     /db_xref="CDD:224048"
     misc_feature    255754..256440
                     /locus_tag="SMa0470"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    255853..255876
                     /locus_tag="SMa0470"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(255862..255867,255871..255879,256018..256020,
                     256264..256269,256366..256368)
                     /locus_tag="SMa0470"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    256009..256020
                     /locus_tag="SMa0470"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    256192..256221
                     /locus_tag="SMa0470"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    256252..256269
                     /locus_tag="SMa0470"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    256276..256287
                     /locus_tag="SMa0470"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    256354..256374
                     /locus_tag="SMa0470"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    256423..256644
                     /locus_tag="SMa0470"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     misc_feature    256777..257469
                     /locus_tag="SMa0470"
                     /note="ATP-binding cassette domain of nickel/oligopeptides
                     specific transporters; Region: ABC_NikE_OppD_transporters;
                     cd03257"
                     /db_xref="CDD:213224"
     misc_feature    256891..256914
                     /locus_tag="SMa0470"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    order(256900..256905,256909..256917,257053..257055,
                     257293..257298,257395..257397)
                     /locus_tag="SMa0470"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213224"
     misc_feature    257044..257055
                     /locus_tag="SMa0470"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213224"
     misc_feature    257221..257250
                     /locus_tag="SMa0470"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213224"
     misc_feature    257281..257298
                     /locus_tag="SMa0470"
                     /note="Walker B; other site"
                     /db_xref="CDD:213224"
     misc_feature    257305..257316
                     /locus_tag="SMa0470"
                     /note="D-loop; other site"
                     /db_xref="CDD:213224"
     misc_feature    257383..257403
                     /locus_tag="SMa0470"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213224"
     misc_feature    257458..>257532
                     /locus_tag="SMa0470"
                     /note="Oligopeptide/dipeptide transporter, C-terminal
                     region; Region: oligo_HPY; cl07097"
                     /db_xref="CDD:263181"
     gene            258225..258533
                     /locus_tag="SMa0471"
                     /db_xref="GeneID:1235067"
     CDS             258225..258533
                     /locus_tag="SMa0471"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435493.1"
                     /db_xref="GI:16262700"
                     /db_xref="GeneID:1235067"
                     /translation="MASNALVQTRIDAEVKERATAVLENMGLTVSDAVRILLTRTANE
                     GALPLELFSHSEAHDAWFRAKVLRALEDTRPDVDDADADAHFRERRAAALRKAAAGDR
                     "
     misc_feature    258225..>258449
                     /locus_tag="SMa0471"
                     /note="DNA-damage-inducible protein J [DNA replication,
                     recombination, and repair]; Region: RelB; COG3077"
                     /db_xref="CDD:225619"
     gene            258530..258823
                     /locus_tag="SMa0473"
                     /db_xref="GeneID:1235068"
     CDS             258530..258823
                     /locus_tag="SMa0473"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435494.1"
                     /db_xref="GI:16262701"
                     /db_xref="GeneID:1235068"
                     /translation="MRLVWARYALDDRDTIFSYIERENPRAAVHVDEEIVSAVRRLLD
                     FPESGRPGRIAGTRELVIPRTPYIAAYMVMEDRIRILRVLHGAQKWPSELDDG"
     misc_feature    258530..258817
                     /locus_tag="SMa0473"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     repeat_region   258869..260541
                     /standard_name="ISRm17"
                     /note="SMa4001; predicted by homology"
                     /rpt_family="ISRm17"
     gene            259012..259911
                     /locus_tag="SMa0475"
                     /db_xref="GeneID:1235069"
     CDS             259012..259911
                     /locus_tag="SMa0475"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm17a transposase"
                     /protein_id="NP_435495.1"
                     /db_xref="GI:16262702"
                     /db_xref="GeneID:1235069"
                     /translation="MRQERTVQGSIFDLFAEHEIGRELEAMSQWLDAHRDLLNLVTSD
                     LRRQGVTETGRQGLPSEAVLRCALLKQYRQLSYEELAFHLEDSASFRAFARLPWGWSP
                     KKSVLHKTISAIRADTWEAVNKMLLASARQERLESGRVVRVDSTVTAALIHEPSDSSL
                     LWDCVRVMVRLLQQADSLGSTIPWHDHCRAAKKRARVIEYTRGRPKRVQHYRALLRIA
                     RNTLDYLQQAAAQLPLAAGPAGKLWQAQVRHYQPLITQIIAQTERRVLAGEAVPAGEK
                     LVSLFEPHADIIVKGSRERRLRT"
     misc_feature    259012..259650
                     /locus_tag="SMa0475"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [DNA replication, recombination, and repair]; Region:
                     COG3039"
                     /db_xref="CDD:225581"
     misc_feature    259171..259392
                     /locus_tag="SMa0475"
                     /note="Transposase domain (DUF772); Region: DUF772;
                     pfam05598"
                     /db_xref="CDD:253271"
     gene            259996..260349
                     /locus_tag="SMa0476"
                     /db_xref="GeneID:1235070"
     CDS             259996..260349
                     /locus_tag="SMa0476"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm17b transposase"
                     /protein_id="NP_435496.1"
                     /db_xref="GI:16262703"
                     /db_xref="GeneID:1235070"
                     /translation="MPLLERHIAFYGEAPRQAAADGGYASRENLRQAKAWGVRDMAFH
                     KKSGLRIEDMVRSRWVYRKLRNFRAGIEAGISCLKRTYGLARCTWRGLDHFKTYVWSS
                     VVAYNLALFARLRPT"
     misc_feature    <259999..260346
                     /locus_tag="SMa0476"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [DNA replication, recombination, and repair]; Region:
                     COG3039"
                     /db_xref="CDD:225581"
     misc_feature    <260173..260319
                     /locus_tag="SMa0476"
                     /note="Transposase DDE domain; Region: DDE_Tnp_1_6;
                     pfam13751"
                     /db_xref="CDD:258043"
     gene            complement(260764..261969)
                     /locus_tag="SMa0478"
                     /db_xref="GeneID:1235071"
     CDS             complement(260764..261969)
                     /locus_tag="SMa0478"
                     /EC_number="1.2.2.1"
                     /function="Small molecule metabolism; Degradation; carbon
                     compounds"
                     /note="Catalyzes the reversible two-electron oxidation of
                     formate to carbon dioxide. It allows the assimilation of
                     carbon dioxide and provides energy for growth through
                     oxidative phosphorylation coupled to the reduction of
                     oxygen, nitrate, sulphate or fumarate"
                     /codon_start=1
                     /transl_table=11
                     /product="formate dehydrogenase"
                     /protein_id="NP_435497.1"
                     /db_xref="GI:16262704"
                     /db_xref="GeneID:1235071"
                     /translation="MEMAKVACVLYDDPVDGYPTAYARDGLPTLERYPGGQTLPTPKA
                     IDFEPGALLGSVSGELGLRKFLEGQGHTLVVTSDKDGPDSVFERELVDAEIVISQPFW
                     PAYLTAERIVKAARLKLAITAGIGSDHVDLQAAIDRGITVAEVTYCNSISVSEHVVMM
                     ILSLARNYIPSYQWVVKGGWNVADCVARSYDIEGMDIGTVGAGRIGTAVLRRLKPFDV
                     KLHYTDRHRLPDEVAKELGVTFHQTAAEMVPVCDVVTINAPLHPETENLFNEAMIGKM
                     KRGAYLVNTARGKICNRDAVARALESGQLAGYAGDVWFPQPAPKDHPWRSMPHHGMTP
                     HISGSSLSAQARYAAGTREILECWFEGRPIREEYLIVSGGKLAGAGAHSYSAGDATRG
                     SEEAAHFKT"
     misc_feature    complement(260809..261963)
                     /locus_tag="SMa0478"
                     /note="formate dehydrogenase; Provisional; Region:
                     PRK07574"
                     /db_xref="CDD:181041"
     misc_feature    complement(260830..261960)
                     /locus_tag="SMa0478"
                     /note="NAD-dependent Formate Dehydrogenase (FDH); Region:
                     FDH; cd05302"
                     /db_xref="CDD:240627"
     misc_feature    complement(order(260932..260934,260938..260940,
                     260944..260955,260959..260982,260992..260997,
                     261010..261012,261016..261024,261031..261033,
                     261322..261327,261334..261339,261385..261387,
                     261391..261405,261409..261438,261442..261459,
                     261463..261468,261472..261474,261481..261486,
                     261493..261498,261502..261507,261514..261519,
                     261814..261816,261931..261939))
                     /locus_tag="SMa0478"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:240627"
     misc_feature    complement(order(261523..261525,261595..261600,
                     261667..261672))
                     /locus_tag="SMa0478"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:240627"
     misc_feature    complement(order(260956..260961,260965..260967,
                     261034..261039,261109..261117,261178..261180,
                     261187..261189,261193..261201,261292..261300,
                     261355..261363,261367..261369,261511..261513,
                     261520..261525,261595..261597,261667..261669))
                     /locus_tag="SMa0478"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240627"
     misc_feature    complement(order(260965..260967,261022..261024,
                     261109..261111))
                     /locus_tag="SMa0478"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240627"
     gene            262378..262674
                     /locus_tag="SMa5024"
                     /db_xref="GeneID:6435262"
     CDS             262378..262674
                     /locus_tag="SMa5024"
                     /note="Has similarity to the central region of a group of
                     conserved hypothetical proteins, including S; meliloti
                     SMa2147, which contain a region with weak similarity to
                     ParB-like nuclease domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000340.1"
                     /db_xref="GI:193782574"
                     /db_xref="GeneID:6435262"
                     /translation="MVFADTRSAGTWYLLDGHLRLEALKELGFAKVECLVATDDDTYT
                     YNKRVNRLAPIEEHRMIARAIERGVSSADIADAWGFRWSPSFAGSVCWKASAPR"
     misc_feature    <262396..262503
                     /locus_tag="SMa5024"
                     /note="ParB-like nuclease domain; Region: ParBc; cl02129"
                     /db_xref="CDD:261190"
     misc_feature    262408..>262620
                     /locus_tag="SMa5024"
                     /note="Stage 0 sporulation protein J (antagonist of Soj)
                     containing ParB-like nuclease domain [Transcription];
                     Region: Spo0J; COG1475"
                     /db_xref="CDD:224392"
     misc_feature    262519..>262650
                     /locus_tag="SMa5024"
                     /note="RepB plasmid partitioning protein; Region: RepB;
                     pfam07506"
                     /db_xref="CDD:254246"
     gene            complement(263506..264432)
                     /locus_tag="SMa0483"
                     /db_xref="GeneID:1235074"
     CDS             complement(263506..264432)
                     /locus_tag="SMa0483"
                     /note="glimmer prediction; inositol monophosphatase,
                     PF00459"
                     /codon_start=1
                     /transl_table=11
                     /product="Phosphatase"
                     /protein_id="NP_435500.1"
                     /db_xref="GI:16262707"
                     /db_xref="GeneID:1235074"
                     /translation="MPPMQFLRARRSPADNRLSIGIAIPTCRRWTCSPAGGTVPPTTI
                     KGVQNSMFDPPLGEFASFAHDIADLARQTISSAAGVRREPIAKSDASPVTETDRAVEK
                     CLRERIADHFPDHGVLGEEFGAEGLGNEFVWVIDPIDGTKAFVAGLPVYGTLISLTRG
                     GTPILGLIDNPMTGDRWLGVSGQPTTLNNVPIRTASTTALATAFIANGNPDAFSPADK
                     SRVESLRRITRWCVYGGSCIAYGRVADGSVDISIDGGLDPYDYCALVPVITGAGGCIT
                     DWQGRPLTLNSGGLCVATATDLLHRHVLEILA"
     misc_feature    complement(263509..264258)
                     /locus_tag="SMa0483"
                     /note="Predominantly bacterial family of Mg++ dependend
                     phosphatases, related to inositol monophosphatases. These
                     enzymes may dephosphorylate fructose-1,6-bisphosphate,
                     inositol monophospate, 3'-phosphoadenosine-5'-phosphate,
                     or similar substrates; Region: Bacterial_IMPase_like_1;
                     cd01641"
                     /db_xref="CDD:238819"
     misc_feature    complement(order(263653..263658,264010..264012,
                     264016..264027,264070..264075,264142..264144))
                     /locus_tag="SMa0483"
                     /note="active site"
                     /db_xref="CDD:238819"
     gene            complement(264485..265939)
                     /gene="thrC2"
                     /locus_tag="SMa0485"
                     /db_xref="GeneID:1235075"
     CDS             complement(264485..265939)
                     /gene="thrC2"
                     /locus_tag="SMa0485"
                     /EC_number="4.2.3.1"
                     /function="Small molecule metabolism; Amino acid
                     biosynthesis; threonine"
                     /note="catalyzes the formation of L-threonine from
                     O-phospho-L-homoserine"
                     /codon_start=1
                     /transl_table=11
                     /product="threonine synthase"
                     /protein_id="NP_435501.1"
                     /db_xref="GI:16262708"
                     /db_xref="GeneID:1235075"
                     /translation="MIKYVSTTGGIEPVGFDEAVLQGFAADGGLFVPDRIPVIDQEQL
                     QAFSTLSFQDLAFELVSLYIDASIIPRQDLRRLIDNSYREFQRPDIVNLVPIRGNRDT
                     YVLELFHGPTQSFKDMAMGFLMQVVDYLLGQRRERLNIVLATTGDTGPAAAWAAAGKQ
                     RIDCWPLYPRGMISREQERQMTTLRADNVHPVGVENCPDGGDDLDLVVAELFSDEKLK
                     RTLALSSVNSINWCRVMTQTVHYFYSYYRAVERVGDPVVFSVPSGAFGNLFAGYLARS
                     MGLPVARFVCANNVNNALHTAFSRGVLPRHDLVQTPSSAIDIVAPYNFWRLLYFATNR
                     DTARIRQWMKDFAARREVVLDVETTKTIQGGFISASISDEETLATVRSVYEAEGHYLI
                     DPHTAVAVAAVEAVRDSLPAAAAIVCFATAHPAKFPDVIKRALDVEELPAAGHHPVID
                     EARDACEHLRICQLENLRSNLIGEMTRQVARRRG"
     misc_feature    complement(264509..265936)
                     /gene="thrC2"
                     /locus_tag="SMa0485"
                     /note="threonine synthase; Validated; Region: PRK09225"
                     /db_xref="CDD:236418"
     misc_feature    complement(264533..265933)
                     /gene="thrC2"
                     /locus_tag="SMa0485"
                     /note="Threonine synthase catalyzes the final step of
                     threonine biosynthesis. The conversion of
                     O-phosphohomoserine into threonine and inorganic phosphate
                     is pyridoxal 5'-phosphate dependent. The Thr-synth_1 CD
                     includes members from higher plants; Region: Thr-synth_2;
                     cd01560"
                     /db_xref="CDD:107203"
     misc_feature    complement(order(264677..264679,265148..265153,
                     265592..265594))
                     /gene="thrC2"
                     /locus_tag="SMa0485"
                     /note="pyridoxal 5'-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:107203"
     misc_feature    complement(265592..265594)
                     /gene="thrC2"
                     /locus_tag="SMa0485"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:107203"
     gene            complement(266004..266954)
                     /locus_tag="SMa0486"
                     /db_xref="GeneID:1235076"
     CDS             complement(266004..266954)
                     /locus_tag="SMa0486"
                     /note="catalyzes the formation of L-proline from
                     L-ornithine"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine cyclodeaminase"
                     /protein_id="NP_435502.1"
                     /db_xref="GI:16262709"
                     /db_xref="GeneID:1235076"
                     /translation="MTKVFGIEEIRAATASMDLTSVMEAGFVAYSDGKVVVPPVGELL
                     FEEPPGDTHIKYGYIRDDRVFVIKIASGFYGNAALGLPSSSGLMLVFSQKTGFLESVL
                     LDEGYLTNVRTALAGRIAARYLAPKEVKAIGVFGTGTMARMQVTYLSTETDCQNIVAW
                     GRSDDSLRRYCDDMAALGYHVTTTRDAREVAEACNLIIMTTPSTKPLLMASQLQPGTH
                     ITAMGSDTPEKQELDSLILARADIVVADSLEQCLSRGEIFHAVRAGHIAAAQVRELGG
                     QIRAGTRVRTSQDQITVADLTGVAVQDIQIAKAVCERLSS"
     misc_feature    complement(266013..266954)
                     /locus_tag="SMa0486"
                     /note="Predicted ornithine cyclodeaminase, mu-crystallin
                     homolog [Amino acid transport and metabolism]; Region:
                     COG2423"
                     /db_xref="CDD:225280"
     misc_feature    complement(266007..266951)
                     /locus_tag="SMa0486"
                     /note="ornithine cyclodeaminase; Validated; Region:
                     PRK06823"
                     /db_xref="CDD:136070"
     gene            complement(267102..267869)
                     /locus_tag="SMa0489"
                     /db_xref="GeneID:1235077"
     CDS             complement(267102..267869)
                     /locus_tag="SMa0489"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; ABC transporter family,
                     PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435503.1"
                     /db_xref="GI:16262710"
                     /db_xref="GeneID:1235077"
                     /translation="MIEATFMNKPNDTMIQLIGVGKRFGQFEALKQVSLEVRRGEKIV
                     LCGPSGSGKSTLIRCINRMEEHTSGRIIIDGRELTDRTKDINAVRREVGMVFQSFNLF
                     PHMTILKNLTIAQRLVRKTPEKEAKEVAMHYLKRVKIPEQASKYPVQLSGGQQQRVAI
                     ARALCMKPQIMLFDEPTSALDPEMISEVLDVMVDLARDGMTMICVTHEMGFARSVADR
                     VMFMDGGQLIEEGDPETFFANPRNERTALFLRQILRH"
     misc_feature    complement(267111..267833)
                     /locus_tag="SMa0489"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    complement(267189..267827)
                     /locus_tag="SMa0489"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    complement(267708..267731)
                     /locus_tag="SMa0489"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(order(267249..267251,267345..267350,
                     267579..267581,267705..267713,267717..267722))
                     /locus_tag="SMa0489"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(267579..267590)
                     /locus_tag="SMa0489"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(267393..267422)
                     /locus_tag="SMa0489"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(267345..267362)
                     /locus_tag="SMa0489"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(267327..267338)
                     /locus_tag="SMa0489"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    complement(267243..267263)
                     /locus_tag="SMa0489"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            complement(267881..268564)
                     /locus_tag="SMa0492"
                     /db_xref="GeneID:1235078"
     CDS             complement(267881..268564)
                     /locus_tag="SMa0492"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; binding-protein-dependent
                     transpo"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435504.1"
                     /db_xref="GI:16262711"
                     /db_xref="GeneID:1235078"
                     /translation="MNIGIVFDAIPRMLGGIVMTFQLLLLSLAIGTMIAVLLLLMRIS
                     GRWWLSWPAQFYTYVFRGTPILVQIFIVYYGLPQFEWIRESIFWPILRDPFGCAILAL
                     SLNTGAYLSEIFRGGVLAVERGLLEAGAALGMSATHRFIYITTPLAIRIALPAYGNEV
                     ISLMKSTALASTITLVDMTGIGRTIVAETFAPYQVFLSLAIVYVAITWIIQRSVKRLE
                     VYLGRSTAR"
     misc_feature    complement(267884..268564)
                     /locus_tag="SMa0492"
                     /note="ABC-type arginine/histidine transport system,
                     permease component [Amino acid transport and metabolism];
                     Region: ArtM; COG4160"
                     /db_xref="CDD:226634"
     misc_feature    complement(267944..268516)
                     /locus_tag="SMa0492"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(267944..267946,267953..267958,
                     267962..267967,267974..267979,268007..268012,
                     268049..268054,268061..268072,268091..268093,
                     268100..268105,268145..268147,268196..268198,
                     268205..268210,268220..268222,268226..268231,
                     268238..268240,268244..268246,268250..268255,
                     268346..268348,268352..268357,268364..268393,
                     268397..268408,268436..268438,268451..268456,
                     268463..268468))
                     /locus_tag="SMa0492"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268055..268072,268346..268390))
                     /locus_tag="SMa0492"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(267977..267979,268007..268009,
                     268016..268018,268052..268054,268268..268270,
                     268346..268348))
                     /locus_tag="SMa0492"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268124..268126,268136..268141,
                     268157..268195))
                     /locus_tag="SMa0492"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(268561..269259)
                     /locus_tag="SMa0493"
                     /db_xref="GeneID:1235079"
     CDS             complement(268561..269259)
                     /locus_tag="SMa0493"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; binding-protein-dependent
                     transport systems inner membrane component, PFam00528;
                     similar to OccQ, octopine transport binding protein, also
                     to arginine and histidine transport binding proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435505.1"
                     /db_xref="GI:16262712"
                     /db_xref="GeneID:1235079"
                     /translation="MEALNGWWDDYLLASVTVAKVFVCSLILMVIFGLLGASAKLSSN
                     RLANAVGNAYTVFFRGTPEILVILLLYFGSAVSLTTIARVFDPSVAFVDIPPFWAGSI
                     AIALVVGSYATETFRGAFNGVKSGSIEAARALGMNGLQTFFYIRIPEMWRIALPPFGN
                     HMLSLIKDTALISIIGLNETLFVAKQAASTTGKPFTMYIVVGLIYLGFSTAITISVLL
                     LEALANRHIQRRPS"
     misc_feature    complement(268570..269256)
                     /locus_tag="SMa0493"
                     /note="ABC-type arginine transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     ArtQ; COG4215"
                     /db_xref="CDD:226670"
     misc_feature    complement(268618..269193)
                     /locus_tag="SMa0493"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268618..268623,268630..268635,
                     268642..268647,268651..268656,268663..268668,
                     268696..268701,268738..268743,268750..268761,
                     268780..268782,268789..268794,268834..268836,
                     268885..268887,268894..268899,268909..268911,
                     268915..268920,268927..268929,268933..268935,
                     268939..268944,269047..269049,269053..269058,
                     269065..269094,269098..269109,269137..269139,
                     269152..269157,269164..269169))
                     /locus_tag="SMa0493"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268744..268761,269047..269091))
                     /locus_tag="SMa0493"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268666..268668,268696..268698,
                     268705..268707,268741..268743,268957..268959,
                     269047..269049))
                     /locus_tag="SMa0493"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(268813..268815,268825..268830,
                     268846..268884))
                     /locus_tag="SMa0493"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(269299..270117)
                     /locus_tag="SMa0495"
                     /db_xref="GeneID:1235080"
     CDS             complement(269299..270117)
                     /locus_tag="SMa0495"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; bacterial extracellular
                     solute-binding protein, family 3, PF00497"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435506.1"
                     /db_xref="GI:16262713"
                     /db_xref="GeneID:1235080"
                     /translation="MNAMKNWQTSLTGLITAVLLSAAPANADTLRVGMECTYAPFNYR
                     TSDGKLEGYDVDVAKGISEIIGVDFEYVCQEWDGMIPALLANKFDLIIASMSITDKRK
                     EQIDFSSPYRNSVGRIVGPVGKDLKLFDDKGQPVVGNFDGLRIGVERASTYFEWFSAK
                     LPKADLVLYDSNEAMYLDLKNGRVDVIMTNPMKAHLSFLSGEGKGKYEFIGPEVNEPK
                     FFGPGVGVGLRKGNDELRDKISAAIRKLIREGKLKEYALKIFPFQIHDDAWAEE"
     misc_feature    complement(269338..270030)
                     /locus_tag="SMa0495"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    complement(269356..270030)
                     /locus_tag="SMa0495"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(269548..269550,269662..269664,
                     269815..269817,269890..269892,270004..270006))
                     /locus_tag="SMa0495"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(269569..269571,269587..269589,
                     269599..269601))
                     /locus_tag="SMa0495"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(269443..269460)
                     /locus_tag="SMa0495"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            270311..270979
                     /locus_tag="SMa0496"
                     /db_xref="GeneID:1235081"
     CDS             270311..270979
                     /locus_tag="SMa0496"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435507.1"
                     /db_xref="GI:16262714"
                     /db_xref="GeneID:1235081"
                     /translation="MKKKDQELGKGIGPELSPFVPVCDAIANLFAPFAEVVLHDMASA
                     SVVYIAGNFSKREFGDPSNLEEIDFKPADVLIGPYEKTNWDGRRIKSISSVLRTASGK
                     EVGVLCINVDVSVFENILLTLQTFVSLPATAGKLDSLFRDDWFERINSYIRHWTTSRG
                     LNISDLSRAQKKELVQALADDGAFSGKNAAGYICRLLGMGRATVYNYLNGDAAKVAGG
                     NSKQ"
     misc_feature    270326..270967
                     /locus_tag="SMa0496"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG2964"
                     /db_xref="CDD:225512"
     misc_feature    270356..270685
                     /locus_tag="SMa0496"
                     /note="YheO-like PAS domain; Region: PAS_6; pfam08348"
                     /db_xref="CDD:254749"
     misc_feature    270746..270937
                     /locus_tag="SMa0496"
                     /note="HTH domain; Region: HTH_22; pfam13309"
                     /db_xref="CDD:257646"
     gene            complement(271057..271956)
                     /locus_tag="SMa0498"
                     /db_xref="GeneID:1235082"
     CDS             complement(271057..271956)
                     /locus_tag="SMa0498"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction; bacterial regulatory
                     helix-turn-helix protein, LysR family, PF00126"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435508.1"
                     /db_xref="GI:16262715"
                     /db_xref="GeneID:1235082"
                     /translation="MTLSFSALESFYWVSQLRSFNAAANKLNVSQPTVSYRIRELEER
                     LGVSLFVRQRRQLVLTSEGEALKHYAESMIAIARDIESNIKTRNTRLPTLRVGVIDSF
                     AAVCLPSLLDELDIRFAGARIAATVDTSHKLADQLSEGLLDIAVLSTPPSHDNVALEL
                     LGRQSVDWIASHKLGLPQTIVSDEELLRQRIFATPAPSNLHSLTTGFLAATAGAGLRL
                     NVCNSLGTILNLVESGTGISILPSRLLQEQIRHGTIQVLKTRTTLPLQEVFIGTNKGA
                     IVRALPQVSQMIRKVSASVGFCV"
     misc_feature    complement(271765..271944)
                     /locus_tag="SMa0498"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(271162..271935)
                     /locus_tag="SMa0498"
                     /note="aminoethylphosphonate catabolism associated LysR
                     family transcriptional regulator; Region: phn_lysR;
                     TIGR03339"
                     /db_xref="CDD:132382"
     misc_feature    complement(271084..271680)
                     /locus_tag="SMa0498"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cd05466"
                     /db_xref="CDD:176102"
     misc_feature    complement(order(271258..271263,271267..271272,
                     271288..271296,271576..271596,271600..271602,
                     271612..271614,271621..271626,271630..271635))
                     /locus_tag="SMa0498"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            272059..272691
                     /locus_tag="SMa0499"
                     /db_xref="GeneID:1235083"
     CDS             272059..272691
                     /locus_tag="SMa0499"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435509.1"
                     /db_xref="GI:16262716"
                     /db_xref="GeneID:1235083"
                     /translation="MHKTISREHILEDLPEIAEIQSDDLREKVVDAWVFALERSSFDR
                     VVDIPGEGSPNVFALKRGTQDAHLRGVTRLALAIYDEFARTYPEARVDRDIILAGGLC
                     HDIGKTWEFDPINLKRWRERGDRYGEPSFRHSAYGTHVCLSVGLPEEIGHICMGHSLE
                     GAHIGHSTECYIIRQADHAWWHVAAALDLCHPETIGFAGPNLRVRPIGMQ"
     misc_feature    <272059..272688
                     /locus_tag="SMa0499"
                     /note="Predicted HD-superfamily hydrolase [General
                     function prediction only]; Region: COG3481"
                     /db_xref="CDD:226012"
     misc_feature    272257..>272517
                     /locus_tag="SMa0499"
                     /note="Metal dependent phosphohydrolases with conserved
                     'HD' motif; Region: HDc; cd00077"
                     /db_xref="CDD:238032"
     misc_feature    order(272257..272259,272365..272370)
                     /locus_tag="SMa0499"
                     /note="Zn2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     misc_feature    272368..272370
                     /locus_tag="SMa0499"
                     /note="Mg2+ binding site [ion binding]; other site"
                     /db_xref="CDD:238032"
     gene            272734..273420
                     /locus_tag="SMa0501"
                     /db_xref="GeneID:1235084"
     CDS             272734..273420
                     /locus_tag="SMa0501"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; binding-protein-dependent
                     transport systems inner membrane component, PF00528"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435510.1"
                     /db_xref="GI:16262717"
                     /db_xref="GeneID:1235084"
                     /translation="MDYTFQFGPLLNYLPQIVSGLWLTIGLSFVGIFGGIALGIFCAV
                     MSTLSSPIPRLLVRLYVEVVRNTPLLVQIFVIFFGLPNIGIRLSPLTSVFIALVLNNG
                     GYVAEIVRGGIEATHRSQVEAAESLGLSYFQTLRYVILPPALEKVFTPVVSQCVLLML
                     STSLVSAIGVEDLTGAAMIASSETFRTMEIYLVVAMVYVVLNFVFRAVLNVAGLMIFT
                     RSRRRLLGRA"
     misc_feature    272734..273366
                     /locus_tag="SMa0501"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    272794..273348
                     /locus_tag="SMa0501"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(272842..272847,272854..272859,272872..272874,
                     272902..272913,272917..272946,272953..272958,
                     272962..272964,273031..273033,273037..273039,
                     273043..273045,273052..273057,273061..273063,
                     273073..273078,273085..273087,273136..273138,
                     273178..273183,273190..273192,273211..273222,
                     273229..273234,273271..273276,273304..273309,
                     273316..273321,273325..273330,273337..273342)
                     /locus_tag="SMa0501"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(272920..272964,273211..273228)
                     /locus_tag="SMa0501"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(272962..272964,273022..273024,273229..273231,
                     273265..273267,273274..273276,273304..273306)
                     /locus_tag="SMa0501"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(273088..273126,273142..273147,273157..273159)
                     /locus_tag="SMa0501"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            273422..274078
                     /locus_tag="SMa0503"
                     /db_xref="GeneID:1235085"
     CDS             273422..274078
                     /locus_tag="SMa0503"
                     /function="Cell processes; Transport of small molecules"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435511.1"
                     /db_xref="GI:16262718"
                     /db_xref="GeneID:1235085"
                     /translation="MRTFGSPEFLFIVYALRWTLTLTVLAFVGGGIMGIVLALLRIAR
                     IRAFSAITTFYMQVIQGLPLLVLLFLCYYAPSLFGIEIAALTAAAIALTINSSAFLGA
                     IWESALRAIPKAQWESADALALTPYKTLRFVIAPQAIRLALPSTVGFLVQIIKQTSLA
                     SIIGFIEITRAGQLVSNATFEPLKAFLSVAALYFAVCFPLTQLSLWLERRTACRGART
                     "
     misc_feature    273431..274066
                     /locus_tag="SMa0503"
                     /note="ABC-type amino acid transport system, permease
                     component [Amino acid transport and metabolism]; Region:
                     HisM; COG0765"
                     /db_xref="CDD:223836"
     misc_feature    273467..274015
                     /locus_tag="SMa0503"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(273515..273520,273527..273532,273545..273547,
                     273575..273586,273590..273619,273626..273631,
                     273635..273637,273701..273706,273710..273712,
                     273716..273718,273725..273730,273734..273736,
                     273746..273751,273758..273760,273809..273811,
                     273851..273856,273863..273865,273884..273895,
                     273902..273907,273944..273949,273977..273982,
                     273989..273994,273998..274003,274010..274015)
                     /locus_tag="SMa0503"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(273593..273637,273884..273901)
                     /locus_tag="SMa0503"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(273635..273637,273902..273904,273938..273940,
                     273947..273949,273977..273979)
                     /locus_tag="SMa0503"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(273761..273799,273815..273820,273830..273832)
                     /locus_tag="SMa0503"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            274136..274933
                     /locus_tag="SMa0506"
                     /db_xref="GeneID:1235086"
     CDS             274136..274933
                     /locus_tag="SMa0506"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; bacterial extracellular
                     solute-binding protein, family 3 motif, PF00467"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter periplasmic substrate-binding
                     protein"
                     /protein_id="NP_435512.1"
                     /db_xref="GI:16262719"
                     /db_xref="GeneID:1235086"
                     /translation="MTMRLKSLLLPLVGLLAITVGAATASASSLDDIIARKKVMIGVD
                     LSVPPFGITNEEMQPDGLDVDVAKLLAKDLGVELELVPVTGQSRIPSLQTGKVDFVVA
                     SFGIYTERALSVAFSNPYGGHRSIIIAPKEATIKSLADLAGKRVGVPRGTAHEKILSA
                     ANVEGMELVRFDDDSTTLNALVSGQVDAIGTVNYIAAQLQERYPDRGFEEKTTYLQSF
                     YGVGLRRNDPDLLHWLNTVLFVHKQSGELGAIYEKWMKTPIPELPSF"
     misc_feature    274256..274900
                     /locus_tag="SMa0506"
                     /note="Bacterial extracellular solute-binding proteins,
                     family 3; Region: SBP_bac_3; pfam00497"
                     /db_xref="CDD:249906"
     misc_feature    274256..274897
                     /locus_tag="SMa0506"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    order(274274..274276,274388..274390,274463..274465,
                     274592..274594,274706..274708)
                     /locus_tag="SMa0506"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    order(274658..274660,274670..274672,274688..274690)
                     /locus_tag="SMa0506"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    274778..274795
                     /locus_tag="SMa0506"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            274983..275714
                     /locus_tag="SMa0508"
                     /db_xref="GeneID:1235087"
     CDS             274983..275714
                     /locus_tag="SMa0508"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; ABC transporter family,
                     PF00005"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435513.1"
                     /db_xref="GI:16262720"
                     /db_xref="GeneID:1235087"
                     /translation="MSVVVAKNIRKSFGGLQVLKGVSLTVEGGEVVALIGGSGSGKST
                     FLRCLNGLESVDSGEIEVAGHRMSRKPAELRRLRRDVGIVFQSYNLFPHLTAGENIML
                     APVQVKGIGKDAARSEAKRCLSLVGLGDRFEAYPDMLSGGQQQRVAIARSLAMQPKVL
                     LFDEVTSALDPELTGEVLAVIEKLARDGMTMILVTHEMGFARRVANRTIFMRDGIIHE
                     EGPSAEFFSSPKTPELRAFLHAEVG"
     misc_feature    274986..275699
                     /locus_tag="SMa0508"
                     /note="ABC-type polar amino acid transport system, ATPase
                     component [Amino acid transport and metabolism]; Region:
                     GlnQ; COG1126"
                     /db_xref="CDD:224051"
     misc_feature    274992..275630
                     /locus_tag="SMa0508"
                     /note="ATP-binding cassette domain of the histidine and
                     glutamine transporters; Region: ABC_HisP_GlnQ; cd03262"
                     /db_xref="CDD:213229"
     misc_feature    275088..275111
                     /locus_tag="SMa0508"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    order(275097..275102,275106..275114,275238..275240,
                     275469..275474,275568..275570)
                     /locus_tag="SMa0508"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213229"
     misc_feature    275229..275240
                     /locus_tag="SMa0508"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213229"
     misc_feature    275397..275426
                     /locus_tag="SMa0508"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213229"
     misc_feature    275457..275474
                     /locus_tag="SMa0508"
                     /note="Walker B; other site"
                     /db_xref="CDD:213229"
     misc_feature    275481..275492
                     /locus_tag="SMa0508"
                     /note="D-loop; other site"
                     /db_xref="CDD:213229"
     misc_feature    275556..275576
                     /locus_tag="SMa0508"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213229"
     gene            275787..276734
                     /locus_tag="SMa0510"
                     /db_xref="GeneID:1235088"
     CDS             275787..276734
                     /locus_tag="SMa0510"
                     /note="glimmer prediction; D-isomer specific 2-hydroxyacid
                     family, PF00389"
                     /codon_start=1
                     /transl_table=11
                     /product="D-isomer specific 2-hydroxyacid dehydrogenase"
                     /protein_id="NP_435514.1"
                     /db_xref="GI:16262721"
                     /db_xref="GeneID:1235088"
                     /translation="MPKIELLQVGPYPSWDEERLNANFTMHRYFEAADKAAFLAEHGA
                     AIRGIATRGELGANWAMIEALPRLEIISVYGVGYDAVDLAAARERGIRVTNTPDVLTK
                     DVADLGVAMMLAHARGMIGGETWVKSGDWAKKGLYPLKRRVHGKRAGVLGLGRIGFEV
                     AKRLAGFDMEIAYSDTGAKDFARDWSFIADPVELAARSDFLFVTLAASAETRHIVGRR
                     VIEALGPDGMLINISRASNIDEEALLDALESKVLGAAALDVFEGEPNLNPRFLALDNV
                     LLQPHMASGTAETRKAMGQLVFDNLSAHFGGRPLPTPVL"
     misc_feature    275793..276731
                     /locus_tag="SMa0510"
                     /note="Lactate dehydrogenase and related dehydrogenases
                     [Energy production and conversion / Coenzyme metabolism /
                     General function prediction only]; Region: LdhA; COG1052"
                     /db_xref="CDD:223980"
     misc_feature    275796..276704
                     /locus_tag="SMa0510"
                     /note="Hydroxy(phenyl)pyruvate Reductase,
                     D-isomer-specific 2-hydroxyacid-related dehydrogenase;
                     Region: HPPR; cd12156"
                     /db_xref="CDD:240633"
     misc_feature    order(275943..275945,276009..276017,276084..276086,
                     276486..276488,276627..276629)
                     /locus_tag="SMa0510"
                     /note="putative ligand binding site [chemical binding];
                     other site"
                     /db_xref="CDD:240633"
     misc_feature    order(276012..276017,276096..276098,276240..276254,
                     276306..276317,276396..276404,276417..276419,
                     276480..276488,276558..276560,276627..276629,
                     276633..276638)
                     /locus_tag="SMa0510"
                     /note="NAD binding site [chemical binding]; other site"
                     /db_xref="CDD:240633"
     misc_feature    order(276486..276488,276573..276575,276627..276629)
                     /locus_tag="SMa0510"
                     /note="catalytic site [active]"
                     /db_xref="CDD:240633"
     gene            276745..277776
                     /gene="idnD"
                     /locus_tag="SMa0512"
                     /db_xref="GeneID:1235089"
     CDS             276745..277776
                     /gene="idnD"
                     /locus_tag="SMa0512"
                     /function="Small molecule metabolism"
                     /note="glimmer prediction; zinc-binding  family, PF00107"
                     /codon_start=1
                     /transl_table=11
                     /product="IdnD L-idonate 5-dehydrogenase"
                     /protein_id="NP_435515.1"
                     /db_xref="GI:16262722"
                     /db_xref="GeneID:1235089"
                     /translation="MKAIVIHTAKDLRVEECAVEKPGPGEVEIRLAAGGICGSDLHYY
                     NHGGFGTVRLKEPMILGHEVSGHVAALGEGVSDLAIGDLVAVSPSRPCGACDYCLKGL
                     PNHCFHMRFYGSAMPFPHIQGAFRERLVAKASQCVKAEGLSAGEAAMAEPLSVTLHAT
                     RRAGEMLGKRVLVTGCGPIGTLSILAARRAGAAEIVAADLSERALGFARAVGADRTVN
                     LSEDRDGLVPFSENKGTFDVLYECSGAQPALVAGIQALRPRGVIVQLGLGGDMALPMM
                     AITAKELDLRGSFRFHEEFATAVKLMQGGLIDVKPLITHTLPLGEALKAFEIASDKGQ
                     SMKTQIAFA"
     misc_feature    276751..277770
                     /gene="idnD"
                     /locus_tag="SMa0512"
                     /note="L-idonate 5-dehydrogenase; Provisional; Region:
                     PRK09880"
                     /db_xref="CDD:182130"
     misc_feature    276754..277770
                     /gene="idnD"
                     /locus_tag="SMa0512"
                     /note="L-idonate 5-dehydrogenase; Region: idonate-5-DH;
                     cd08232"
                     /db_xref="CDD:176194"
     misc_feature    order(276853..276861,276868..276870,277195..277197,
                     277207..277209,277267..277284,277339..277344,
                     277354..277356,277399..277401,277468..277473,
                     277477..277479,277537..277542,277606..277614)
                     /gene="idnD"
                     /locus_tag="SMa0512"
                     /note="putative NAD(P) binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176194"
     misc_feature    order(276853..276855,276859..276861,276928..276930,
                     277195..277197)
                     /gene="idnD"
                     /locus_tag="SMa0512"
                     /note="catalytic Zn binding site [ion binding]; other
                     site"
                     /db_xref="CDD:176194"
     gene            277846..278601
                     /gene="idnO1"
                     /locus_tag="SMa0513"
                     /db_xref="GeneID:1235090"
     CDS             277846..278601
                     /gene="idnO1"
                     /locus_tag="SMa0513"
                     /EC_number="1.1.1.69"
                     /function="Small molecule metabolism; Degradation"
                     /note="catalyzes the formation of 5-dehydro-D-gluconate
                     from D-gluconate"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate 5-dehydrogenase"
                     /protein_id="NP_435516.1"
                     /db_xref="GI:16262723"
                     /db_xref="GeneID:1235090"
                     /translation="MSTELFDLTGKRALVTGSSQGIGYALAKGLAATGAEIILNGRDA
                     AKLAAAARDLGAGHTLAFDATDHQAVRKAVDAFEADVGAIDILVNNAGMQHRTPLEDF
                     PADAFERLLKTNVSSVFNVGQAVARHMIKRGAGKIINIASVQTALARPGIAPYTATKG
                     AVGNLTKGMATDWARYGLQCNAIAPGYFDTPLNAALVADPSFSDWLERRTPAGRWGKV
                     EELVGACIFLSSDASSFVNGHVLYVDGGITASL"
     misc_feature    277846..278598
                     /gene="idnO1"
                     /locus_tag="SMa0513"
                     /note="gluconate 5-dehydrogenase; Provisional; Region:
                     PRK07523"
                     /db_xref="CDD:236040"
     misc_feature    277846..278592
                     /gene="idnO1"
                     /locus_tag="SMa0513"
                     /note="gluconate 5-dehydrogenase; Provisional; Region:
                     PRK07097"
                     /db_xref="CDD:235933"
     misc_feature    order(277894..277896,277900..277905,277909..277911,
                     277966..277974,278113..278121,278263..278271,
                     278308..278310,278320..278322,278398..278409)
                     /gene="idnO1"
                     /locus_tag="SMa0513"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(278185..278187,278269..278271,278308..278310,
                     278320..278322)
                     /gene="idnO1"
                     /locus_tag="SMa0513"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            278603..279121
                     /gene="idnK"
                     /locus_tag="SMa0514"
                     /db_xref="GeneID:1235091"
     CDS             278603..279121
                     /gene="idnK"
                     /locus_tag="SMa0514"
                     /EC_number="2.7.1.12"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction Selected Met12 as start to avoid
                     overlap with SMA0513. possible operon with
                     SMA0512,SMA0513,SMA0514,SMA0516,SMA0518"
                     /codon_start=1
                     /transl_table=11
                     /product="gluconate kinase"
                     /protein_id="NP_435517.1"
                     /db_xref="GI:16262724"
                     /db_xref="GeneID:1235091"
                     /translation="MAPHSARRGIVLMGVAGCGKSAIGAALATRLGATYVDGDDLHPP
                     ENIARMSRGEPLTDDDRWPWLTLVGRRLAAPDGVLIIGCSALKRRYRDHIRNEAGAPV
                     TFVHLSGTKVLITARMGARAGHFMPVSLIESQFAALEPPTTDENVITVDIDQPLEVLV
                     DEIAVKLEETPS"
     misc_feature    278630..279058
                     /gene="idnK"
                     /locus_tag="SMa0514"
                     /note="Gluconate kinase (GntK) catalyzes the phosphoryl
                     transfer from ATP to gluconate. The resulting product
                     gluconate-6-phoshate is an important precursor of
                     gluconate metabolism. GntK acts as a dimmer composed of
                     two identical subunits; Region: GntK; cd02021"
                     /db_xref="CDD:238979"
     misc_feature    278630..279025
                     /gene="idnK"
                     /locus_tag="SMa0514"
                     /note="AAA domain; Region: AAA_33; pfam13671"
                     /db_xref="CDD:257977"
     misc_feature    order(278642..278665,278711..278713,278717..278719,
                     278951..278953,278963..278965)
                     /gene="idnK"
                     /locus_tag="SMa0514"
                     /note="ATP-binding site [chemical binding]; other site"
                     /db_xref="CDD:238979"
     misc_feature    order(278648..278653,278963..278965)
                     /gene="idnK"
                     /locus_tag="SMa0514"
                     /note="Gluconate-6-phosphate binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238979"
     gene            279118..280005
                     /locus_tag="SMa0516"
                     /db_xref="GeneID:1235092"
     CDS             279118..280005
                     /locus_tag="SMa0516"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism"
                     /note="glimmer prediction possible operon with
                     SMA0512,SMA0513,SMA0514,SMA0516,SMA0518. best match to
                     3-hydroxyisobutyrate  and D-threonine dehydratase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435518.1"
                     /db_xref="GI:16262725"
                     /db_xref="GeneID:1235092"
                     /translation="MTNRVALIGAGAMGGSIGARLVETGNRLTVFDPGPDKVQALVDK
                     GAFAAPSAAEAAAVSDYVILSLNAPAIVRQAVFGDAGVAAGAQAGTLIIDMSSIDPNA
                     TKQLAADAAEKGLRWVDSPLSGGAPKALIGELTLMAGGTAQDVKDAHAVLRHVASNYT
                     HMGSVGAGQTTKLINQVLCGLGFLAVAEATQLALDAGVDASKIPQALMGGRADSAILQ
                     EYMPRFVTKDYRHTGRIDNMVKDLAGAQDLARRTNTAMPLTAACAEIHRMLTAAGLGG
                     EDQAALMEFFRGPNKENFK"
     misc_feature    279127..279978
                     /locus_tag="SMa0516"
                     /note="3-hydroxyisobutyrate dehydrogenase and related
                     beta-hydroxyacid dehydrogenases [Lipid metabolism];
                     Region: MmsB; COG2084"
                     /db_xref="CDD:224995"
     misc_feature    279127..279603
                     /locus_tag="SMa0516"
                     /note="NAD binding domain of 6-phosphogluconate
                     dehydrogenase; Region: NAD_binding_2; pfam03446"
                     /db_xref="CDD:251959"
     misc_feature    279613..279975
                     /locus_tag="SMa0516"
                     /note="NAD-binding of NADP-dependent 3-hydroxyisobutyrate
                     dehydrogenase; Region: NAD_binding_11; pfam14833"
                     /db_xref="CDD:258970"
     gene            280002..280334
                     /locus_tag="SMa0518"
                     /db_xref="GeneID:1235093"
     CDS             280002..280334
                     /locus_tag="SMa0518"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction possible operon with
                     SMA0512,SMA0513,SMA0514,SMA0516,SMA0518. may be involved
                     in gluconate metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435519.1"
                     /db_xref="GI:16262726"
                     /db_xref="GeneID:1235093"
                     /translation="MITRYALFEGKVKDGHTEAFRKAVIERILPKWKQFPHATDVRIS
                     FAESRDEGAPELSMILAINYPDLEAVEEALASPVRAEARAATEAVLAEFFEGRIHHHV
                     MSASEFKL"
     gene            280693..281535
                     /locus_tag="SMa0520"
                     /db_xref="GeneID:1235094"
     CDS             280693..281535
                     /locus_tag="SMa0520"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction weak (5e-7, 8/2000) match to
                     first 60% of transcriptional regulator RpiR but finds none
                     of the other 15 members of the family"
                     /codon_start=1
                     /transl_table=11
                     /product="RpiR family transcriptional regulator"
                     /protein_id="NP_435520.1"
                     /db_xref="GI:16262727"
                     /db_xref="GeneID:1235094"
                     /translation="MLIAERVQTIADTLTPAERRLVKEIIAKPRDVALGTAGELARRT
                     GVHEATASRLARKLGFETYAGFRHAIRDEFIVKTDPALRVRRTLETSRGHGMLEMLVQ
                     QEIEALTRLSSYVDEERLAAAAAALSDRRRIFIFARGNAETLAVLMNRRLRRMAFETV
                     LVCGDSRDIAEQILSMGPDDALLVFAFRRQPRAYAPLIERAGKVGAVSVVVSGTVGPS
                     LSPKADHLLAAPRAGDADAFQTLTVPMAICNGLILSMAQSDEVRSLSNLEQLGELIGE
                     LEGR"
     misc_feature    280693..281529
                     /locus_tag="SMa0520"
                     /note="Transcriptional regulators [Transcription]; Region:
                     RpiR; COG1737"
                     /db_xref="CDD:224651"
     misc_feature    280693..280914
                     /locus_tag="SMa0520"
                     /note="Helix-turn-helix domain, rpiR family; Region:
                     HTH_6; pfam01418"
                     /db_xref="CDD:201784"
     misc_feature    281071..281454
                     /locus_tag="SMa0520"
                     /note="SIS domain. SIS (Sugar ISomerase) domains are found
                     in many phosphosugar isomerases and phosphosugar binding
                     proteins. SIS domains are also found in proteins that
                     regulate the expression of genes involved in synthesis of
                     phosphosugars; Region: SIS; cl00389"
                     /db_xref="CDD:260399"
     gene            281664..282392
                     /locus_tag="SMa0522"
                     /db_xref="GeneID:1235095"
     CDS             281664..282392
                     /locus_tag="SMa0522"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction, AUG start may be part of
                     transcription unit with SMA0522, SMA0523, SMA0525,
                     SMA0526, SMA0527"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435521.1"
                     /db_xref="GI:16262728"
                     /db_xref="GeneID:1235095"
                     /translation="MKRMMMIGAVLVALAAPAMAQDVDTLSPEALLTLAQKEGKVTVY
                     SFTSRIARVEKAFEEAYPGIDLIGFDMSSTEMITRLRTEAAAGITNADVVYVSDAPVV
                     LSDLLETGLLKNYVPPRIADKLDTAFKSPLLAQRLSTKVLMYNEAAYPNGAPIKNLWD
                     LTTPEWKGKVLMVDPLQRGDYLDLMTEFVLRSDEMAKAYEALFRKPIELDDGVETAGH
                     QFIVDLFENDLVLLADGRCECGGW"
     misc_feature    281826..>282368
                     /locus_tag="SMa0522"
                     /note="ABC-type Fe3+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: AfuA; COG1840"
                     /db_xref="CDD:224753"
     gene            282373..282777
                     /locus_tag="SMa0523"
                     /db_xref="GeneID:1235096"
     CDS             282373..282777
                     /locus_tag="SMa0523"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction, GUG start may be part of
                     transcription unit with SMA0522, SMA0523, SMA0525,
                     SMA0526, SMA0527. Small overlap with SMA0522"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435522.1"
                     /db_xref="GI:16262729"
                     /db_xref="GeneID:1235096"
                     /translation="MNAAVGKLGQDQPPVGFTSYSDRRDNEDEGWALQVVNDVVPSNG
                     IVFPALLALTADTKNPAASRLAIDFLMGDDSETGGPGYAPFYVAGDWPTRSDIKGHPD
                     AIPLADFKAWRVDPAATATIRKSVGDLVLQLQ"
     misc_feature    <282373..282762
                     /locus_tag="SMa0523"
                     /note="ABC-type Fe3+ transport system, periplasmic
                     component [Inorganic ion transport and metabolism];
                     Region: AfuA; COG1840"
                     /db_xref="CDD:224753"
     gene            282774..284579
                     /locus_tag="SMa0525"
                     /db_xref="GeneID:1235097"
     CDS             282774..284579
                     /locus_tag="SMa0525"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction, AUG start may be part of
                     transcription unit with SMA0522, SMA0523, SMA0525,
                     SMA0526, SMA0527. Best match (3e-16, 8/2000) to  ABC iron
                     transport system"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435523.1"
                     /db_xref="GI:16262730"
                     /db_xref="GeneID:1235097"
                     /translation="MIRVPPSPSGRGASALSDILMSTQSRNRSFKDAFLSPGLGLKAA
                     VLVLLTALVAAPLLKVFGATLAPGAWSAWSDVLASNLSRNLFWLPLANTMILGAGVAT
                     GCVLVGGFLAWLVVMTDVPFRRTIGLLATLPFMIPSFATALAWGSLFRNARVGGQIGF
                     LEGLGFSVPDWLAWGMVPTLVVLMAHYYSLAFTVIAAALATVNSDLVEAAQMTGAGRR
                     RIFLGIVLPVALPALVAGASLTFAGAVSNFAAPALLGLPVRMQTLATRLYGMIEIGQA
                     ERGYVLAILLILVSAFFLWAGNRVISGRRSYATITGKGGRSKRFALGTARLPLFVAAA
                     SICVLTTVVPVVILIASSLAPSSSALFSDWSLHYWIGASDPAIARGQAGIWNNPLILS
                     ATGVTVGLGVTVAFSASLVGLLVAFVLARSRSGFLSAAINQISFLPLLVPGIAFGAAY
                     VALLGAPIGPLPALYGTFLLLVIAATAYLVPFAVQTGRAVIQQVSGDLDESARMTGAG
                     FLRRLFAITVPLAIRGLSAGALIVFVKIVRDLSLVVLLFTPTMPLLSVLAYRYASDGF
                     TQFANALTVVVLVISVAATLFANRLQAKSQPWLQS"
     misc_feature    282864..284573
                     /locus_tag="SMa0525"
                     /note="ABC-type Fe3+ transport system, permease component
                     [Inorganic ion transport and metabolism]; Region: ThiP;
                     COG1178"
                     /db_xref="CDD:224099"
     misc_feature    283041..283640
                     /locus_tag="SMa0525"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(283089..283094,283101..283106,283119..283121,
                     283149..283160,283164..283193,283200..283205,
                     283209..283211,283326..283331,283335..283337,
                     283341..283343,283350..283355,283359..283361,
                     283371..283376,283383..283385,283434..283436,
                     283476..283481,283488..283490,283509..283520,
                     283527..283532,283569..283574,283602..283607,
                     283614..283619,283623..283628,283635..283640)
                     /locus_tag="SMa0525"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(283167..283211,283509..283526)
                     /locus_tag="SMa0525"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(283209..283211,283311..283313,283527..283529,
                     283563..283565,283572..283574,283602..283604)
                     /locus_tag="SMa0525"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(283386..283424,283440..283445,283455..283457)
                     /locus_tag="SMa0525"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     misc_feature    283956..284522
                     /locus_tag="SMa0525"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(284001..284006,284013..284018,284031..284033,
                     284064..284075,284079..284108,284115..284120,
                     284124..284126,284202..284207,284211..284213,
                     284217..284219,284226..284231,284235..284237,
                     284247..284252,284259..284261,284310..284312,
                     284352..284357,284364..284366,284385..284396,
                     284403..284408,284445..284450,284478..284483,
                     284490..284495,284499..284504,284511..284516)
                     /locus_tag="SMa0525"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(284082..284126,284385..284402)
                     /locus_tag="SMa0525"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(284124..284126,284187..284189,284403..284405,
                     284439..284441,284448..284450,284478..284480)
                     /locus_tag="SMa0525"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(284262..284300,284316..284321,284331..284333)
                     /locus_tag="SMa0525"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            284576..285622
                     /locus_tag="SMa0526"
                     /db_xref="GeneID:1235098"
     CDS             284576..285622
                     /locus_tag="SMa0526"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction trimmed by 4 amino acids to
                     decrease overlap with SMA0525 and give AUG start. may be
                     part of transcription unit with SMA0522, SMA0523, SMA0525,
                     SMA0526, SMA0527"
                     /codon_start=1
                     /transl_table=11
                     /product="maltose/trehalose ABC transporter"
                     /protein_id="NP_435524.1"
                     /db_xref="GI:16262731"
                     /db_xref="GeneID:1235098"
                     /translation="MIQIESLHKQFGSYEAVQGVSLSVPKGAFLVLVGPSGCGKSTIL
                     RMLAGLEAPTSGTITFGGNTVSDGGRGWVIEPSRRDTGLVFQSYALWPHMTVAGNIDW
                     PLKVAGLDRDKRCSRVGEVLDLLGIGQLAARYPNEISGGQQQRVAIARMIAPKPGILL
                     FDEPLSNLDAKLRVEMRTELLRVHRATGATSVYVTHDQVEAMTMATHVAVMNAGRIEQ
                     FGSPGELVARPRTAFVATFVGTPPANLVPVVNGAYCGRLADAALAGRNGSAMFRPEEL
                     TLAESPSDRTLTLDYAEASPMAGRVMVTGIRADLRLTAIVDSLPSFSVGHEVHFQLPP
                     APSMFFTPEGVRAQ"
     misc_feature    284576..285604
                     /locus_tag="SMa0526"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    284579..285292
                     /locus_tag="SMa0526"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    284675..284698
                     /locus_tag="SMa0526"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(284684..284689,284693..284701,284831..284833,
                     285059..285064,285161..285163)
                     /locus_tag="SMa0526"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    284822..284833
                     /locus_tag="SMa0526"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    284987..285016
                     /locus_tag="SMa0526"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    285047..285064
                     /locus_tag="SMa0526"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    285071..285082
                     /locus_tag="SMa0526"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    285149..285169
                     /locus_tag="SMa0526"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     gene            285619..286218
                     /locus_tag="SMa0527"
                     /db_xref="GeneID:1235099"
     CDS             285619..286218
                     /locus_tag="SMa0527"
                     /function="Small molecule metabolism; Energy metabolism,
                     carbon"
                     /note="glimmer prediction, AUG start may be part of
                     transcription unit with SMA0522, SMA0523, SMA0525,
                     SMA0526, SMA0527. match to E. coli gpmB phosphoglycerate
                     mutase (1e-20, 8/2000) and to E. coli cobC
                     alpha-ribazole-5'-phosphate phosphatase (2e-15, 8/2000)
                     over 85% of predicted coding region"
                     /codon_start=1
                     /transl_table=11
                     /product="phosphatase"
                     /protein_id="NP_435525.1"
                     /db_xref="GI:16262732"
                     /db_xref="GeneID:1235099"
                     /translation="MKRIILVRHGESAWNSVRRLQGQADIGLSARGEAQATALRATIE
                     AMRPDHVIASDLLRARHTAALLGYPHAQLSPALREIDVGDWTGRAIGDLMAEDQDAYL
                     GWRAGTYAPRGGERWQEFRDRVTAGLGKAVSIPGERLLVVCHGGVIRALLDGLLGLPP
                     KRIIPVGPASVTVLADKPGGMRLETFNFSPDGPVFDAPD"
     misc_feature    285625..>286068
                     /locus_tag="SMa0527"
                     /note="Histidine phosphatase domain found in
                     phosphoglycerate mutases and related proteins, mostly
                     phosphatases; contains a His residue which is
                     phosphorylated during the reaction; Region: HP_PGM_like;
                     cd07067"
                     /db_xref="CDD:132718"
     misc_feature    order(285640..285645,285790..285792,286048..286053)
                     /locus_tag="SMa0527"
                     /note="catalytic core [active]"
                     /db_xref="CDD:132718"
     gene            complement(286919..287350)
                     /locus_tag="SMa5025"
                     /db_xref="GeneID:6435263"
     CDS             complement(286919..287350)
                     /locus_tag="SMa5025"
                     /note="Has weak, possibly spurious, similarity to the SAM-
                     binding domain found in methyltransferases"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000341.1"
                     /db_xref="GI:193782575"
                     /db_xref="GeneID:6435263"
                     /translation="MAKDLSPRLLAIVDALPLRRGMRVLEIGCGPGAMAREIAGRIGD
                     GHVLAIDRSAKAIAQAQAASQAEIGSGRLSLRQVAAEDFELEAGEMPYDIAVAVRVGA
                     LDGRHPEAGRRAKRRVAAALTPQGQLLIDGGDPLRRLLLDD"
     misc_feature    complement(<287060..287284)
                     /locus_tag="SMa5025"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    complement(order(287111..287119,287195..287200,
                     287252..287272))
                     /locus_tag="SMa5025"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            complement(287402..287641)
                     /locus_tag="SMa0535"
                     /db_xref="GeneID:1235100"
     CDS             complement(287402..287641)
                     /locus_tag="SMa0535"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435526.2"
                     /db_xref="GI:193782576"
                     /db_xref="GeneID:1235100"
                     /translation="MQAAHLVARFESGKTCDQIAPRVKAIPFVTRIDSLAGEIDLLVS
                     VDADSIDSVEDVRRQVASVPGIATVTTALVLRRHL"
     misc_feature    complement(287411..287611)
                     /locus_tag="SMa0535"
                     /note="AsnC family; Region: AsnC_trans_reg; pfam01037"
                     /db_xref="CDD:250314"
     misc_feature    complement(287408..>287608)
                     /locus_tag="SMa0535"
                     /note="Transcriptional regulators [Transcription]; Region:
                     Lrp; COG1522"
                     /db_xref="CDD:224439"
     gene            287923..288336
                     /locus_tag="SMa0537"
                     /db_xref="GeneID:1235101"
     CDS             287923..288336
                     /locus_tag="SMa0537"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435527.1"
                     /db_xref="GI:16262734"
                     /db_xref="GeneID:1235101"
                     /translation="MTHTKAPITAEDTIRSWAGAVAACDIEAVCYADPLLVFDVVGQL
                     QREGKALYRRAWEDEFFPWHGGTGKFALRELSVHAGGDIAFATGLLDCGGTEGGRPAE
                     YTLRLTLGLAKTPNGWYIVHEHSSEPTSFNEKVVG"
     misc_feature    287923..288327
                     /locus_tag="SMa0537"
                     /note="Ketosteroid isomerase homolog [Function unknown];
                     Region: COG4319"
                     /db_xref="CDD:226769"
     gene            288341..288703
                     /locus_tag="SMa0538"
                     /db_xref="GeneID:1235102"
     CDS             288341..288703
                     /locus_tag="SMa0538"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435528.1"
                     /db_xref="GI:16262735"
                     /db_xref="GeneID:1235102"
                     /translation="MALLDEILEIERRLWRNDADVYAATYLPQAVLIFPGIGRIDLDT
                     AVEAIRGENAAGRHWAEVSFSAETAVEVAAGTCLVAYHADARWNDQPTAEAVDCLTVY
                     VKRDGRWRVAAHQQTASA"
     misc_feature    288359..288673
                     /locus_tag="SMa0538"
                     /note="Domain of unknown function (DUF4440); Region:
                     DUF4440; pfam14534"
                     /db_xref="CDD:258674"
     gene            289833..290228
                     /locus_tag="SMa0541"
                     /db_xref="GeneID:1235103"
     CDS             289833..290228
                     /locus_tag="SMa0541"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435529.2"
                     /db_xref="GI:193782577"
                     /db_xref="GeneID:1235103"
                     /translation="MRRILIALAATTTIVGAAAAQTAETTTTETFVTAKPTDVLSYNL
                     INLNVTNTANESIGEIKDLVLSEGQLAGYILSVGGVLGMGERYVVVSPKALKITYVEN
                     DKKWTAVMDATKDQLKAAPEFKYEGRWKR"
     misc_feature    289938..290183
                     /locus_tag="SMa0541"
                     /note="PRC-barrel domain; Region: PRC; pfam05239"
                     /db_xref="CDD:253112"
     gene            290367..290957
                     /locus_tag="SMa0543"
                     /db_xref="GeneID:1235104"
     CDS             290367..290957
                     /locus_tag="SMa0543"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435530.1"
                     /db_xref="GI:16262737"
                     /db_xref="GeneID:1235104"
                     /translation="MVAVALLMPGTDEDATETATPPATTTEPTTPQPSTSAPPPTTEP
                     APTTPRRNHQPLSRPTRSPRSRLTHGSDRRSLLLDRRNVRDASRDRRARRPSRFGCQR
                     RNNNVSSRACGSQMATQDKRGGNGRNAGNGSYLRRTSSTLSIESASTLTSRSISPARE
                     SIRVTNGTAPYLRGRFLSISPHQAAFDAVEDFPHNL"
     gene            complement(291198..291638)
                     /locus_tag="SMa0545"
                     /db_xref="GeneID:1235105"
     CDS             complement(291198..291638)
                     /locus_tag="SMa0545"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction weak match (e-04) to Pyrococcus
                     hypothetical protein over 80% of length"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435531.1"
                     /db_xref="GI:16262738"
                     /db_xref="GeneID:1235105"
                     /translation="METLVADASIAIKWVVEEEGTDSAVELRSRFRFAAPELLIPECA
                     NILWKKVQRGELSRDEAVLAAKLLERSGIDFVSMTGLLEEATNLSIVLSHPAYDCTYL
                     IAAQRTGSRFVTADMRLLRIVSERAPGEIARLCVSLPDARNDAH"
     misc_feature    complement(291264..291626)
                     /locus_tag="SMa0545"
                     /note="PIN domain of the Pyrobaculum aerophilum Pae0151
                     and Pae2754 proteins and homologs; Region: PIN_Pae0151;
                     cd09873"
                     /db_xref="CDD:189043"
     misc_feature    complement(order(291291..291293,291345..291347,
                     291513..291515,291618..291620))
                     /locus_tag="SMa0545"
                     /note="putative active site [active]"
                     /db_xref="CDD:189043"
     misc_feature    complement(order(291273..291275,291285..291296,
                     291339..291341,291345..291359,291369..291374,
                     291378..291383,291390..291392,291435..291437,
                     291444..291449,291453..291458,291492..291500,
                     291504..291521,291525..291533,291612..291614))
                     /locus_tag="SMa0545"
                     /note="homotetrameric interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:189043"
     misc_feature    complement(291291..291293)
                     /locus_tag="SMa0545"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:189043"
     gene            complement(291638..291877)
                     /locus_tag="SMa0548"
                     /db_xref="GeneID:1235106"
     CDS             complement(291638..291877)
                     /locus_tag="SMa0548"
                     /note="glimmer prediction ProDom match (3e-5) to plasmid
                     stability protein from Pseudomonas syringae and to
                     sequence from Sinorhizobium sp. NGR234 over amino terminal
                     half of SMA0548"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435532.1"
                     /db_xref="GI:16262739"
                     /db_xref="GeneID:1235106"
                     /translation="MPGNLHVRNLDDDLISKLKIRAARHGRSAEAEHREILRQALASE
                     GGPDFEELAADLRKLTASRKQTPSEVLLRESRDER"
     misc_feature    complement(291641..291874)
                     /locus_tag="SMa0548"
                     /note="Plasmid stability protein [General function
                     prediction only]; Region: StbC; COG4691"
                     /db_xref="CDD:227035"
     gene            292217..293509
                     /locus_tag="SMa0551"
                     /db_xref="GeneID:1235107"
     CDS             292217..293509
                     /locus_tag="SMa0551"
                     /function="Small molecule metabolism; Degradation"
                     /note="Catalyzes the hydrolytic cleavage of a
                     carbon-halogen bond in N-ethylammeline"
                     /codon_start=1
                     /transl_table=11
                     /product="N-ethylammeline chlorohydrolase"
                     /protein_id="NP_435533.2"
                     /db_xref="GI:193782578"
                     /db_xref="GeneID:1235107"
                     /translation="MGMALIGPGFIDLDALSDIDTGVLGLDHQPGWKKGRVWPRDYVE
                     EGPVEMLTPEELAFQKRYAFAHLIRNGITTALPIASLFYRAWNETPEEFASAAESAAD
                     LGLRVYLGPAFRAGHSVIEADGTLTVEIDAARGRAGLDAAIAFCAAHDNTHGGLVRAM
                     LAPDRVEYWTADLLKRTAGVARDLGVPVRLHCCQSTFEVETIRRSFGTGSAEWRHDIG
                     FLSERALLPHGTHTDREGLRIIADSGATVVHCPLVMARHGAALNHFGDLRRAGLRLGM
                     GTDTWPPDMILNMQIGLMLGRVMGGELDSPSSADLYDVATLGGADARGRPDLGRLQAG
                     AAADIVVIDLAAHHLGQVRDPIAGLVASANGRDVRTVFIAGRRVMSEGTIPGFDFAEA
                     HARAGAQFERLVAQYPRRTWRHPAVQSIFPPSYEVTRT"
     misc_feature    292217..293506
                     /locus_tag="SMa0551"
                     /note="N-ethylammeline chlorohydrolase; Provisional;
                     Region: PRK06151"
                     /db_xref="CDD:180428"
     misc_feature    292310..293371
                     /locus_tag="SMa0551"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     misc_feature    order(292787..292789,292898..292900,293051..293053)
                     /locus_tag="SMa0551"
                     /note="active site"
                     /db_xref="CDD:238617"
     gene            293602..294093
                     /locus_tag="SMa0552"
                     /db_xref="GeneID:1235108"
     CDS             293602..294093
                     /locus_tag="SMa0552"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism"
                     /note="glimmer prediction, GTG start moderate match
                     (3e-21, 8/2000) to predicted allantoinases over about 50%
                     of protein length"
                     /codon_start=1
                     /transl_table=11
                     /product="cyclic amidohydrolase"
                     /protein_id="NP_435534.2"
                     /db_xref="GI:193782579"
                     /db_xref="GeneID:1235108"
                     /translation="MCDLFVRNATVVTEERTFDGGISVSNGRIDELVVGQRDIAAARQ
                     IIDASGLLLLPGLVDAHVHFSEPGRGHWEGFETGSRAAAAGGITTFVEMPLNAQPATI
                     DAAALVMKKAAAKQSHIDYALWGGLVDDNLDDLADLRRGGVVGFYRERHCRGGGRGLA
                     GAT"
     misc_feature    293608..>294039
                     /locus_tag="SMa0552"
                     /note="Superfamily of metallo-dependent hydrolases (also
                     called amidohydrolase superfamily) is a large group of
                     proteins that show conservation in their 3-dimensional
                     fold (TIM barrel) and in details of their active site. The
                     vast majority of the members have a...; Region:
                     metallo-dependent_hydrolases; cl00281"
                     /db_xref="CDD:260323"
     gene            294071..294868
                     /locus_tag="SMa0554"
                     /db_xref="GeneID:1235109"
     CDS             294071..294868
                     /locus_tag="SMa0554"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435535.1"
                     /db_xref="GI:16262742"
                     /db_xref="GeneID:1235109"
                     /translation="MVWREQLDLLLGALSALHIGGLQAEGAEIWRDPEGQFVWELLCH
                     PAVIAYYERHYPFAPPLLLRAAGDRRLPDTYRSQWQAELEQEGFDAAYRQFLHLNARF
                     ISNDVIGYFIELLDGFYVFDTHIDEFRRELEQPARLGGWLTRPDRWQLLEGMASFYEF
                     ALDLDQYLAALEFPMLRGHVWLHFAYWFGNGGARMEEVALWLQNAVAHAAEDESIDGA
                     ELGEALARLRAPQRYPLVLIEQTAEVLGPWLESSGVGEQLSAGSRSL"
     gene            complement(295587..296474)
                     /locus_tag="SMa0557"
                     /db_xref="GeneID:1235110"
     CDS             complement(295587..296474)
                     /locus_tag="SMa0557"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction Good match to several
                     LysR-related transcriptional regulators.  In E. coli
                     related to Xanthosine metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435536.1"
                     /db_xref="GI:16262743"
                     /db_xref="GeneID:1235110"
                     /translation="MQREELGDLLAFLAVAEEESFTKAAARLGTSQSSLSLIIKRLEA
                     RLGVRLLTRTTRSVAPTEAGEQLFSTLAPAFGTIEAQLSALSEFRDKPAGNFRITAGQ
                     HSIDTILWPKLSAFLLAYPDIKVELVAESALTDIVAERFDAGVRLGDQVEKDMIAVRI
                     GPPARMIVVGAPSCLRDRPPPKTPQELTTHRCINLRLPSYGGFYAWEFERDGHEVRVR
                     VDGQVAFNGVPQIVKAALDGFGLTYVHEDVVREYLKNGRLVQILDDWTPPFPGYHLYY
                     PSRRHPSPAFTLLVEALKE"
     misc_feature    complement(295590..296462)
                     /locus_tag="SMa0557"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    complement(296280..296459)
                     /locus_tag="SMa0557"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(295596..296201)
                     /locus_tag="SMa0557"
                     /note="The C-terminal substrate binding domain of an
                     uncharacterized LysR-type transcriptional regulator
                     CrgA-like, contains the type 2 periplasmic binding fold;
                     Region: PBP2_CrgA_like_5; cd08474"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(295659..295661,295740..295742,
                     295791..295793,295983..295985,295992..295994,
                     296034..296036,296151..296153,296163..296165))
                     /locus_tag="SMa0557"
                     /note="putative effector binding pocket; other site"
                     /db_xref="CDD:176163"
     misc_feature    complement(order(295764..295766,295773..295778,
                     295797..295811,295902..295904,296088..296108,
                     296112..296114,296124..296126,296133..296138,
                     296142..296147,296157..296162))
                     /locus_tag="SMa0557"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176163"
     gene            296598..296990
                     /locus_tag="SMa0558"
                     /db_xref="GeneID:1235111"
     CDS             296598..296990
                     /locus_tag="SMa0558"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction carboxyl third has weak ProDom
                     match (3e-3) to hypothetical proteins of similar length"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435537.2"
                     /db_xref="GI:193782580"
                     /db_xref="GeneID:1235111"
                     /translation="MGLKRLLIIAASIIAPLPVQQVVAQEAKGPVIRIAELEIDPAQM
                     AAYSAAVKEEMEESMRVEPGVLALYAVSIKGQSHHLRFFEMYADQAAYESHRESPHFR
                     KYVETTKDMITSRKLLETDNFQLSAKLR"
     misc_feature    296679..296981
                     /locus_tag="SMa0558"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG1359"
                     /db_xref="CDD:224278"
     gene            297048..297791
                     /locus_tag="SMa0559"
                     /db_xref="GeneID:1235112"
     CDS             297048..297791
                     /locus_tag="SMa0559"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction match (5e-10, 8/2000) to several
                     4-carboxymuconolactone decarboxylases in 40% of the
                     protein"
                     /codon_start=1
                     /transl_table=11
                     /product="4-carboxymuconolactone decarboxylase"
                     /protein_id="NP_435538.2"
                     /db_xref="GI:193782581"
                     /db_xref="GeneID:1235112"
                     /translation="MMTTSNAGAQQPNVEGRRFSPDQVRSVAPALEQYTQQRLYGDVW
                     QRPGLNRRDRSLVTIAALIARGEAPALTYYADQALENGVKPSEISETITHLAYYSGWG
                     KAMATVGPVSEAFAKRGIGQDQLAAVESTPLPLDEEAEAQRATTVGNQFGSVAPGLVQ
                     YTTDYLFRDLWLRPDLAPRDRSLVTIAALISVGQVEQITFHLNKALDNGLSEEQAAEV
                     ITHLAFYAGWPNAMSALPVAKAVFEKRRG"
     misc_feature    297099..297413
                     /locus_tag="SMa0559"
                     /note="Uncharacterized homolog of
                     gamma-carboxymuconolactone decarboxylase subunit [Function
                     unknown]; Region: COG0599"
                     /db_xref="CDD:223672"
     misc_feature    297459..297788
                     /locus_tag="SMa0559"
                     /note="Uncharacterized homolog of
                     gamma-carboxymuconolactone decarboxylase subunit [Function
                     unknown]; Region: COG0599"
                     /db_xref="CDD:223672"
     gene            297935..298318
                     /locus_tag="SMa0561"
                     /db_xref="GeneID:1235113"
     CDS             297935..298318
                     /locus_tag="SMa0561"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction, GTG start good match (7e-44,
                     8/2000) to hypothetical Xylella protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435539.1"
                     /db_xref="GI:16262746"
                     /db_xref="GeneID:1235113"
                     /translation="MLPMNIWPTDELRQIAESDDLHIAPFRENGRTYGTLTWIWSVVV
                     DGELYVRGYNGQQSRWYQAAIRQKAGRITAAGMTKEVSFEPVEGAINDQIDEGYRRKY
                     ATSRYLAPMIGERARAATVKITPKD"
     misc_feature    297935..298315
                     /locus_tag="SMa0561"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4334"
                     /db_xref="CDD:226784"
     gene            298329..299318
                     /locus_tag="SMa0563"
                     /db_xref="GeneID:1235114"
     CDS             298329..299318
                     /locus_tag="SMa0563"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction excellent match (e-102, 8/2000)
                     to aldehyde oxidases and dehydrogenases, oxidoreductases"
                     /codon_start=1
                     /transl_table=11
                     /product="aldehyde or keto oxidase"
                     /protein_id="NP_435540.1"
                     /db_xref="GI:16262747"
                     /db_xref="GeneID:1235114"
                     /translation="MQKRKLGQGLEVSALSLGCMGYGKARDIPDRPQMIELLRRAVDL
                     GMDFFDTAEVYGPWTNEEMVGEAFAGMRDKVKIATKFGWDIDQSTGEHGGGVNSKPTQ
                     IRSAVEGSLKRLRTDFIDLLYQHRVDPDVPMEDVAGTVKDLIAEGKVRYFGLSEAGAE
                     SIRRAHAVQPVAALQSEYSLWTREPEAEIIPTLEELGIGLVPFSPLGKGFLAGKIDAS
                     TAFAANDFRSQIPRFAPEAREANQALVDLIRSVGERRSATPAQVALAWLMAQKPWIVP
                     LFGTRKLERLEENLGALSVTLSDDDLEQIESGAAAIRIEGARYPEEMLRRSGR"
     misc_feature    298335..299249
                     /locus_tag="SMa0563"
                     /note="Aldo-keto reductases (AKRs) are a superfamily of
                     soluble NAD(P)(H) oxidoreductases whose chief purpose is
                     to reduce aldehydes and ketones to primary and secondary
                     alcohols. AKRs are present in all phyla and are of
                     importance to both health and industrial...; Region:
                     Aldo_ket_red; cd06660"
                     /db_xref="CDD:119408"
     misc_feature    298338..299249
                     /locus_tag="SMa0563"
                     /note="voltage-dependent potassium channel beta subunit,
                     animal; Region: Kv_beta; TIGR01293"
                     /db_xref="CDD:213602"
     misc_feature    order(298380..298388,298476..298478,298491..298493,
                     298566..298568,298701..298706,298791..298796,
                     298851..298853,298935..298952,299106..299108,
                     299157..299168,299181..299183,299190..299195)
                     /locus_tag="SMa0563"
                     /note="active site"
                     /db_xref="CDD:119408"
     misc_feature    order(298476..298478,298491..298493,298566..298568,
                     298701..298703)
                     /locus_tag="SMa0563"
                     /note="catalytic tetrad [active]"
                     /db_xref="CDD:119408"
     gene            299384..300487
                     /locus_tag="SMa0564"
                     /db_xref="GeneID:1235115"
     CDS             299384..300487
                     /locus_tag="SMa0564"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction start codon changed based on
                     codon usage and homology; Excellent match (e-117) to
                     Xylella hypothetical protein. Best match (e-22, 8/2000) to
                     quinoprotein glucose  protein, chain B. ProDom match
                     (e-51) to central domain of family including glucose
                     dehydrogenase, PQQ protein"
                     /codon_start=1
                     /transl_table=11
                     /product="dehydrogenase"
                     /protein_id="NP_435541.2"
                     /db_xref="GI:193782582"
                     /db_xref="GeneID:1235115"
                     /translation="MPILPEKRRTRMRKRLICTTLSILVGGCCLSGTSMAQDASTPIL
                     DRGEGAWSSSVLADGLDYPWDIVRDGERLILTEKAGTVVIIEGGNVQRSTLQTSDPLR
                     TEGGAGLLGIALAPDFADSGQAFFYYSYSSGSEPANRIVAARFDGNTWRETAVLVDAI
                     PGHRLYNGGRIAIGPDDHLYVTTGWTENYERPQDLQSLAGKVLRLTLAGGVPEDNPFQ
                     GSLVYSFGHRNPQGLAWNAEGELFVSEHGQAALDEINLIAPGANYGWPIISGDETQEG
                     MQPPFVHSGGDTWAPSGIAFAGNELLVTALQGRGLYVLDRQARTLQPVVSLGERVRHV
                     LPVGDDLLLITTNRSPRGQGPSKDRLVRLSAQN"
     misc_feature    299405..300484
                     /locus_tag="SMa0564"
                     /note="Glucose/sorbosone dehydrogenases [Carbohydrate
                     transport and metabolism]; Region: COG2133"
                     /db_xref="CDD:225044"
     misc_feature    299534..>300268
                     /locus_tag="SMa0564"
                     /note="dehydrogenase, PQQ-dependent, s-GDH family; Region:
                     non_repeat_PQQ; cl19645"
                     /db_xref="CDD:267998"
     gene            300571..301050
                     /locus_tag="SMa5026"
                     /db_xref="GeneID:6435264"
     CDS             300571..301050
                     /locus_tag="SMa5026"
                     /note="Uncharacterized conserved protein, contains double-
                     stranded beta-helix domain [Function unknown]; Weak
                     similarity to cupin"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000342.1"
                     /db_xref="GI:193782583"
                     /db_xref="GeneID:6435264"
                     /translation="MKKLIAAASLVILSTAIARAQTIEITPNASAPSALGDAKLFSGH
                     VVVASLFPANEFTHGTGGHVTFAPGARTAWHTHPAGQMLIVTSGKGWVQQEGGEKREI
                     NSGDVVWIPVGVNHWHGATNKTGMGHIAISYMKEGKNVEWGKLVTDEEFVGQVPPRD"
     misc_feature    300622..301011
                     /locus_tag="SMa5026"
                     /note="Uncharacterized conserved protein, contains
                     double-stranded beta-helix domain [Function unknown];
                     Region: COG1917"
                     /db_xref="CDD:224829"
     gene            301204..301761
                     /locus_tag="SMa0567"
                     /db_xref="GeneID:1235117"
     CDS             301204..301761
                     /locus_tag="SMa0567"
                     /function="Small molecule metabolism; Fatty acid
                     biosynthesis"
                     /note="glimmer prediction Good match (e-57) of entire
                     SMA0567 protein to carboxyl terminal third of
                     Sinorhizobium meliloti acetoacetyl CoA synthetase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435543.1"
                     /db_xref="GI:16262750"
                     /db_xref="GeneID:1235117"
                     /translation="MRSSLRGLSINSFFETTSYLEFRSSYSDESARIDQVAEPAFDVS
                     QHGGIVIHGRSDATLNPGGVRIGTAEIYSQVEQLHEVAESLCIGQDWDDDIRVILFVL
                     LRDGFDLTEELQAKIKAKIRTGASPRHVPTKIVQVSDIPRTKSGKIVELAVRDVDHGR
                     PVVNKEVLANPEALDQFVAMVELSV"
     misc_feature    <301330..301734
                     /locus_tag="SMa0567"
                     /note="Adenylate forming domain, Class I; Region:
                     AFD_class_I; cl17068"
                     /db_xref="CDD:266508"
     misc_feature    order(301387..301395,301567..301569,301585..301587)
                     /locus_tag="SMa0567"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:213270"
     gene            complement(301877..303766)
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /db_xref="GeneID:1235118"
     CDS             complement(301877..303766)
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /function="Small molecule metabolism; Global functions"
                     /note="glimmer prediction excellent match to cya3 from
                     Sinorhizobium meliloti but match to only one 'real' adenyl
                     cyclase, from Anabaena is only (e-7) and 25% of protein"
                     /codon_start=1
                     /transl_table=11
                     /product="CyaF4 adenylate cyclase"
                     /protein_id="NP_435544.1"
                     /db_xref="GI:16262751"
                     /db_xref="GeneID:1235118"
                     /translation="MERKLCAILAADVVGYSALMERDEAGTFERLHAGRKELFEPEIA
                     RHHGKVFKLMGDGLLAEFGSVVDAVECAVSLQRGLTERNAAVPHDQRIRVRIGINLGE
                     VIVEREDRYGEGVNVAARLQQLAEPGGICVSGKVAREVEKKLAFGFEPMGEQKVKNII
                     EPVQAFRIIIEWQARRRPVIRFQRYWVGTGTAVLALLLVLAGAAWQFWPTATVSGKPS
                     VAVLPFDNYGGDEASGRLADGLTEDIITDLARFPEFKVIARNSTETYKGKAIDVREIG
                     KALDVGFVVEGSIAREADRVRVTAQLIDSKQGRHLWSQRWDRPDKEVFVIQAEIAEQI
                     ANRLGGGAGLVQESGRIAAHRKVPGNLNAYELYLLGTERLEQLDQANLEAALSLLTQA
                     VQSDPGLARGWVELFHTHDLLAGLGIEPERNRALADAAAERALTLDPSDPEAHAVYGS
                     SLGMRGDFARAEAEYEAALRMAPNAAEILIFYIGWASTFGKPERGADLVERAIQLDPN
                     YPGWANRPFGLAYFMAGRYPEAVTMFERLGIERHNRWSWAAHAGALAAAERRTEAAAL
                     VARAMAAHPDLSIELIANEPGWSDAERRRFINTMRLAGFPACTKPEVLAKIEKPLRLP
                     ECASL"
     misc_feature    complement(303233..303757)
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    complement(303263..303748)
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(303296..303298,303407..303412,
                     303419..303424,303434..303442,303590..303592,
                     303599..303607,303611..303613,303716..303733,
                     303737..303739))
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(303599..303601,303731..303733))
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    complement(order(303296..303298,303419..303421,
                     303428..303439,303455..303457,303608..303613,
                     303647..303649,303662..303664,303671..303676,
                     303683..303685,303716..303718))
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     misc_feature    complement(302747..303154)
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5616"
                     /db_xref="CDD:227903"
     misc_feature    complement(302159..>302362)
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(302195..302200,302207..302212,
                     302225..302230,302303..302308,302312..302317,
                     302321..302326))
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(302165..302167,302177..302179,
                     302213..302215,302261..302263,302270..302272,
                     302282..302284,302315..302317))
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(302159..>302299)
                     /gene="cyaF4"
                     /locus_tag="SMa0570"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     gene            304557..304880
                     /locus_tag="SMa0572"
                     /db_xref="GeneID:1235119"
     CDS             304557..304880
                     /locus_tag="SMa0572"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435545.1"
                     /db_xref="GI:16262752"
                     /db_xref="GeneID:1235119"
                     /translation="MKTIIPRQLARSDVEAAIDYYAREAGTEVTHGFIGALQAAYASI
                     ASHPEAGSLRYAYELGLPDLRSVSLKRYPYLIFYRDQPDHVDVWRVLHAKRDNPQWMQ
                     EPNNH"
     misc_feature    304557..304865
                     /locus_tag="SMa0572"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(305128..305841)
                     /locus_tag="SMa0574"
                     /db_xref="GeneID:1235120"
     CDS             complement(305128..305841)
                     /locus_tag="SMa0574"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction matches (2e-16) hypothetical
                     protein from Streptomyces coelicolor"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435546.2"
                     /db_xref="GI:193782584"
                     /db_xref="GeneID:1235120"
                     /translation="MIVQACLNGARPSDYHPRLPLTADAIALDGAACISAGAAELHIH
                     PRGPDGRESLLAVDEAIYAVRRACPGSLVGVSTGAWIERDEKQTRDCISAWRQLPDYA
                     SVNISERDAPAVIALLHRMGVGVEAGLATVADAERFVTLPDCHRAFRILIEIEEQDLG
                     KADAIADGIAQVLERANILRPVLLHGLDATAWHFVNRAHQRRWSTRVGLEDGCQLTNG
                     EIAGGNADLVADALQIFRS"
     misc_feature    complement(305131..305841)
                     /locus_tag="SMa0574"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG3246"
                     /db_xref="CDD:225785"
     gene            305892..306179
                     /locus_tag="SMa0575"
                     /db_xref="GeneID:1235121"
     CDS             305892..306179
                     /locus_tag="SMa0575"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435547.2"
                     /db_xref="GI:193782585"
                     /db_xref="GeneID:1235121"
                     /translation="MGSFEPLIAPIADDHLRAKGAVRHEPCARLVARMFTFWAKKIAY
                     CIAWNSGLLVELRRVVGAVPKAPTTLITEPPPLSHRSTLIGQEPDPATRFA"
     gene            306248..307339
                     /locus_tag="SMa0576"
                     /db_xref="GeneID:1235122"
     CDS             306248..307339
                     /locus_tag="SMa0576"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction Excellent match (e-48) to both
                     LivK, the E. coli leucine-specific binding protein and
                     LivJ, the E. coli Leu/Val/Ile binding protein involved in
                     branched chain amino acid transport"
                     /codon_start=1
                     /transl_table=11
                     /product="Leu or Leu/Val/Ile transport binding protein"
                     /protein_id="NP_435548.1"
                     /db_xref="GI:16262755"
                     /db_xref="GeneID:1235122"
                     /translation="MRHLFTAAALAFALASQSEAEVLIGVAGPMSGKLAWTGTQLRRG
                     AEMAVANINAAGGVLGQQVRLIVADDFCDPRQALAAAEKLVADGAVFVIGHYCSGASI
                     PASKIYAAAGVLQISPSSTNPMLTEQGHANVFRVCSRDDAQGHKAGNYLADHWGDSKI
                     AILHDNTTYGKGLADETKKQLNMRGVTEAVYQSYTPGKDDYSVEVAALQTAHIAVLYL
                     GGYHTEAALMVRAARDRAYPVQLISGDDTATEAFGLIAGPAAEGTLFTFVADPRRNAE
                     AAEVVERFRAENFEPDSWTLHSYGAAEIWAQAVTKANSLDLQAVIAALREDQFDTVLG
                     RIDFDKKGDLTVQSWVWYVWKSGEYVPVE"
     misc_feature    306317..307309
                     /locus_tag="SMa0576"
                     /note="Type I periplasmic ligand-binding domain of ABC
                     (Atpase Binding Cassette)-type active transport systems
                     that are involved in the transport of all three branched
                     chain aliphatic amino acids (leucine, isoleucine and
                     valine); Region: PBP1_ABC_LIVBP_like; cd06342"
                     /db_xref="CDD:107337"
     misc_feature    order(306335..306337,306362..306364,306374..306376,
                     306383..306385,306935..306937,306998..307000,
                     307007..307009,307016..307021,307109..307111)
                     /locus_tag="SMa0576"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:107337"
     misc_feature    306365..307309
                     /locus_tag="SMa0576"
                     /note="Receptor family ligand binding region; Region:
                     ANF_receptor; pfam01094"
                     /db_xref="CDD:250359"
     misc_feature    order(306533..306541,306602..306607,306752..306754,
                     306908..306910,306980..306982)
                     /locus_tag="SMa0576"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:107337"
     gene            307530..309989
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /db_xref="GeneID:1235123"
     CDS             307530..309989
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /function="Small molecule metabolism; Global functions"
                     /note="glimmer prediction Contains domain in carboxyl
                     terminus that matches (e-31) adenyl cyclases. ProDom
                     scores lower (e-7) to adenyl cyclase motifs"
                     /codon_start=1
                     /transl_table=11
                     /product="guanylate cyclase"
                     /protein_id="NP_435549.2"
                     /db_xref="GI:193782586"
                     /db_xref="GeneID:1235123"
                     /translation="MFDRLGVRGRLLFAFFGISAFAVLATVGALYAFLELSQVLERVT
                     ERRAPSALASLELSRHAERVAATAPAFLASTSRARHSEVSAAIGSEMARLEELLAALK
                     GATLSSGVVSEIEDAVVGLRRNLHALDDLVTVRLAAVARKEELLRRLSATTNASQRLV
                     APGILVMNSKVPRWRAATADAVTTPEAEAAATRDLARAIAAYIPQQTAQREIAAINDT
                     LLQAAVAPTPGDLSLISFPLRRSIETLESVTPEFDEQLRKRFQQLVDQFEALIDGQRS
                     IPNARNEELAVVAEGEKLVVENDKLSRKLTLAVDRLVAAAKGDIAEAGSEAATVRRYG
                     TGVVLGSALLSLLSSVLIVWLYVDRNLLARLTGLSHSMLAIAAGDLRVPLPQTRGDEI
                     GRMAKALRVFRDTAIEVEEKNLRTVAEARQRLIDAIESISEGFAFYDSEDRLLVCNSR
                     YRDILYPGMDDTVVSGTHFEAIIRAAAERGLIEDAIGREQEWLAERLEAHRNPTGTLL
                     QQRGPDRWIQISERRISGGGTVAVYSDITELKRREQDLSEKSVALEALSAKLAKYLAP
                     QVYNSIFSGKQDVRIESRRKKLTICFSDIAAFTETTDKMESEELTQLLNQYLTEMSKI
                     ALSFGATIDKYVGDAILMFFGDPETRGIREDAIACVSMALAMQERMGELGETWRSVGI
                     EMPLRCRIGIHTDYCTVGNFGSEDRMDYTIIGGAVNLAARLEEEAAPGSVLISYETFA
                     QVKDLIHCEETGRVQIRGIAYPVATYRVVDFKANLTKSCNAIRTELPHLRLEAEPELM
                     STGEREVAITALRETLDRLRR"
     misc_feature    308610..308741
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="Histidine kinase, Adenylyl cyclase,
                     Methyl-accepting protein, and Phosphatase (HAMP) domain.
                     HAMP is a signaling domain which occurs in a wide variety
                     of signaling proteins, many of which are bacterial. The
                     HAMP domain consists of two alpha helices...; Region:
                     HAMP; cd06225"
                     /db_xref="CDD:100122"
     misc_feature    order(308610..308615,308622..308627,308631..308636,
                     308643..308648,308652..308654,308700..308705,
                     308709..308714,308721..308726,308730..308735)
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:100122"
     misc_feature    308811..309161
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="PAS fold; Region: PAS_7; pfam12860"
                     /db_xref="CDD:257355"
     misc_feature    309267..309839
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="Adenylate cyclase, family 3 (some proteins contain
                     HAMP domain) [Signal transduction mechanisms]; Region:
                     CyaA; COG2114"
                     /db_xref="CDD:225025"
     misc_feature    309291..309833
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="cyclase homology domain; Region: CHD; cd07302"
                     /db_xref="CDD:143636"
     misc_feature    order(309303..309305,309309..309326,309429..309431,
                     309435..309443,309450..309452,309660..309668,
                     309678..309683,309690..309695,309798..309800)
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="nucleotidyl binding site; other site"
                     /db_xref="CDD:143636"
     misc_feature    order(309309..309311,309441..309443)
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="metal binding site [ion binding]; metal-binding
                     site"
                     /db_xref="CDD:143636"
     misc_feature    order(309324..309326,309360..309362,309369..309374,
                     309381..309383,309393..309395,309429..309434,
                     309621..309623,309630..309632,309663..309674,
                     309681..309683,309798..309800)
                     /gene="cyaN"
                     /locus_tag="SMa0579"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:143636"
     gene            complement(310425..311225)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /db_xref="GeneID:1235125"
     CDS             complement(310425..311225)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction Excellent match (e-87) to
                     nitrate transport protein ATP binding component nasD from
                     Klebsiella oxytoca starting at amino acid 35 of glimmer
                     prediction. Met33 of glimmer prediction has good SD
                     sequence and was called SMA0581 start. ChrD, NasD and NrtC
                     are synonyms. Possible operon with SMA0581, SMA0583 and
                     SMA0585"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter ATP-binding protein"
                     /protein_id="NP_435551.1"
                     /db_xref="GI:16262758"
                     /db_xref="GeneID:1235125"
                     /translation="MTKSYLSLELLDKSFERGGTRTEVLKQVSLTVDKGEFISIIGHS
                     GCGKSTLLNIVGGLTQATTGVVLLDGKVVDEPGPDRAVVFQNHSLLPWLTVYENVRLA
                     VDKVFSRTRNKQERHEWTMRNLELVQMAHAAEKHPSEVSGGMKQRVGIARALAMEPKV
                     LLLDEPFGALDALTRAHLQDQVMQIHATLGNTVLMITHDVDEAVLLSDRIVMMTNGPS
                     ARVGEILDVPLARPRRRIELASDRTYLTCRESVLKFLYERHRFVEAAE"
     misc_feature    complement(310440..311219)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, ATPase component [Inorganic ion transport and
                     metabolism]; Region: TauB; COG1116"
                     /db_xref="CDD:224041"
     misc_feature    complement(310539..311210)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="ATP-binding cassette domain of the nitrate and
                     sulfonate transporters; Region:
                     ABC_NrtD_SsuB_transporters; cd03293"
                     /db_xref="CDD:213260"
     misc_feature    complement(311079..311102)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(order(310632..310634,310731..310736,
                     310971..310973,311076..311084,311088..311093))
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(310971..310982)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(310779..310808)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(310731..310748)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="Walker B; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(310713..310724)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="D-loop; other site"
                     /db_xref="CDD:213260"
     misc_feature    complement(310626..310646)
                     /gene="nrtC"
                     /locus_tag="SMa0581"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213260"
     gene            complement(311239..312132)
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /db_xref="GeneID:1235126"
     CDS             complement(311239..312132)
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction Possible operon with SMA0581,
                     SMA0583 and SMA0585. Excellent match to nitrate transport
                     proteins in Klebsiella (NasB) and cyanobacteria (NtrB)"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter permease"
                     /protein_id="NP_435552.1"
                     /db_xref="GI:16262759"
                     /db_xref="GeneID:1235126"
                     /translation="MSVTNLKLKPQATPQTAAQVIALGQTASRGIDGRLSRFVTQTVT
                     NLLPLLVTLTFFTLAWQLICSSPESSLPAPSRVLEESWELIAHPFYIGQGVDQGLFWH
                     VFASLQRVALGYAMAAAVGVALGTLVGQSALAMRGLDPIFQVLRTVPPLAWLPLSLAA
                     FQDGTPSAIFVIFITAIWPIIINTAVGIRNIPQDYQNVAKVLRLNSFEYFGKIMLPAA
                     APYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAWNSSLISDIIVALIYVGIVG
                     FLLDRLIALVGRAVTRGTANA"
     misc_feature    complement(311257..312030)
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     system, permease component [Inorganic ion transport and
                     metabolism]; Region: TauC; COG0600"
                     /db_xref="CDD:223673"
     misc_feature    complement(311299..311817)
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(311305..311310,311317..311322,
                     311326..311331,311338..311343,311371..311376,
                     311407..311412,311419..311430,311449..311451,
                     311458..311463,311503..311505,311554..311556,
                     311563..311568,311578..311580,311584..311589,
                     311596..311598,311602..311604,311608..311613,
                     311659..311661,311665..311670,311677..311706,
                     311710..311721,311746..311748,311761..311766,
                     311773..311778))
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(311413..311430,311659..311703))
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(311341..311343,311371..311373,
                     311380..311382,311410..311412,311626..311628,
                     311659..311661))
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    complement(order(311482..311484,311494..311499,
                     311515..311553))
                     /gene="nrtB"
                     /locus_tag="SMa0583"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            complement(312195..313487)
                     /gene="nrtA"
                     /locus_tag="SMa0585"
                     /db_xref="GeneID:1235127"
     CDS             complement(312195..313487)
                     /gene="nrtA"
                     /locus_tag="SMa0585"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction Excellent match (e-143) with
                     nitrate binding protein precursor proteins from several
                     cyanobacteria.  Possible operon with SMA0581, SMA0583 and
                     SMA0585"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrate ABC transporter substrate-binding
                     protein"
                     /protein_id="NP_435553.1"
                     /db_xref="GI:16262760"
                     /db_xref="GeneID:1235127"
                     /translation="MTKTLFGGLTRRSVLKTTATAAMVGAARTLLPSGAFAQGAGPET
                     AKATLGFIALTDSAPLIIAKEKGLFDKYGMTEVEVVKQASWGTTRDNLVLGSAGAGID
                     GAHILTPMPYLISTGKVTQNNQPLPMAILARLNLDAQAISVGAAYADLKVGIDASVLK
                     DAFAKKKAGGEAAKVAMTFPGGTHDLWIRYWLAAAGIDPDKDVETIVVPPPQMVANMK
                     VGTMDCFCVGEPWNEQLVNQKIGYTAVNTAEIWAEHPEKSFAMRADWVEKNPRAVKAL
                     VMAIEEAAQWCDDMANKDELAKIVGKRSWFNVPPKDIVDRLKGEYDYGNGKIVENSPH
                     FMKFWREHASYPFQSHDAWFLTENIRWGKLASDTDIKGLIAKVNREDIWREAAKDLGI
                     SDIPASTSRGPETFFDGKVFDPANPETYLKSLAISRIA"
     misc_feature    complement(312384..313445)
                     /gene="nrtA"
                     /locus_tag="SMa0585"
                     /note="ABC-type nitrate/sulfonate/bicarbonate transport
                     systems, periplasmic components [Inorganic ion transport
                     and metabolism]; Region: TauA; COG0715"
                     /db_xref="CDD:223787"
     misc_feature    complement(312585..313370)
                     /gene="nrtA"
                     /locus_tag="SMa0585"
                     /note="NMT1-like family; Region: NMT1_2; pfam13379"
                     /db_xref="CDD:257706"
     gene            314305..314763
                     /locus_tag="SMa0590"
                     /db_xref="GeneID:1235128"
     CDS             314305..314763
                     /locus_tag="SMa0590"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435554.1"
                     /db_xref="GI:16262761"
                     /db_xref="GeneID:1235128"
                     /translation="MICGPYHDSVRFAANCAAGCLSYLSDTRGRFGRLPGEAGAQFVA
                     RHVVSPAREGGTDDGRGGSGYHAPTPNPRILASQTQAQDQSDHRQERTDSLSRHRSRQ
                     SGRQRAAFALTGAPHPSMARRRGRRAPTAAMRAVKTYPRPRPGVCAIWPS"
     repeat_region   314549..314988
                     /standard_name="ISRm17"
                     /note="SMa4002; predicted by homology, possible ISRm17
                     fragment, 92% identical over length to ISRm17"
                     /rpt_family="ISRm17"
     gene            314792..314986
                     /locus_tag="SMa0591"
                     /db_xref="GeneID:1235129"
     CDS             314792..314986
                     /locus_tag="SMa0591"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction Excellent match to 64 amino
                     acids at carboxyl terminus of much larger (44 kDa) protein
                     from Sinorhizobium NGR234"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, fragment"
                     /protein_id="NP_435555.1"
                     /db_xref="GI:16262762"
                     /db_xref="GeneID:1235129"
                     /translation="MVRSRWVYRKLRNFRAGIEAGISGLTRTYGLAHCTWRGLHHFET
                     YVSSSVVAYNLALFARLRPT"
     misc_feature    <314792..314983
                     /locus_tag="SMa0591"
                     /note="Transposase and inactivated derivatives, IS5 family
                     [DNA replication, recombination, and repair]; Region:
                     COG3039"
                     /db_xref="CDD:225581"
     gene            315280..316452
                     /locus_tag="SMa0592"
                     /db_xref="GeneID:1235130"
     CDS             315280..316452
                     /locus_tag="SMa0592"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction match (e-19) to two similar size
                     (45 kDa) proteins in Sinorhizobium sp. NGR234 over entire
                     length"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435556.1"
                     /db_xref="GI:16262763"
                     /db_xref="GeneID:1235130"
                     /translation="MALRSANILFKDETAGTLVETANGGTRFAYHSDWNEGNIACCFP
                     STQREHEWKVGLHPFFQHLGPEGWLREQQARSAHIVEEDDLGLLLRYGADCIGAVSIR
                     PPDDAAQLPEITEATVSPGRTVSGVQKKLLVTKDDENRFVPASATGSALYIAKFNSDR
                     IDNLVRNELLSLRWTAAVLGEREVTGFTASLTAVVDETALIVTRFDRRPNGEKLRLED
                     CAQILSKPKGQDYAGKYDAAYEDIAAIIRQHSSRAPIDLLRFFNRLIVFTLIGNCDAH
                     LKNFSLLETPTGLRLSPAYDVVNTAFYDGFDQTLALSIGGEKIHLEAANQAIFRAFGK
                     EIGLPDRAIDQTFKQLKRQVEKAASIIRPPDAEPADGFVHRFKEIVDNSCLRILET"
     misc_feature    315280..316446
                     /locus_tag="SMa0592"
                     /note="Toxin module HipA, protein kinase of
                     phosphatidylinositol 3/4-kinase superfamily [General
                     function prediction only]; Region: HipA; COG3550"
                     /db_xref="CDD:226080"
     misc_feature    315295..315585
                     /locus_tag="SMa0592"
                     /note="HipA N-terminal domain; Region: Couple_hipA;
                     pfam13657"
                     /db_xref="CDD:257965"
     misc_feature    315649..315900
                     /locus_tag="SMa0592"
                     /note="HipA-like N-terminal domain; Region: HipA_N;
                     pfam07805"
                     /db_xref="CDD:254443"
     misc_feature    315916..316167
                     /locus_tag="SMa0592"
                     /note="HipA-like C-terminal domain; Region: HipA_C;
                     pfam07804"
                     /db_xref="CDD:254442"
     gene            316428..317459
                     /locus_tag="SMa0594"
                     /db_xref="GeneID:1235131"
     CDS             316428..317459
                     /locus_tag="SMa0594"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435557.1"
                     /db_xref="GI:16262764"
                     /db_xref="GeneID:1235131"
                     /translation="MPENTGNIAPLAWQRYVEEALRRRKAEGLTQKHHSALAGVSHPT
                     MAAFERGETTLTLAKALDILRVVGLVDEPTEGDTQARFVRDAFERWRNLVAPLPQDSP
                     ARFPNGWYRFDYWLEGDLKMSELTAFERILEKAVVRKTGWPPFWLPTREAIQPREVDG
                     LIECWLAPQGEEVERGFNDPAHCDFWRAAPSGRMFLIRGYQEDGAETFPAGTILDTTL
                     PLWRMGEVLLHAEKLASLLRKDADTAVTVHFRAMFTGLRGRVLRSWANPLSDLLVEGH
                     GARSDEAVLEAKFSANDIESRLAECMLPLLTSLYERFGVAGLSLNRVEAEVQRLLNSP
                     ISKERRPRR"
     misc_feature    316482..316634
                     /locus_tag="SMa0594"
                     /note="Helix-turn-helix XRE-family like proteins.
                     Prokaryotic DNA binding proteins belonging to the
                     xenobiotic response element family of transcriptional
                     regulators; Region: HTH_XRE; cd00093"
                     /db_xref="CDD:238045"
     misc_feature    order(316491..316493,316500..316502,316575..316577)
                     /locus_tag="SMa0594"
                     /note="non-specific DNA binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238045"
     misc_feature    order(316497..316499,316572..316574)
                     /locus_tag="SMa0594"
                     /note="salt bridge; other site"
                     /db_xref="CDD:238045"
     misc_feature    order(316518..316523,316554..316556,316563..316565,
                     316575..316580)
                     /locus_tag="SMa0594"
                     /note="sequence-specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238045"
     gene            complement(318078..319409)
                     /locus_tag="SMa0599"
                     /db_xref="GeneID:1235133"
     CDS             complement(318078..319409)
                     /locus_tag="SMa0599"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435559.2"
                     /db_xref="GI:193782587"
                     /db_xref="GeneID:1235133"
                     /translation="MGKQVTGHNRCTIHSGLFRPLQSIVVCGMLVVVAGCGGHPKGVL
                     TPVADSMPATSRVEMLITTTRGRSEVPGEMFTGERARAPAFANITVSIPPVRKVGEVA
                     WPKKLPSNPATDFATLKADDLTRDGAKTWLNTTVSKSPDRSVLVFVHGFNNRFEDSVY
                     RFAQIVHDSGIKSAPVLVTWPSRGSLLAYGYDRESTNYTRNALESLFQYLAEDGEVKE
                     VSILAHSMGNWLTLEALRQMAIRNDGLPAKFKNVMLAAPDVDVDVFRSQIEDMGSQHP
                     RFTLFVSRDDRALAFSRRVWGDIPRLGSIDPEADPYKQELAENEITVIDLTKVKAGDG
                     MHHGKFAESPEVVRLIGARISEGQPLTDSRMGLGDHLIAGTTGAAAAAGSAAGLILAA
                     PVAVIDPHTRDNYANHVGAAMGQSDGKQKIAVTDCVSRQSAERDPACAPQN"
     misc_feature    complement(318198..319319)
                     /locus_tag="SMa0599"
                     /note="Uncharacterized protein conserved in bacteria
                     [Function unknown]; Region: COG4782"
                     /db_xref="CDD:227121"
     gene            complement(319553..321799)
                     /locus_tag="SMa0601"
                     /db_xref="GeneID:1235134"
     CDS             complement(319553..321799)
                     /locus_tag="SMa0601"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction, start codon changed based on
                     codon usage; match to cya3 adenyl cyclase of S. meliloti
                     but not to adenyl cyclases that matched with cya3.  cya3
                     match over carboxyl 50% of protein. Catalytic domain is
                     not present"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435560.2"
                     /db_xref="GI:193782588"
                     /db_xref="GeneID:1235134"
                     /translation="MIHAAASEAEKPQSTDSRCLAQLARIRQSAEFDATGREHRFLQY
                     VVEETLAGRGSRIKAYTVAVEVFGRDSTFDPQNDPIVRIAASHLRRSLERYYLTAGKS
                     DPIVIGIPKGGYLPTFSERGSPEDANAAESSMPTMQAQAAGPSDASPVAARPPPGPGP
                     GPGPDDVRAQFERIVSSKEFHGGGRGDALLRYIIEETLAGRAERIKGYSIAIEVFKRD
                     KSFTQDDPVVRIEAARLRRALERYYLVAGQNDPLRIEVPKGGYGPTFSWKEAVRAESD
                     RTAVPDASGPIVSARRRGRVLLTVGVVAVAAAAILGYWTIDRPGSVSSLRAGSVSVPD
                     GPTLVIAPFANLGEGPNAELYTDGVTEELLTALPRFKEIKVFGRETSKSLPPDVDVSQ
                     VRDELGARYLLAGGVRVSGSRIRVTARLVDASDGAILWSEDYDNDLQSRDLFAIQSDV
                     ASKVATAVAQPYGIIAQTDAANPPPDDLGAYSCTLSFYDYRAELSAERHAKVSACLES
                     AVARYPGYATAWAMLSIAHLDEERFKFNPKSGAPMAMERALQAARRAVQLDPGNTRGL
                     QALMTALFFNGQYAEAMRTGEQALAMNSNDTELMGELGTRVAMGGQWQRGAALLDRAI
                     ALNPGGAGYYHGTRALAAHMLGDHPAAVAGIRQADLQKFPLFHAVASVIYAEAGMLHE
                     ARRAGETFMRRRPDFVPNLQAEFMMRNLQPKDQLRLVSGLRKAGFSIPDGVEASIAAA
                     EAADAKSR"
     misc_feature    complement(320408..320866)
                     /locus_tag="SMa0601"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5616"
                     /db_xref="CDD:227903"
     misc_feature    complement(320024..320326)
                     /locus_tag="SMa0601"
                     /note="Bacterial transcriptional activator domain; Region:
                     BTAD; smart01043"
                     /db_xref="CDD:198111"
     misc_feature    complement(320015..320320)
                     /locus_tag="SMa0601"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(320033..320035,320042..320044,
                     320054..320056,320090..320092,320135..320137,
                     320144..320146,320156..320158,320228..320230,
                     320273..320275,320282..320284,320294..320296))
                     /locus_tag="SMa0601"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(320072..320077,320084..320089,
                     320096..320101,320213..320218,320225..320230,
                     320234..320239))
                     /locus_tag="SMa0601"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(319916..320104)
                     /locus_tag="SMa0601"
                     /note="TPR repeat; Region: TPR_11; pfam13414"
                     /db_xref="CDD:257739"
     misc_feature    complement(319808..320086)
                     /locus_tag="SMa0601"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(319865..319870,319877..319882,
                     319895..319900,319973..319978,319985..319990,
                     319994..319999,320084..320086))
                     /locus_tag="SMa0601"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(319826..319828,319835..319837,
                     319847..319849,319883..319885,319931..319933,
                     319940..319942,319952..319954,319988..319990,
                     320033..320035,320042..320044,320054..320056))
                     /locus_tag="SMa0601"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            322421..323233
                     /locus_tag="SMa0604"
                     /db_xref="GeneID:1235135"
     CDS             322421..323233
                     /locus_tag="SMa0604"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction match (6e-15) to most of
                     Synechococcus hypothetical protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435561.2"
                     /db_xref="GI:193782589"
                     /db_xref="GeneID:1235135"
                     /translation="MKQQNVGANLVSGTRRRAGGLAVAAMAVALSNAPSRAQSVINPD
                     ADSVLRAMTDQLQALQEFSVEYDTDHEVVQLDGEKIQYSASGRIAMSRSAGFRMTRQG
                     PYTDTEISFDGKVVSLYGKRLNVYARIDSPGPSIDEAVAEIQAATGFDAAGADFLSAD
                     PYAALAEGVLSGSLVGTAFVGGMLCDHLAFRNDDVDWELWISKGEQNLPLKYVITTKW
                     VTGSPQYTLRFRNWATGGVSSKSFEFKPPTDARKVDVVHTDVVGDLLLEAQQ"
     misc_feature    322421..323230
                     /locus_tag="SMa0604"
                     /note="Predicted periplasmic protein [Function unknown];
                     Region: COG3900"
                     /db_xref="CDD:226416"
     gene            323230..323565
                     /locus_tag="SMa0606"
                     /db_xref="GeneID:1235136"
     CDS             323230..323565
                     /locus_tag="SMa0606"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435562.1"
                     /db_xref="GI:16262769"
                     /db_xref="GeneID:1235136"
                     /translation="MSMKRTSHRYISAAAMIAALVTVDGWTARLSGHGAVFIGNAQAR
                     VGRPLTPASVAGVARRTTRRTIRRSAIYVAALPAACVKTSVSGTVLWQCGATYYQPYG
                     GRYVVVYVD"
     gene            323618..325168
                     /locus_tag="SMa0607"
                     /db_xref="GeneID:1235137"
     CDS             323618..325168
                     /locus_tag="SMa0607"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction, start codon changed based on
                     codon usage pattern."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435563.1"
                     /db_xref="GI:16262770"
                     /db_xref="GeneID:1235137"
                     /translation="MKIARKYGPIAAAFVAALAITTSYAQSPTPGYNTKIPEQILTPD
                     KVESSIGTLNFADGVPTAETAGKIYDYLDTLRGVEVFLNFMPAASLEALRMGNAEMGA
                     TKANQALIFDQLLDSNPLLLTGNTDTVYCSVFLDLETDGPTVVEVPPGTGPGTVNDAF
                     FRFVIDMGAPGPDQGKGGKYLIVPADYKGDLPKDKSEGGEYYVARSPSHVNWLILRGF
                     LVDGKPDAASKLFREGLKVYPLAKKSNPPKMEFLDGSKVAFNTVHANTFEFYKELDHV
                     IQKEPIDLFDPELRGLAAGIGIRKGRSFAPDDRMTKILTDAVGIGNATARSIAFHNRD
                     PRSPLYPNSQWRSGFVGSDYRWIDLDGVSGRNKDARTNFFYMATVNTPAMAAKLIGKG
                     SQYALITADATGNAFDGAKTYRLNVPSNPPAKDFWSVVLYDPQTRSELQTSQPFPSRN
                     SKRDKLVANADGSVDLYFGPKAPAGKDSNWIETVPGKGWFSLLRLYGPLEPWFDKTWR
                     PGEIEEVR"
     misc_feature    323768..325165
                     /locus_tag="SMa0607"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5361"
                     /db_xref="CDD:227659"
     misc_feature    323933..324331
                     /locus_tag="SMa0607"
                     /note="Protein of unknown function (DUF1254); Region:
                     DUF1254; pfam06863"
                     /db_xref="CDD:253949"
     misc_feature    324989..325120
                     /locus_tag="SMa0607"
                     /note="Protein of unknown function (DUF1214); Region:
                     DUF1214; pfam06742"
                     /db_xref="CDD:253888"
     gene            325226..325801
                     /locus_tag="SMa0609"
                     /db_xref="GeneID:1235138"
     CDS             325226..325801
                     /locus_tag="SMa0609"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435564.1"
                     /db_xref="GI:16262771"
                     /db_xref="GeneID:1235138"
                     /translation="MITKRDLLRSAAIGALVAATANSTTVIAQDKAEWPSPLEAKDIA
                     EEGFIYGLPLVMNYAVMQEFAVNRDSGQFKAPFNEINNMHQLASPEDTAIITPNSDTP
                     YSILWLDLRVEPVVVSVPAVDKERYYSVQLIDGNTYNFGYIGSRATGTEPGSYLVVGP
                     DWKARSPRASSRSSDRPPRSYSPTFGPSLST"
     misc_feature    <325226..325798
                     /locus_tag="SMa0609"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5361"
                     /db_xref="CDD:227659"
     misc_feature    325457..>325714
                     /locus_tag="SMa0609"
                     /note="Protein of unknown function (DUF1254); Region:
                     DUF1254; pfam06863"
                     /db_xref="CDD:253949"
     gene            325807..326667
                     /locus_tag="SMa0610"
                     /db_xref="GeneID:1235139"
     CDS             325807..326667
                     /locus_tag="SMa0610"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435565.1"
                     /db_xref="GI:16262772"
                     /db_xref="GeneID:1235139"
                     /translation="MPNVEKVQAGYKAQPLSAFLKQPAPTAAPEIAFVPATTAGIKDN
                     FFQYLDAALQFVPETLRDNAIRAKLAKIGIGPGKTFEFKELSLEHKAEMLISVKQGDD
                     KINKWLASGNKPINRWNVSSLLGDEVFFNGDWLRRAGAAKAGLYGNDAVEAMYPFTRT
                     DATGEPLDGSKHKYTLTFPPGQLPPVNAFWSVTMYDGKSQFLVKNPINRYLINSPMLP
                     GMKTEPDGSVTLYIQEDNPGAGKEANWLPAPDGPIYLVMRLYWPKTTPPSILPAGKGT
                     WQPPGVKRVS"
     misc_feature    <325816..326664
                     /locus_tag="SMa0610"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5361"
                     /db_xref="CDD:227659"
     misc_feature    <326215..326586
                     /locus_tag="SMa0610"
                     /note="Protein of unknown function (DUF1214); Region:
                     DUF1214; cl08447"
                     /db_xref="CDD:263661"
     gene            326972..328627
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /db_xref="GeneID:1235140"
     CDS             326972..328627
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="CcoN; FixN"
                     /codon_start=1
                     /transl_table=11
                     /product="cbb3-type cytochrome c oxidase subunit I"
                     /protein_id="NP_435566.1"
                     /db_xref="GI:16262773"
                     /db_xref="GeneID:1235140"
                     /translation="MGQLTTRERDLAAAILLVLAIVGIAMAAAGRFDPLGVHGAVVLL
                     YSLALLYLIMSSSFGPPPDPSRISRYYDDPIKAGVWFTLFWAIFGMFIGVWAAAQLAW
                     PSLNFDTAWASFGRIRPAHTTGVIFGFGGNALIATSFHVVQRTSRARLADQLSPWFVL
                     FGYNLFCILAVTGYFMGVTQSKEYAEAEWYADLWLVIVWVTYFILYIRTLARRREPHI
                     YVANWYYMAFIVVVAILHIINNLTVPVSLGHAKSYTIWSGVQDSMVQWWYGHNAVAFF
                     LTAGFLAMLYYYLPKRAERPIFSYRLSILSFWGITFFYMWAGSHHLHYTALPHWVQNL
                     GMTFSVMLLVPSWASAGNALLTLNGAWHKVRDDATLRFIMMAAFFYGLSTFEGSFLAV
                     RPVNSLSHYTDWTVGHVHAGALGWVALITYGSLYTLVPAIWKRERMYSAALVEVHFWL
                     AFAGTVIYVFAMWNSGIIQGLMWRTYTGDGTLAYSFVDSLVAMYPYYIARAFGGLLFL
                     IGAVVATYNIWMTVRGVPALAERHGDVPVAAPLPEGAATGPAE"
     misc_feature    327059..328537
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /note="Cytochrome cbb3 oxidase subunit I.  Cytochrome cbb3
                     oxidase, the terminal oxidase in the respiratory chains of
                     proteobacteria, is a multi-chain transmembrane protein
                     located in the cell membrane. Like other cytochrome
                     oxidases, it catalyzes the reduction...; Region:
                     cbb3_Oxidase_I; cd01661"
                     /db_xref="CDD:238831"
     misc_feature    order(327200..327202,328199..328201,328211..328213,
                     328343..328345,328454..328456)
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /note="Low-spin heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238831"
     misc_feature    327206..328492
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:249600"
     misc_feature    order(327740..327742,327755..327760,328157..328159,
                     328169..328174,328388..328390)
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238831"
     misc_feature    order(327779..327781,327929..327934,328193..328195)
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /note="Binuclear center (active site) [active]"
                     /db_xref="CDD:238831"
     misc_feature    order(327932..327934,328169..328174,328388..328393)
                     /gene="fixN3"
                     /locus_tag="SMa0612"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238831"
     gene            328632..329384
                     /gene="fixO3"
                     /locus_tag="SMa0615"
                     /db_xref="GeneID:1235141"
     CDS             328632..329384
                     /gene="fixO3"
                     /locus_tag="SMa0615"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="CcoO; FixO"
                     /codon_start=1
                     /transl_table=11
                     /product="cbb3-type cytochrome c oxidase subunit II"
                     /protein_id="NP_435567.1"
                     /db_xref="GI:16262774"
                     /db_xref="GeneID:1235141"
                     /translation="MRELIHRKLERTAIGFVLAIILAASVGGIVEIAPLFTIDETVED
                     VEDMRLYTPLELAGRNIYIREGCYACHSQMIRTLRDEVERYGPFSLAVESKYDHPMLW
                     GSKRTGPDLARVGGKYSDFWHVAHLTNPRDVVPESNMPAYAWLARTPLRLDDLGSHLE
                     AQRSVGVPYTDEMIENAARDAFGQAVPDSEQASGVTERYGDETQVSAFDGVATRVTEM
                     DALVAYLQVLGRLTKAAYQNTAAPEQVPDPTN"
     misc_feature    328647..329330
                     /gene="fixO3"
                     /locus_tag="SMa0615"
                     /note="Cytochrome C oxidase, mono-heme subunit/FixO;
                     Region: FixO; pfam02433"
                     /db_xref="CDD:111339"
     gene            329407..329577
                     /gene="fixQ3"
                     /locus_tag="SMa0616"
                     /db_xref="GeneID:1235142"
     CDS             329407..329577
                     /gene="fixQ3"
                     /locus_tag="SMa0616"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="glimmer prediction match (7e-7) to Azorhizobium
                     caulinodans but not to other members of FixQ family"
                     /codon_start=1
                     /transl_table=11
                     /product="FixQ3 nitrogen fixation protein"
                     /protein_id="NP_435568.1"
                     /db_xref="GI:16262775"
                     /db_xref="GeneID:1235142"
                     /translation="MEVTHETLVEAAKTWGLFYLIGFSICVIVYAFWPANRERFDRAK
                     RGILEEDDQPWT"
     misc_feature    329416..329553
                     /gene="fixQ3"
                     /locus_tag="SMa0616"
                     /note="Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3
                     oxidase, the terminal oxidase in the respiratory chains of
                     proteobacteria, is a multi-chain transmembrane protein
                     located in the cell membrane. Like other cytochrome
                     oxidases, it catalyzes the reduction of O2...; Region:
                     cbb3_Oxidase_CcoQ; cd01324"
                     /db_xref="CDD:238647"
     gene            329568..330449
                     /gene="fixP3"
                     /locus_tag="SMa0617"
                     /db_xref="GeneID:1235143"
     CDS             329568..330449
                     /gene="fixP3"
                     /locus_tag="SMa0617"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="good match to FixP proteins over entire length"
                     /codon_start=1
                     /transl_table=11
                     /product="FixP3 Diheme c-type cytochrome"
                     /protein_id="NP_435569.1"
                     /db_xref="GI:16262776"
                     /db_xref="GeneID:1235143"
                     /translation="MDVEEVDPISGRRTTGHEWNGIKELDTPVPRGVLLFLVVTHVFA
                     LLWWVLLPTWPLGTTYTKGLLGIDERNVVEEKLAAAAAARAVWEKRIDTLSYEQIRAD
                     EQLMATVRSTGHQLFGDNCAVCHGIDGKGRSNYPDLTDDDWLWGGGPEDIEQTLRVGI
                     NTRHPESRVAQMPSFGREQMLERNQVRDVAAYVYSLTNPGYSTPENIGRIEAGREVFL
                     TSCAACHGENARGSREVGAPNLTDAYWIYGGTMQTIIESVHGGRQGHMPTWDERLTSA
                     EIKILALYINSLGVEKP"
     misc_feature    329595..329744
                     /gene="fixP3"
                     /locus_tag="SMa0617"
                     /note="N-terminal domain of cytochrome oxidase-cbb3, FixP;
                     Region: FixP_N; pfam14715"
                     /db_xref="CDD:258852"
     misc_feature    329607..330434
                     /gene="fixP3"
                     /locus_tag="SMa0617"
                     /note="cytochrome c oxidase, cbb3-type, subunit III;
                     Region: ccoP; TIGR00782"
                     /db_xref="CDD:129864"
     misc_feature    329904..330155
                     /gene="fixP3"
                     /locus_tag="SMa0617"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     misc_feature    330195..330431
                     /gene="fixP3"
                     /locus_tag="SMa0617"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            330668..331474
                     /locus_tag="SMa0620"
                     /db_xref="GeneID:1235144"
     CDS             330668..331474
                     /locus_tag="SMa0620"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435570.1"
                     /db_xref="GI:16262777"
                     /db_xref="GeneID:1235144"
                     /translation="MSGTGKLQRWVGEVSGIEETWNPKWQRHLPAQAPFEWLAKGWRD
                     LITYPMLSLSYGVAVFVVSFLIIWLLFATGRDYFLFPAVAGFMIIAPLLATGLYLKSS
                     RLERSEPVSLGSMLRVRPVAGAQVFFTGLLLCMLMLLWMRAAVLVYALFFGVRPFPGL
                     GHITQLLLTTPTGWAMLAVGIFIGALFAGFSFAISVFSIPMLLDQRIDAFTAMGVSVA
                     LVWNNLRPMLVWGAIVLGMFLVSVATAMIGLVVIFPLLGHATWHAYRAVR"
     misc_feature    330668..331471
                     /locus_tag="SMa0620"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5473"
                     /db_xref="CDD:227760"
     gene            331477..333744
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /db_xref="GeneID:1235145"
     CDS             331477..333744
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /codon_start=1
                     /transl_table=11
                     /product="FixI2 E1-E2 type cation ATPase"
                     /protein_id="NP_435571.1"
                     /db_xref="GI:16262778"
                     /db_xref="GeneID:1235145"
                     /translation="MSCCSGIAVPSAGAASRTSISPEEIRLASRDLGDGLRQTAMTLP
                     DAHCAACIAAVEGALRKISGVELARVNLSARRVTINWRGNDDESPDFAAALAKIGYAS
                     HLASIEEETQDPVLASLLKALAVAGFSAMNIMILSVSVWSGADPATRHAFHLVSAALA
                     LPAIVYSGRFFYRSAWAALRHGRTNMDVPISVGVLLAFALSVYDTLHNAAFAYFDAST
                     SLLFVLLAGRTLDHLMRGRARSAVGALARLSPRGASVVQADEAIDYVPLSEIQPGMRL
                     LVAAGERVPVDGVVVKGASELDASIVSGESEWRRAAPGSALQAGVMNLANPLTLLATA
                     SVDGSFLAEMTRMMEAAESGRSTYRRIADRAASLYAPVVHGVALLSMVAWLFGTGDLH
                     KSVTIAIAVLVITCPCALGLAVPMVQVVAVRRLFERGIMARDGSAFERLNEIDTVLFD
                     KTGTLTLGEMRLVNAGDIQPRLLSLAAAMARVSRHPASVAIALADPRRPVAPVEFDSL
                     EEVHGCGIEGRAGDAVYRLGRPSWASTAKQVDLGTSSTTVLSKDAETIAVFAFEETVR
                     PGARELVQTLRSAGLSVRILSGDRSAAVSSIARQLDIEAFSAELLPGEKVEAIRALAA
                     TGRKVLMIGDGLNDAPALAAAHVSIAPSSATDVGRSASDFVFLGQSLLAVRDIIQTAA
                     RADVLIRQNFAMAIAYNVVSVPFAIGGVVTPLAAALAMSLSSIVVVGNALRQGAKVKK
                     GPRTFGATKPATAKI"
     misc_feature    331582..333696
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     misc_feature    331597..331776
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /note="Heavy-metal-associated domain (HMA) is a conserved
                     domain of approximately 30 amino acid residues found in a
                     number of proteins that transport or detoxify heavy
                     metals, for example, the CPx-type heavy metal ATPases and
                     copper chaperones. HMA domain...; Region: HMA; cd00371"
                     /db_xref="CDD:238219"
     misc_feature    order(331612..331620,331627..331629)
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /note="metal-binding site [ion binding]"
                     /db_xref="CDD:238219"
     misc_feature    332134..332796
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /note="E1-E2 ATPase; Region: E1-E2_ATPase; pfam00122"
                     /db_xref="CDD:249606"
     misc_feature    333130..333426
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /note="Haloacid dehalogenase-like hydrolases. The haloacid
                     dehalogenase-like (HAD) superfamily includes L-2-haloacid
                     dehalogenase, epoxide hydrolase, phosphoserine
                     phosphatase, phosphomannomutase, phosphoglycolate
                     phosphatase, P-type ATPase, and many others; Region:
                     HAD_like; cd01427"
                     /db_xref="CDD:119389"
     misc_feature    333235..333237
                     /gene="fixI2"
                     /locus_tag="SMa0621"
                     /note="motif II; other site"
                     /db_xref="CDD:119389"
     gene            333741..334001
                     /gene="fixS2"
                     /locus_tag="SMa0622"
                     /db_xref="GeneID:1235146"
     CDS             333741..334001
                     /gene="fixS2"
                     /locus_tag="SMa0622"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /codon_start=1
                     /transl_table=11
                     /product="FixS2 nitrogen fixation protein"
                     /protein_id="NP_435572.1"
                     /db_xref="GI:16262779"
                     /db_xref="GeneID:1235146"
                     /translation="MNYLALLVPVALAMGFVGLLAFFWSLRSGQYDDLDGAAERILLD
                     DEEDEGPLPDPVRDGTASRRQRSPKEDGESKLYSGVSNAKHG"
     misc_feature    333741..333908
                     /gene="fixS2"
                     /locus_tag="SMa0622"
                     /note="Uncharacterized protein, possibly involved in
                     nitrogen fixation [Inorganic ion transport and
                     metabolism]; Region: FixS; COG3197"
                     /db_xref="CDD:225738"
     gene            334433..334594
                     /locus_tag="SMa0625"
                     /db_xref="GeneID:1235147"
     CDS             334433..334594
                     /locus_tag="SMa0625"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435573.1"
                     /db_xref="GI:16262780"
                     /db_xref="GeneID:1235147"
                     /translation="MMARERTGLSPALALVAAFMLFLQSVVHAFAGQPSDILPFDAFG
                     NSLCVTGTP"
     gene            335117..336379
                     /locus_tag="SMa0626"
                     /db_xref="GeneID:1235148"
     CDS             335117..336379
                     /locus_tag="SMa0626"
                     /function="Structural elements; Cell envelope"
                     /note="glimmer prediction domain in amino terminus matches
                     (e-15) outer membrane proteins, domain in carboxyl
                     terminus matches (e-16) hypothetical protein from
                     Synechococcus"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435574.1"
                     /db_xref="GI:16262781"
                     /db_xref="GeneID:1235148"
                     /translation="MSNAHITIFGDSKYDLRWRKSGRNASLCEGVARKLLMAGALVAA
                     TNVPCWSQSVADPVKQYSKESMQQALQTREQYDVHGLSFDTGQSTLQPGAKPLLDDIA
                     TALKNFPDWSLRIVGHTDASGSAESNERLSLERANTIKAALVERGIDAGKLLAAGAGQ
                     SRPIASNETDEGKALNRRVELMRFTDSAEAKKLLKAMSDYLAAQKAISFAYDANLQVV
                     TNSDQKLGLASSGTVTLSRPDKVHTTRSGGFVDVESLFDGKTLTLLGKNVNKYTQVEI
                     PGTVDHLVDELKDKYGLPLPAADLLLTNAYDELIQGVYDSKDLGSGVINGAECDSLAF
                     RKDDVDFQIWVAQGAQPHPCRLVITSRLVKGGPEYSVQIRDWKSGDGVTLGDFSFKNP
                     TDAEKIDVNDLKGTLGELPENFVGGGGK"
     misc_feature    335117..335659
                     /locus_tag="SMa0626"
                     /note="Outer membrane protein and related
                     peptidoglycan-associated (lipo)proteins [Cell envelope
                     biogenesis, outer membrane]; Region: OmpA; COG2885"
                     /db_xref="CDD:225439"
     misc_feature    335357..335662
                     /locus_tag="SMa0626"
                     /note="Peptidoglycan binding domains similar to the
                     C-terminal domain of outer-membrane protein OmpA; Region:
                     OmpA_C-like; cd07185"
                     /db_xref="CDD:143586"
     misc_feature    order(335369..335374,335471..335476,335483..335485,
                     335495..335500,335507..335509,335633..335635,
                     335645..335647)
                     /locus_tag="SMa0626"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:143586"
     misc_feature    335651..336364
                     /locus_tag="SMa0626"
                     /note="Predicted periplasmic protein [Function unknown];
                     Region: COG3900"
                     /db_xref="CDD:226416"
     gene            336766..337464
                     /gene="aqpZ2"
                     /locus_tag="SMa0627"
                     /db_xref="GeneID:1235149"
     CDS             336766..337464
                     /gene="aqpZ2"
                     /locus_tag="SMa0627"
                     /function="Cell processes; Transport of small molecules"
                     /note="porin involved in osmoregulation allowing water to
                     move into and out of the cell in response to osmotic
                     pressure"
                     /codon_start=1
                     /transl_table=11
                     /product="aquaporin Z"
                     /protein_id="NP_435575.1"
                     /db_xref="GI:16262782"
                     /db_xref="GeneID:1235149"
                     /translation="MFKKLCAEFLGTCWLVLGGCGSAVLASAFPQVGIGLLGVSFAFG
                     LTVLTMAYTVGGISGGHFNPAVSLGLAVAGRVPAASLVSYVIAQVAGAIIAAAVLYVI
                     ATGKADFQLGSFAANGYGEHSPGGYSLTAALVTEVVMTFFFLIIILGSTHRRVPAGFA
                     PIAIGLALTLIHLVSIPVTNTSVNPARSTGQALFVGGWALSQLWLFWIAPLFGAAIAG
                     IVWKSVGEEFRPVD"
     misc_feature    336766..337446
                     /gene="aqpZ2"
                     /locus_tag="SMa0627"
                     /note="aquaporin Z; Provisional; Region: PRK05420"
                     /db_xref="CDD:235453"
     misc_feature    order(336892..336894,336946..336954,337303..337308,
                     337315..337317,337324..337326)
                     /gene="aqpZ2"
                     /locus_tag="SMa0627"
                     /note="amphipathic channel; other site"
                     /db_xref="CDD:238204"
     misc_feature    order(336952..336960,337315..337323)
                     /gene="aqpZ2"
                     /locus_tag="SMa0627"
                     /note="Asn-Pro-Ala signature motifs; other site"
                     /db_xref="CDD:238204"
     gene            complement(337732..338109)
                     /locus_tag="SMa0629"
                     /db_xref="GeneID:1235150"
     CDS             complement(337732..338109)
                     /locus_tag="SMa0629"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435576.1"
                     /db_xref="GI:16262783"
                     /db_xref="GeneID:1235150"
                     /translation="MNQFKIISAMDSHNFERKRASGPTKRDTLMLGREARRKTTLPLW
                     FRGFVAADRGDRPRLALGLVGARTAERLRRNARQISGAHSRPLDRRLGLAERHFVARC
                     NYAIQSNALVRNEFETRRREVLE"
     gene            complement(338133..339704)
                     /locus_tag="SMa0630"
                     /db_xref="GeneID:1235151"
     CDS             complement(338133..339704)
                     /locus_tag="SMa0630"
                     /function="Structural elements; Cell envelope"
                     /note="glimmer prediction carboxyl half of protein matches
                     (e-26) E. coli predicted membrane protein YbiO"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435577.1"
                     /db_xref="GI:16262784"
                     /db_xref="GeneID:1235151"
                     /translation="MASVGSFLAFEWPPLLRKIILTLLLAVIVFRVVRAIGKLLFALS
                     GASGIADQPPSVFESDAARRFWLSRISIIAGFLLFGWAIASLMPALSFSNEVTRLAAF
                     LFGLGILVTAVEVVWRRPDKPAPLVVKSLLTIYLVVLWSAWVAGLLGLLWLGIYSLLL
                     PPLVRGVGDVAQALATRAQRTGPPGIVLSVVIVRGARAAVIAAAVAWLAYIWRIRAAA
                     LAGSEPGAIVIPGLLNGIIALLVADLLWQMSKALIAYRMGLGPKDGSNVDELARSGRL
                     RTLLPIFRNVLAVFIGAVTVLTILSGLGVQIAPLIAGAGIFGVAIGFGSQTLVKDVLS
                     GVFYMLDDAFRVGEYIQSGSYKGTVESFSLRSVRLRHHRGPIFTVPFGELGAVQNMSR
                     DWVIDKMTLNVTYDADVDLARKLIKKVGQELAADPEFAADTIEPLKMQGVDSFGDFAI
                     VLRMKLMTKPGAQFTIKRRAFMMIKKAFDENGIKIAVPTVHVSGGSDNAAAAQQALNM
                     SKAAELAANKAPVGL"
     misc_feature    complement(338211..339026)
                     /locus_tag="SMa0630"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     misc_feature    complement(338250..338849)
                     /locus_tag="SMa0630"
                     /note="Mechanosensitive ion channel; Region: MS_channel;
                     pfam00924"
                     /db_xref="CDD:250229"
     gene            complement(339652..340218)
                     /locus_tag="SMa0631"
                     /db_xref="GeneID:1235152"
     CDS             complement(339652..340218)
                     /locus_tag="SMa0631"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435578.1"
                     /db_xref="GI:16262785"
                     /db_xref="GeneID:1235152"
                     /translation="MNSVQPIRIGFLLLAVAPILFWMLLGVSWAQQAPVGVPPEKAQQ
                     FLDLLSDPQVKTWLEGKIPSAAAEPPAGSPVETISSWEAAIRDRINGLMGAVPRIPEE
                     LARGAAVVSRDVNSGRPGLVVSILAVLIAVGLGAEWLIRRVFARARKSGANENAGQEI
                     LSEIACLADVCLGQRRFIPGIRMAALTA"
     misc_feature    complement(<339751..>340191)
                     /locus_tag="SMa0631"
                     /note="Small-conductance mechanosensitive channel [Cell
                     envelope biogenesis, outer membrane]; Region: MscS;
                     COG0668"
                     /db_xref="CDD:223740"
     gene            complement(340397..340783)
                     /locus_tag="SMa0633"
                     /db_xref="GeneID:1235153"
     CDS             complement(340397..340783)
                     /locus_tag="SMa0633"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435579.1"
                     /db_xref="GI:16262786"
                     /db_xref="GeneID:1235153"
                     /translation="MGTPVLDQVGFEMIVYVAEISGRGIAAFDAANDIEAQAQLANRG
                     LLRDLIVLQNEGRALWDGVADIHLRTATPEETEIWQTSRTAAVQSGEDSDDEGRHVFL
                     VPVVDPSHDNFDDDDNPHHDDDRDGD"
     gene            341499..342152
                     /locus_tag="SMa0636"
                     /db_xref="GeneID:1235154"
     CDS             341499..342152
                     /locus_tag="SMa0636"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction match (e-21) to several
                     hypothetical proteins from archaebacteria and eubacteria,
                     some over full length"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435580.1"
                     /db_xref="GI:16262787"
                     /db_xref="GeneID:1235154"
                     /translation="MTTKVVKLSPDDSVRQAAKLMFDHHVSGVPVVDDDGHLLGVISE
                     GDLIRRAELCSEASVLMADMAIDPDDRANAFIRRCSWRVGDVMTANPVTIEEEAPLAR
                     VAGLMQERGIKRIPVVRDGELVGIVSRADLLQAIFSTKPDETAAGDEAIRRSILVRLG
                     ENTSLEELDVTVTVTEGIVHFWGQVETAGCRRAARIMAESVHGVRGIVEHFPDPYTQ"
     misc_feature    341499..341897
                     /locus_tag="SMa0636"
                     /note="FOG: CBS domain [General function prediction only];
                     Region: COG0517"
                     /db_xref="CDD:223591"
     misc_feature    341502..341903
                     /locus_tag="SMa0636"
                     /note="This cd contains two tandem repeats of the
                     cystathionine beta-synthase (CBS pair) domains associated
                     with the BON (bacterial OsmY and nodulation domain)
                     domain. BON is a putative phospholipid-binding domain
                     found in a family of osmotic shock protection...; Region:
                     CBS_pair_BON_assoc; cd04586"
                     /db_xref="CDD:239959"
     misc_feature    341766..342125
                     /locus_tag="SMa0636"
                     /note="The CBS domain, named after human CBS, is a small
                     domain originally identified in cystathionine
                     beta-synthase and is subsequently found in a wide range of
                     different proteins. CBS domains usually occur in tandem
                     repeats. They associate to form a so-called...; Region:
                     CBS_pair; cl15354"
                     /db_xref="CDD:265675"
     gene            342592..342981
                     /locus_tag="SMa0637"
                     /db_xref="GeneID:1235155"
     CDS             342592..342981
                     /locus_tag="SMa0637"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435581.1"
                     /db_xref="GI:16262788"
                     /db_xref="GeneID:1235155"
                     /translation="MNARVSFAREPLYRSQVAGAASWGVSALEDQQLAGLIMWVPAGM
                     IYVAAALAIAAALIGGSNTSFAGESNDDAGARGGKLPCVTAAFKTARITLSVRRGSSG
                     QCQIHASCPTRVRRLSRSLRAKRHGRR"
     misc_feature    <342610..342732
                     /locus_tag="SMa0637"
                     /note="Cytochrome c oxidase caa3 assembly factor
                     (Caa3_CtaG); Region: Caa3_CtaG; cl09173"
                     /db_xref="CDD:263735"
     gene            342978..343235
                     /locus_tag="SMa0638"
                     /db_xref="GeneID:1235156"
     CDS             342978..343235
                     /locus_tag="SMa0638"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435582.1"
                     /db_xref="GI:16262789"
                     /db_xref="GeneID:1235156"
                     /translation="MTAAPVTEKSRYRSRPPSLYAPWWKSKEVITPSVIGGGASLLTV
                     IGGIPWQNLLLILVAFGAIAGFLYWRKNADRRAVARVEGMA"
     misc_feature    <343071..343175
                     /locus_tag="SMa0638"
                     /note="putative monovalent cation/H+ antiporter subunit D;
                     Reviewed; Region: PRK07234"
                     /db_xref="CDD:235978"
     gene            343640..344044
                     /locus_tag="SMa0639"
                     /db_xref="GeneID:1235157"
     CDS             343640..344044
                     /locus_tag="SMa0639"
                     /note="glimmer prediction match (3e-8) to immunoreactive
                     Brucella abortus protein in carboxyl half. Similar to
                     SMA1086 of S. meliloti pSyma"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435583.1"
                     /db_xref="GI:16262790"
                     /db_xref="GeneID:1235157"
                     /translation="MKAPTLAFAVLASAIGMSPAKAQTCIGICNGGTGGTTNHNLFIE
                     REYRDFLQQRYPNYGSRYRGMRPDISIGPGATVGGPRVGVRQQFRLRQRMVIDANKHL
                     RWCQERYLSYRLADDTFQPFEGARRPCNSPYN"
     misc_feature    343940..344029
                     /locus_tag="SMa0639"
                     /note="BA14K-like protein; Region: BA14K; pfam07886"
                     /db_xref="CDD:203793"
     gene            344135..344554
                     /locus_tag="SMa0640"
                     /db_xref="GeneID:1235158"
     CDS             344135..344554
                     /locus_tag="SMa0640"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435584.1"
                     /db_xref="GI:16262791"
                     /db_xref="GeneID:1235158"
                     /translation="MRRRRNAPATAKRSSKSHQTTRAGDCLKHRNPKRWSQLRKGGLN
                     ITSILLSSYLALPADSLLGRDLGEGERQLEFAGKFHRSPRQAPDSGRSLPPAGRQSRL
                     RISAVEKQAAEAATSMKAVRIRSTASILTHDPHPLVQ"
     gene            345407..345667
                     /locus_tag="SMa0643"
                     /db_xref="GeneID:1235159"
     CDS             345407..345667
                     /locus_tag="SMa0643"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_435585.1"
                     /db_xref="GI:16262792"
                     /db_xref="GeneID:1235159"
                     /translation="MNPGKLNNWIDDAAISGLVAIARFARVLHRDLDAVCSAIELLWS
                     NGQAEGQINPLKTIKRAMYGRAGPELLRARMLPLDQNYRHKK"
     misc_feature    <345407..345634
                     /locus_tag="SMa0643"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3464"
                     /db_xref="CDD:225995"
     misc_feature    <345422..345631
                     /locus_tag="SMa0643"
                     /note="Transposase; Region: DDE_Tnp_ISL3; pfam01610"
                     /db_xref="CDD:250743"
     gene            345684..345992
                     /locus_tag="SMa0645"
                     /db_xref="GeneID:1235160"
     CDS             345684..345992
                     /locus_tag="SMa0645"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435586.1"
                     /db_xref="GI:16262793"
                     /db_xref="GeneID:1235160"
                     /translation="MQNDIGGELVHLEDLVLDDATKNVRTPTHELTIPLGLSAAGLRS
                     LRGRDFVSGSPAASSAADGTVEVTTDPDVDRSTEGRDESNGDVSVFGAEFVAIDAVLA
                     "
     gene            346110..346361
                     /locus_tag="SMa0647"
                     /db_xref="GeneID:1235161"
     CDS             346110..346361
                     /locus_tag="SMa0647"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction matches domain (15%) of
                     hypothetical protein Y4CF from Sinorhizobium pNGR234a
                     plasmid See SMA0649"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435587.1"
                     /db_xref="GI:16262794"
                     /db_xref="GeneID:1235161"
                     /translation="MLRQAHDLPPVLQAIVALDAWNVLSVLQHAPWLGRVLAASILRQ
                     AGVTASAHLATVNLGLETMPVERRRHRDRNFRLLALPMG"
     misc_feature    346113..>346307
                     /locus_tag="SMa0647"
                     /note="Protein of unknown function (DUF1612); Region:
                     DUF1612; pfam07756"
                     /db_xref="CDD:149040"
     gene            346342..346659
                     /locus_tag="SMa0649"
                     /db_xref="GeneID:1235162"
     CDS             346342..346659
                     /locus_tag="SMa0649"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction matches domain (11%) of
                     hypothetical protein Y4CF from Sinorhizobium pNGR234a
                     plasmid. see SMA0647"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435588.2"
                     /db_xref="GI:193782590"
                     /db_xref="GeneID:1235162"
                     /translation="MRCPWADCSRRDRAEGARPAGAGKNDDGAKLKGRRTSSTLPELV
                     DLVMARPLVSASMVAKTLDVTPQAARRIVLELGLREIALVTVDDAASLVLRIVNTLQE
                     CFR"
     misc_feature    346459..>346584
                     /locus_tag="SMa0649"
                     /note="HTH DNA binding domain; Region: HTH_13; pfam11972"
                     /db_xref="CDD:152407"
     gene            complement(347249..347851)
                     /locus_tag="SMa5027"
                     /db_xref="GeneID:6435265"
     CDS             complement(347249..347851)
                     /locus_tag="SMa5027"
                     /note="Possible secreted protein"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000343.1"
                     /db_xref="GI:193782591"
                     /db_xref="GeneID:6435265"
                     /translation="MARLPSMAAAALALAASFPLICVTTTPASAQSLSAGDDGGDISA
                     SDVRDFLRDALRARSDRRDLIRDLVPERQDRRDELLDLLGDGGDLMGDRGDRLERLRD
                     LLAARRDRPDDLMELIGDRGDRRERLMDLIAARRDRRDELMDLIGDRDDQGGGRGLLR
                     QRLLERLADGNDENCVFITRSLRAENGDWLAFVRRRVCRD"
     repeat_region   complement(348201..349286)
                     /standard_name="ISRm24"
                     /note="SMa4003"
                     /rpt_family="ISRm24"
     gene            complement(348248..349249)
                     /locus_tag="SMa0656"
                     /db_xref="GeneID:1235164"
     CDS             complement(348248..349249)
                     /locus_tag="SMa0656"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /note="glimmer prediction excellent fit (e-134) to
                     transposase in IS30 of Agrobacterium rhizogenes"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm24 transposase"
                     /protein_id="NP_435590.1"
                     /db_xref="GI:16262797"
                     /db_xref="GeneID:1235164"
                     /translation="MSQCYLHLTLPDRRRVHQLLERKAPTAEIARQLGRHRSTIYREL
                     KRNTFHDAEFPEYSGYYSGIANDISKERRRRLRKLSRHPQLRELVIEQLKALWSPEQI
                     AGRLLADGVSAVRVCTETIYRFIYSKEDYALELYQHLPEGRRKRRPRRSRKPRDGSIP
                     LDCRISQRPDFIADRSQFGHWEGDLLIFRRDLGEANVTSLVERKSRYTVMIKNGSRHS
                     RPLIDKIIDAFSPLPAFARQSFTFDRGTEFRGFKALEDGLGARSWFCDPNSPWQKGAV
                     ENTNKRIRRFVPSDTDLSAVSQPQLVALAHHLNSLPRKCLGYRTPAEVFMAHLRDCG"
     misc_feature    complement(348251..349249)
                     /locus_tag="SMa0656"
                     /note="Transposase and inactivated derivatives, IS30
                     family [DNA replication, recombination, and repair];
                     Region: Tra8; COG2826"
                     /db_xref="CDD:225382"
     misc_feature    complement(349109..349240)
                     /locus_tag="SMa0656"
                     /note="Helix-turn-helix domain; Region: HTH_38; pfam13936"
                     /db_xref="CDD:258198"
     misc_feature    complement(order(349121..349129,349133..349138))
                     /locus_tag="SMa0656"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     misc_feature    complement(348875..>349000)
                     /locus_tag="SMa0656"
                     /note="Homeodomain-like domain; Region: HTH_32; pfam13565"
                     /db_xref="CDD:257882"
     misc_feature    complement(348389..348718)
                     /locus_tag="SMa0656"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            349400..349597
                     /locus_tag="SMa0657"
                     /db_xref="GeneID:1235165"
     CDS             349400..349597
                     /locus_tag="SMa0657"
                     /function="Small molecule metabolism; Energy transfer"
                     /note="glimmer prediction good match to amino terminus of
                     cytochrome c binding protein associated nitrate reductase
                     involved in denitrification.  Frameshift relation to
                     SMA0659, the carboxyl terminus"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c binding protein, amino terminus"
                     /protein_id="NP_435591.1"
                     /db_xref="GI:16262798"
                     /db_xref="GeneID:1235165"
                     /translation="MTLGGFVGGVIFWGAFNTALELTNTEEFCVSCHEMRANVYEELR
                     RTVHFSNRSGPGVLSRLPRAA"
     misc_feature    349400..>349561
                     /locus_tag="SMa0657"
                     /note="cytochrome c-type protein NapC; Provisional;
                     Region: PRK10617; cl17554"
                     /db_xref="CDD:248108"
     gene            349623..350021
                     /locus_tag="SMa0659"
                     /db_xref="GeneID:1235166"
     CDS             349623..350021
                     /locus_tag="SMa0659"
                     /function="Small molecule metabolism; Energy transfer"
                     /note="glimmer prediction good match to carboxyl terminus
                     of cytochrome c binding protein associated nitrate
                     reductase involved in denitrification.  Frameshift
                     relation to SMA0657, the amino terminus"
                     /codon_start=1
                     /transl_table=11
                     /product="cytochrome c binding protein, carboxyl terminus"
                     /protein_id="NP_435592.1"
                     /db_xref="GI:16262799"
                     /db_xref="GeneID:1235166"
                     /translation="MQASKEVWGKIFGSINTREKFLDHRLELAKHEWARLKANDSLEC
                     RNCHSSAAMDLSKQTQRAAEIHTRYLLPGKVTCIDCHKGIAHELPNMQGVEPGWKLPP
                     ELEGETLPSASATDELKKVMNDSHTVAFGN"
     misc_feature    <349623..349895
                     /locus_tag="SMa0659"
                     /note="cytochrome c-type protein NapC; Provisional;
                     Region: PRK10617; cl17554"
                     /db_xref="CDD:248108"
     gene            350388..350867
                     /locus_tag="SMa0661"
                     /db_xref="GeneID:1235167"
     CDS             350388..350867
                     /locus_tag="SMa0661"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435593.1"
                     /db_xref="GI:16262800"
                     /db_xref="GeneID:1235167"
                     /translation="MRATWAIPVAALVLLLDSSDGTAGQPGKSADQPSKYVPSVGEIM
                     NKIDLSRSKLWYSVKLRNWALAGYQLDQVKTGFDDVSRHHPDKSNFDFANVQKIANLI
                     EEAIVARSDEQFQQSFALMTTECNDCHRAVGKPFLHVGAPKVPSPYSDKMLEPGAFR"
     gene            complement(350925..351560)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /db_xref="GeneID:1235168"
     CDS             complement(350925..351560)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /function="Miscellaneous; Not classified regulator"
                     /note="transcriptional regulator that positively regulated
                     fixLJ operon; upregulated transcription by FixJ; part of
                     global network that controls expression of aerobic
                     respiratory terminal oxidases and carbon and nitrogen
                     metabolic enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator FixK"
                     /protein_id="NP_435594.1"
                     /db_xref="GI:16262801"
                     /db_xref="GeneID:1235168"
                     /translation="MNTSISASWGRYINAIPPRSGEAALAPLSSFVDGQCIYSFGERA
                     DQVYQVEFGAVRVYRLAANGRRQILAFHFGGNWFGLQSRDRHSSNAEAIGVTGVRCIS
                     LQEEPLFRPALFSAALDNVSAAQEHQLVIGRQSAIERVAAFLLEMSERSGYSRRFELS
                     MSRVDVADYLALTVETVSRSLTKLKHRGFIELHGARGIELVGYRALQNLCL"
     misc_feature    complement(350928..351560)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="transcriptional regulator FixK; Provisional;
                     Region: fixK; PRK09391"
                     /db_xref="CDD:236494"
     misc_feature    complement(351249..351494)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    complement(order(351297..351305,351321..351326))
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    complement(350961..351155)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="helix_turn_helix, cAMP Regulatory protein
                     C-terminus; DNA binding domain of prokaryotic regulatory
                     proteins belonging to the catabolite activator protein
                     family; Region: HTH_CRP; cd00092"
                     /db_xref="CDD:238044"
     misc_feature    complement(351141..351146)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(351042..351044,351069..351077,
                     351081..351083))
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(351024..351044)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    complement(order(351024..351026,351036..351041))
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    complement(351036..351041)
                     /gene="fixK"
                     /locus_tag="SMa0662"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            complement(351675..351944)
                     /locus_tag="SMa0663"
                     /db_xref="GeneID:1235169"
     CDS             complement(351675..351944)
                     /locus_tag="SMa0663"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435595.1"
                     /db_xref="GI:16262802"
                     /db_xref="GeneID:1235169"
                     /translation="MNGEPDWKHCMAAALRRFPARSLQIRELSMRDEDFRGMCEDFAA
                     AENALAAVDQLPLHIREERRAEFKGLIESLAAEIAIALGPADGSI"
     gene            352085..353842
                     /locus_tag="SMa0664"
                     /db_xref="GeneID:1235170"
     CDS             352085..353842
                     /locus_tag="SMa0664"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction match (e-10) to cya3 adenyl
                     cyclase (CAB38103) over final two thirds (400 bp) but does
                     not capture hits to the original adenyl cyclases used for
                     cya3 assignment"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435596.1"
                     /db_xref="GI:16262803"
                     /db_xref="GeneID:1235170"
                     /translation="MTIAGRGSVRAGSPTALPTNTEILVQLDRIRLSAEFDVPDRARK
                     FLAYIVGEAIAGRADRIKAYSIATEVFGRDSSFDAQTDPVVRIEAGRIRRALERYYFV
                     AGSNDPIVIKIPKGGYAPAFEKRGGAPYQLSSGQAANVQSRSMSLEQTALWVSVATVG
                     LLTCGLLANAFFGSAATTIESLTKPGGTRPNIPKLMVMPFEDLSQTPQSAMITRGLTD
                     EVISNIAKFKEIVVVAGPAAPNPHSAEREYPAFALEGRVRLDGDKLRLGIRLVQHSDG
                     SVVWANTYDEVLQPRKIIELQQNAAAAVASAIAQPYGIVFQANATHFMRSVPDDWQAY
                     ACTLAYYGYRGDLNPQTHASVQECLQHATTQFPDYATAWALLSLTYVDELRFRYRLNR
                     STTVSLSHAIEAAARAVELDPQNVRALQAEMLTLFFRGEVNAALTVGARAYAINPNDT
                     ELSGEYGFRLALSGQWRSGCDLVSKTVASNPGPVGYFEAALAVCCYIEHDYVAAERWA
                     RSADLHANPVYHVILLAILGKLGKMDLARAEREWLEINVPGFLENARNEVALRIHRPE
                     DQKHFIEGLRQAGVPIPGK"
     misc_feature    352589..353026
                     /locus_tag="SMa0664"
                     /note="Predicted integral membrane protein [Function
                     unknown]; Region: COG5616"
                     /db_xref="CDD:227903"
     misc_feature    353153..353428
                     /locus_tag="SMa0664"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    order(353159..353161,353168..353170,353213..353215,
                     353285..353287,353297..353299,353306..353308,
                     353351..353353,353387..353389,353399..353401,
                     353408..353410)
                     /locus_tag="SMa0664"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     misc_feature    order(353204..353209,353213..353218,353225..353230,
                     353342..353347,353354..353359,353366..353371)
                     /locus_tag="SMa0664"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     gene            complement(353876..355030)
                     /locus_tag="SMa0665"
                     /db_xref="GeneID:1235171"
     CDS             complement(353876..355030)
                     /locus_tag="SMa0665"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction match (e-26) to E. coli
                     hypothetical membrane protein over 75% 0f length"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435597.2"
                     /db_xref="GI:193782592"
                     /db_xref="GeneID:1235171"
                     /translation="MDDNPSSQRNPDPVNPAARPSIEPRITEIARIGLVGLFAYWSFT
                     LIAPFAIILIWAAILAVALYPAYAALSAILGQRPRVAALVITMLGLLVIVAPLAAIAF
                     SFAEGLQVVLARLNDRSLLISAPPDSIRSFPLIGERIYSVWSMASDNLEAVLQQIKPA
                     LLQAGSKALGKIASIGADLLSFVVSVLVAGFLFGSGARLANSAQGFASRMGGDRGVGF
                     LQLAAATIRNVARGVIGVALLQAFLCILILSLFKVPAPGAIAFVVLILCIIQIGPALA
                     LLPVIVWAWTSMEFGMAALFTILLIPLLIIDNVMKPILVARGLSTPTLVILLGVLGGT
                     LSYGLIGLFLGPIVLSVFHSLLLIWMNTDTVGSEGLRLGNPDYRIRREKT"
     misc_feature    complement(353948..354907)
                     /locus_tag="SMa0665"
                     /note="Domain of unknown function DUF20; Region: UPF0118;
                     cl00465"
                     /db_xref="CDD:260441"
     gene            355528..356016
                     /locus_tag="SMa0667"
                     /db_xref="GeneID:1235172"
     CDS             355528..356016
                     /locus_tag="SMa0667"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435598.1"
                     /db_xref="GI:16262805"
                     /db_xref="GeneID:1235172"
                     /translation="MEDSLHPAAVAHLPPFITAPGQTDVLFNVMIVFVLLMVFVVGIL
                     YLRLHALPEHMAHGASKVQLQIVGVLALIALFTHNHLFWIAALLLAMVEFPNFSSPVE
                     SIARSLAKMADRHDGTDEPGTSAQPAAMPPRANESHASPPQWVPLEIEPVAGDNKAER
                     RG"
     gene            356020..357249
                     /locus_tag="SMa0669"
                     /db_xref="GeneID:1235173"
     CDS             356020..357249
                     /locus_tag="SMa0669"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction. match (e-10 to e-14) to three
                     hypothetical E. coli proteins over 70% of sequence. ProDom
                     match (aa62-aa232) to multidrug carrier transmembrane
                     family"
                     /codon_start=1
                     /transl_table=11
                     /product="hemolysin D"
                     /protein_id="NP_435599.1"
                     /db_xref="GI:16262806"
                     /db_xref="GeneID:1235173"
                     /translation="MLEFLICSLLTIFPDYLVRRYVQGKRVGREINLYSMWFELRYGI
                     TACLILTISLITMIFYFHPSTSNVTAVFRTVTIMPESTGRVAEVYVDLNEKVSAGAPL
                     FRLDDSEQRAALETARRRVAEIEAEAIVAQSELASADGLIAQAEGDYLQALNELETQV
                     ELNQRNPNIVARREIERLQVAVDGRDGARAASISNKRTLETKIASLLPAQKASAEAAL
                     TQAQVELDKTIVRAGTAGVVQQFALRAGDIVNPMIRSAGILVPEQRRIGLIAGFGQIE
                     AQVMKAGMIAEATCIGKPFTIIPMVVTEVQDVIAAGQIRPTDQLVDAQQLASPGTLTA
                     YLEPLYEGQFSGVPPGSSCIANAYTSNHDALHAPGISTPHWLFLHVVDAVGLVHAMIL
                     RLQALLLPVQTLVFKGH"
     misc_feature    356092..357141
                     /locus_tag="SMa0669"
                     /note="Multidrug resistance efflux pump [Defense
                     mechanisms]; Region: EmrA; COG1566"
                     /db_xref="CDD:224482"
     misc_feature    356236..356385
                     /locus_tag="SMa0669"
                     /note="Biotin-lipoyl like; Region: Biotin_lipoyl_2;
                     pfam13533"
                     /db_xref="CDD:257852"
     gene            357359..358213
                     /locus_tag="SMa0670"
                     /db_xref="GeneID:1235174"
     CDS             357359..358213
                     /locus_tag="SMa0670"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction match (e-76) to predicted
                     regulatory proteins from several sources ProDom finds
                     domain (e-74) but doesn't call function (8/2000)"
                     /codon_start=1
                     /transl_table=11
                     /product="regulatory protein"
                     /protein_id="NP_435600.1"
                     /db_xref="GI:16262807"
                     /db_xref="GeneID:1235174"
                     /translation="MDKHTDDRKKNNHWKAEDRKSAATEASETRSGGNYAKELARLQE
                     EIAHLQAWVKKTGARIVIVFEGRDAAGKGGVIKRITERVSPRVFRVVALPAPTDREKT
                     QIYMQRYIQQFPAAGEVVIFDRSWYNRPGVERVMGFCSEKKAKRFLEIAPRFEAAMIE
                     SGIVLLKYFLDVSEEEQDRRFRQRINDPLRQWKLSPMDVESYRRWWDYTRAYDEMIRM
                     TDTDDAPWWIVPSDNKKQARVNCIAHILSSIPYERVKFEDPDLGKRQKRPADFEGDTR
                     RRTVPNLF"
     misc_feature    357449..358129
                     /locus_tag="SMa0670"
                     /note="polyphosphate kinase 2, PA0141 family; Region:
                     PPK2_P_aer; TIGR03707"
                     /db_xref="CDD:213852"
     repeat_region   358752..360049
                     /standard_name="ISRm3"
                     /note="SMa3006; predicted by homology"
                     /rpt_family="ISRm3"
     gene            358810..360012
                     /locus_tag="SMa0673"
                     /db_xref="GeneID:1235175"
     CDS             358810..360012
                     /locus_tag="SMa0673"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm3 transposase"
                     /protein_id="NP_435601.1"
                     /db_xref="GI:16262808"
                     /db_xref="GeneID:1235175"
                     /translation="MAIEKELLDQLLAGRDPSEVFGKDGLLDDLKKALSERILNAELD
                     DHLDVERLEGGPANRRNGSSKKTVLTGTSKMTLTIPRDRAGTFDPKLIARYQRRFPDF
                     DDKIISMYARGMTVREIQGHLEELYGIDVSPDLISAVTDTVLEAVGEWQNRPLELCYP
                     LVFFDAIRVKIRDEGFVRNKAVYVALAVLADGSKEILGLWIEQTEGAKFWLRVMNELK
                     NRGCQDILIAVVDGLKGFPEAITAVFPQTIVQTCIVHLIRHSLEFVSYKDRRTVVPAL
                     RAIYRARDAEAGLKALEAFEEGYWGQKYPAIAQSWRRNWEHVVPFFAFPEGVRRIIYT
                     TNAIEALNSKLRRAVRSRGHFPGDEAAMKLLYLVLNNAAEQWKRAPREWVEAKTQFAV
                     IFGERFFN"
     misc_feature    358816..359946
                     /locus_tag="SMa0673"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; pfam00872"
                     /db_xref="CDD:250193"
     misc_feature    358879..359997
                     /locus_tag="SMa0673"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(360005..360349)
                     /locus_tag="SMa0674"
                     /db_xref="GeneID:1235176"
     CDS             complement(360005..360349)
                     /locus_tag="SMa0674"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435602.1"
                     /db_xref="GI:16262809"
                     /db_xref="GeneID:1235176"
                     /translation="MSEKVPGNGGSKHLFYGVLNPVDRSNEVLFGLIMVMTFTNSLST
                     TDAGRADVRSMLVGAVGCNLAWGIIDAVMYFMSSMAERKLSERTVHRVRTADDVKAGT
                     VRNSVRWAGFIS"
     gene            complement(360346..361491)
                     /locus_tag="SMa0675"
                     /db_xref="GeneID:1235177"
     CDS             complement(360346..361491)
                     /locus_tag="SMa0675"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction. ProDom aa47-390 Family
                     #PD005505  PROTEIN EXCHANGER AFFINITY CALCIUM 6e-38
                     Matches to diverse organisms including bacterial, yeasts
                     and plants over entire protein. Manganese resistance"
                     /codon_start=1
                     /transl_table=11
                     /product="Ca2+/H+ antiporter"
                     /protein_id="NP_435603.2"
                     /db_xref="GI:193782593"
                     /db_xref="GeneID:1235177"
                     /translation="MRTFEVKGSTKQSRSAIETVLRELRRSPLLALIFFVPVVILLER
                     MAPKAHTLLFFVAIAAIVPLAALLSRATESVAAKTGDAVGGLLNATLGNLTELIITLA
                     ALQAGQYLLVKASIAGAIVTNSLFMFGGAFLIGGLKHHLQEFNRVNARFQAILLFLAT
                     IAILVPSLTSGLDRTPAAEFSQQLSLGLAILLIVVYGLGMVFSLKTHKELFASVGQAE
                     AGEEPWPLSIGIVVLIVVTLLVAMVSEIFVGSVQAAAQHLGLTPAFVGFIVIALVGGA
                     AEMTTAFSAARANRLDLSVGIALGSAAQIALFVAPVLVLVSYFIGPQPMSLEFWPGAV
                     AMMLVATMAATLLSNGGHAAWYAGVMALAVYAIFALTLFLLPPGVTQ"
     misc_feature    complement(360364..361449)
                     /locus_tag="SMa0675"
                     /note="Ca2+/H+ antiporter [Inorganic ion transport and
                     metabolism]; Region: ChaA; COG0387"
                     /db_xref="CDD:223464"
     misc_feature    complement(360883..361317)
                     /locus_tag="SMa0675"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     misc_feature    complement(360376..360771)
                     /locus_tag="SMa0675"
                     /note="Sodium/calcium exchanger protein; Region: Na_Ca_ex;
                     pfam01699"
                     /db_xref="CDD:250805"
     gene            complement(361696..362637)
                     /locus_tag="SMa0677"
                     /db_xref="GeneID:1235178"
     CDS             complement(361696..362637)
                     /locus_tag="SMa0677"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction Met12 has good SD sequence match
                     (e-16) to  ABC glutamate/aspartate transporter protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435604.2"
                     /db_xref="GI:193782594"
                     /db_xref="GeneID:1235178"
                     /translation="MQAAPGKGRQSGRRIVRFGLTLGAVTVSMWASAEAQTLDRIRSS
                     STVKLGYDATARPFSFKAEGESATGYAVSLCMEVVEELKRELGIADLAVEWIELTREA
                     ADHAIRQGSADLFCGASPVTLTRRKEVSFSIAIFPSGTGAVLNASAPLALREVLTQGR
                     PSDRPIWRGSPARTVLNQKTFSPIAGTTSEDWLAERIKTFQLSATIAAVENYDQGIAN
                     ILNGESDVLFGDLPLLLDAAARGENSGDLIVLKRHFTYEPLALVLARNDEDFRIVVDR
                     ALSRTYRSEDFPAFFSEWFGPPDDTIVTFFRQTTLPE"
     misc_feature    complement(361717..362601)
                     /locus_tag="SMa0677"
                     /note="ABC-type amino acid transport/signal transduction
                     systems, periplasmic component/domain [Amino acid
                     transport and metabolism / Signal transduction
                     mechanisms]; Region: HisJ; COG0834"
                     /db_xref="CDD:223904"
     misc_feature    complement(361753..362499)
                     /locus_tag="SMa0677"
                     /note="Bacterial periplasmic transport systems use
                     membrane-bound complexes and substrate-bound,
                     membrane-associated, periplasmic binding proteins (PBPs)
                     to transport a wide variety of  substrates, such as, amino
                     acids, peptides, sugars, vitamins and inorganic...;
                     Region: PBPb; cd00134"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(361948..361950,362074..362076,
                     362263..362265,362338..362340,362473..362475))
                     /locus_tag="SMa0677"
                     /note="substrate binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:238078"
     misc_feature    complement(order(361969..361971,361987..361989,
                     361999..362001))
                     /locus_tag="SMa0677"
                     /note="membrane-bound complex binding site; other site"
                     /db_xref="CDD:238078"
     misc_feature    complement(361852..361869)
                     /locus_tag="SMa0677"
                     /note="hinge residues; other site"
                     /db_xref="CDD:238078"
     gene            complement(362667..364025)
                     /gene="potE"
                     /locus_tag="SMa0678"
                     /db_xref="GeneID:1235179"
     CDS             complement(362667..364025)
                     /gene="potE"
                     /locus_tag="SMa0678"
                     /function="Cell processes; Transport of small molecules"
                     /note="catalyzes the uptake of putrescine via a proton
                     symport mechanism, as well as the efflux of putrescine by
                     a putrescine/ornithine antiport system"
                     /codon_start=1
                     /transl_table=11
                     /product="putrescine transporter"
                     /protein_id="NP_435605.1"
                     /db_xref="GI:16262812"
                     /db_xref="GeneID:1235179"
                     /translation="MTEHSLNVAMEAASKKKMNLVQLTFIVAVNMMGSGIIMLPANMA
                     QVGAISLLSWLVTAVGSMAIAYGFAQAGLFNQRPGGMSAYAEDAYGKPGYFLVFLLYF
                     LSLAVGNVAIGISAVGYLAGFFPWLTSTPIATCVSLIILLWLTTVANFGGPRVTGRIG
                     SITVWGVILPVGLLCIIGWAWFSSEVFAAAWNPNGLTLVQGMGSSISLTLWAFLGMES
                     AAQNSDAVENPKRDVPLACLFGTLGAAIIYILSTTVIQGIVPNAELAASTGPFALAFA
                     TMFNPAIGSVVMALAVLACVGSLLGWQFTIAQTARAAADERMFPSLFSRVNEMGAPVT
                     GMIVMGVVQSLLALMTISPTLNEQFAALVNLAVVTNVLPYIISLSALFVMMRAAGVSE
                     SKFRLNSSIAIVGMLYSVFAIYASGKDAVLGGMLVTGIAFIIYGLIAPRFTPRPGIVR
                     TA"
     misc_feature    complement(362685..363995)
                     /gene="potE"
                     /locus_tag="SMa0678"
                     /note="putrescine transporter; Provisional; Region: potE;
                     PRK10655"
                     /db_xref="CDD:182622"
     misc_feature    complement(<363123..363956)
                     /gene="potE"
                     /locus_tag="SMa0678"
                     /note="Tryptophan/tyrosine permease family; Region:
                     Trp_Tyr_perm; cl17316"
                     /db_xref="CDD:266625"
     gene            complement(364053..366401)
                     /locus_tag="SMa0680"
                     /db_xref="GeneID:1235180"
     CDS             complement(364053..366401)
                     /locus_tag="SMa0680"
                     /EC_number="4.1.1.17"
                     /EC_number="4.1.1.19"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction, start codon changed based on
                     homology"
                     /codon_start=1
                     /transl_table=11
                     /product="amino acid (ornithine, lysine, arginine)
                     decarboxylase"
                     /protein_id="NP_435606.1"
                     /db_xref="GI:16262813"
                     /db_xref="GeneID:1235180"
                     /translation="MKAPTVPIPFHKLLKVVAFVDESNLETKRLLAHIVAENFEVELR
                     GSYNADVSEDASVGAYIGTVEGGRLEDARKFVRAVRDIGFRTPLWALADSHGIADIAA
                     IKMAGEVDGFVYLGQQTPAFYAKQIISSLVNYGKTLLPPFFGGLMAYDGEANIAFDCP
                     GHQGGQFYRKSPAGQLFFNYFGESIFRADLCNADVDLGDLLIHEGPAAEAQKNAARIF
                     GADRTYFILNGTSTSNKVVTNAVLRAGDLVLFDRNNHKSLHQGALVQAGAIPVYLPTS
                     RNSFGMIGAVDWDAWDEASLRRQIERHPLVEDKARASAERPFRLACIQLATYDGTIYN
                     VRKVLEQIGHLCDYVLWDEAWIGYNAFHPLFEDHSPMRIDTLDAEMPGLFSTQSVHKQ
                     GAGFSQASQIHKRDEHIRDQRRYVEHKRFNESLLMHVSTSPFYPLFASLDVNAKIHEG
                     KAGEMLWDRCIELGIEARKKLREFTRYYESSGAGPQEQWFFDPFVPDVVTISGSKHTE
                     DVVESRWEALPTEVIKREQQCWRFRPGASWHGYSGYSDGYAMVDPNKLTLLTPGIDRA
                     TGEYRDFGIPATMVANYLREQRIVPEKCDLNSILFLLTPAEDESKLNTLIAKLVKFKN
                     LWDRDAPLAEVLPTVFAANRERYAGYTLRQVCAEMHDFYRQAGVKELQRLCFRAESMP
                     EPAMTPKAAYEALVANEVDYVALDEAFGRISATLALIYPPGIGVIVPGERWDERARPM
                     HNYFLAFQESFNRFPGFNYEVQGVFQERVDGQIKFYTYAVRE"
     misc_feature    complement(366000..366335)
                     /locus_tag="SMa0680"
                     /note="Orn/Lys/Arg decarboxylase, N-terminal domain;
                     Region: OKR_DC_1_N; pfam03709"
                     /db_xref="CDD:252113"
     misc_feature    complement(364056..366233)
                     /locus_tag="SMa0680"
                     /note="ornithine decarboxylase; Provisional; Region:
                     PRK13578"
                     /db_xref="CDD:237434"
     misc_feature    complement(364569..365984)
                     /locus_tag="SMa0680"
                     /note="Orn/Lys/Arg decarboxylase, major domain; Region:
                     OKR_DC_1; pfam01276"
                     /db_xref="CDD:250498"
     misc_feature    complement(order(365229..365231,365238..365240,
                     365337..365339,365346..365348,365430..365432,
                     365700..365702,365709..365714))
                     /locus_tag="SMa0680"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(365229..365231)
                     /locus_tag="SMa0680"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     misc_feature    complement(364089..364496)
                     /locus_tag="SMa0680"
                     /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Region: OKR_DC_1_C; pfam03711"
                     /db_xref="CDD:112521"
     gene            complement(366403..368673)
                     /locus_tag="SMa0682"
                     /db_xref="GeneID:1235181"
     CDS             complement(366403..368673)
                     /locus_tag="SMa0682"
                     /EC_number="4.1.1.17"
                     /EC_number="4.1.1.19"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction Excellent match (e-147) to
                     various basic amino acid decarboxylases (lysine, arginine,
                     ornithine) over entire length.  May be in operon with
                     adjacent genes"
                     /codon_start=1
                     /transl_table=11
                     /product="decarboxylase (lysine, ornithine, arginine)"
                     /protein_id="NP_435607.4"
                     /db_xref="GI:193782595"
                     /db_xref="GeneID:1235181"
                     /translation="MEFYKAFPIAVIDEDYEGKSAAGRGMRSLAEAIEKEGYRVVAGL
                     TYEDARRLVNVFNTESCWLISVDGTESSTTRWEILAELLAAKRSRNNLLPIFLFGDDT
                     TAEMVPAPVLRHANAFMRLFEDSPEFMARAIVRAAQNYLERLPPPMFKALMEYTLHGA
                     YSWHTPGHGGGVAFRKSPVGQLFYTFFGENTLRSDISVSVGSVGSLLDHVGPIGEGER
                     NAARIFGADETLFVVGGTSTANKIVWQGMVTRNDLVLCDRNCHKSILHSLIMTGATPI
                     YLTPSRNGLGIIGPIAKEQFTPEAIAHKIVASPFASETNGKVRLMVVTNSTYDGLCYN
                     VDGIKSALGDAVEVLHFDEAWFAYANFHEFYDGYHAISSTKPARSQEAITFATQSTHK
                     LLAAFSQASMLHVQHAVAKQLDITRFNEAFMMHTSTSPQYGIIASCDVAAAMMEQPAG
                     RALVQETIDEAMSFRRAVNAVRTQMQDSWWFEVWEPPIADRAPSDATSDWLLKPGDAW
                     HGFEDLAENHVMVDPIKVTILSPGLNAGGAMLEHGIPAAVVTKFLSSRRIEIEKTGLY
                     SFLVLFSMGITRGKWSTLITELLNFKDLYDANAPLSRALPALAAAHPDVYRAMGLRDL
                     CEKIHDVYRSDGVPNAQREMYTVLPEMALRPADAYNRLVKGCVESVDIDELIGRTLAV
                     MIVPYPPGIPLIMPGERITAATRSIQDYLVYARSFDRKFPGFETDIHGLRFVANPSGR
                     RYLVDCIVEEGQDDTA"
     misc_feature    complement(368254..368613)
                     /locus_tag="SMa0682"
                     /note="Orn/Lys/Arg decarboxylase, N-terminal domain;
                     Region: OKR_DC_1_N; pfam03709"
                     /db_xref="CDD:252113"
     misc_feature    complement(366427..368265)
                     /locus_tag="SMa0682"
                     /note="Arginine/lysine/ornithine decarboxylases [Amino
                     acid transport and metabolism]; Region: LdcC; COG1982"
                     /db_xref="CDD:224893"
     misc_feature    complement(366934..368238)
                     /locus_tag="SMa0682"
                     /note="Orn/Lys/Arg decarboxylase, major domain; Region:
                     OKR_DC_1; pfam01276"
                     /db_xref="CDD:250498"
     misc_feature    complement(order(367498..367500,367507..367509,
                     367609..367611,367618..367620,367702..367704,
                     367954..367956,367963..367968))
                     /locus_tag="SMa0682"
                     /note="pyridoxal 5'-phosphate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:99742"
     misc_feature    complement(367498..367500)
                     /locus_tag="SMa0682"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:99742"
     misc_feature    complement(366457..366834)
                     /locus_tag="SMa0682"
                     /note="Orn/Lys/Arg decarboxylase, C-terminal domain;
                     Region: OKR_DC_1_C; pfam03711"
                     /db_xref="CDD:112521"
     gene            complement(368879..369805)
                     /locus_tag="SMa0683"
                     /db_xref="GeneID:1235182"
     CDS             complement(368879..369805)
                     /locus_tag="SMa0683"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction ProDom match (e=0.003) to zinc
                     transport family"
                     /codon_start=1
                     /transl_table=11
                     /product="Cation efflux protein"
                     /protein_id="NP_435608.2"
                     /db_xref="GI:193782596"
                     /db_xref="GeneID:1235182"
                     /translation="MCNEQTFLRASIAATVVVAAFGIILGLLSGSFSITFDGVYSLAD
                     AGMTVLALWVSRLIAVSATGDALSARMRDRFTMGFWHLEPIVLLLNGTLLMAIAVYAL
                     INALTSVLKGGHQLQFGFAIAYAAVTVFVCAMMAVIGARANRGLRSNFIALDVKAWIM
                     SGGIASALLVAFIIGHAVQETALHWMTLYVDPVVLAFVCIVIIPLPIGTVKSALADIL
                     LITPNELRARVERIADETVRKQGFLSYRAYVARVGRAKQIELHFIVPSNFPPQPVESW
                     DQIRDEIGIAIGDEGHNRWLTVAFTADERWAE"
     misc_feature    complement(368882..369805)
                     /locus_tag="SMa0683"
                     /note="Predicted Co/Zn/Cd cation transporters [Inorganic
                     ion transport and metabolism]; Region: COG3965"
                     /db_xref="CDD:226474"
     gene            complement(369951..371276)
                     /locus_tag="SMa0684"
                     /db_xref="GeneID:1235183"
     CDS             complement(369951..371276)
                     /locus_tag="SMa0684"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction matches (e-53) ABC transport
                     family that includes putrescine/ornithine antiport,
                     lysine/cadaverine transport"
                     /codon_start=1
                     /transl_table=11
                     /product="transport protein"
                     /protein_id="NP_435609.1"
                     /db_xref="GI:16262816"
                     /db_xref="GeneID:1235183"
                     /translation="MSAPSSGKSLGLAACTAIVVGNMVGSGFYLSPAAVAPYGNLAIV
                     IWIVMGAGAICLGLTFARLAKLSPAVGGPYAYTRLAYGDFPGFLIAWGYWISIWASLP
                     VIAVAFAGVVIDFFPFLRGRGTATLLTLSVIWLVVLVNLRGVHAAGLFSEITTYAKMI
                     PFGAVALLGLFYIDFSHFADFNPSGQPLLQASAALAPLTMFAYLGLESATVPAGDVRD
                     AERTIPRSTVLGIAIAVTLYVLGTIVVMGLVPREELVHSVAPFSEAARRMWGPAGELA
                     ISLAVVLSSIGALNGWTLLMGQVPMAAARDGLFPPLFSRLSARHVPATGIVVSATLAT
                     ILVLVQAAGSEGFSSIYRLFVGLSTMTAVIPYAFCALASSLVSARVSGGTLIPRVTLI
                     ELVGFTFAIFTLYGCGAEPVLYGLVLLLLSIPVYIWQRRRSFVPGDFGQ"
     misc_feature    complement(370047..371276)
                     /locus_tag="SMa0684"
                     /note="arginine:agmatin antiporter; Provisional; Region:
                     PRK10644"
                     /db_xref="CDD:182613"
     gene            complement(371790..372296)
                     /locus_tag="SMa0687"
                     /db_xref="GeneID:1235184"
     CDS             complement(371790..372296)
                     /locus_tag="SMa0687"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435610.2"
                     /db_xref="GI:193782597"
                     /db_xref="GeneID:1235184"
                     /translation="MNVTSKTRIVAATAVSLLCSGTMVQAQDMKKYGTAAGWDIVVRG
                     DMGPGCLIAKKLGNDMQIQMGIDETTGRRGYMALYTKLAANVGSGEKRAVIFDVDGQK
                     FSGEATGQQLEGFDGAYVWVNNPDFIYDLAKMKTLTITPDGRKPFALSLAGTDAAMQA
                     MRACQEAN"
     gene            complement(372485..373435)
                     /locus_tag="SMa0689"
                     /db_xref="GeneID:1235185"
     CDS             complement(372485..373435)
                     /locus_tag="SMa0689"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435611.1"
                     /db_xref="GI:16262818"
                     /db_xref="GeneID:1235185"
                     /translation="MIKLLHTLLVGSAASLAPLLGAIDAALAQAEGPASVYDYAAAEE
                     PPVFDDPAKAVEAFKSVLAANDFDDLARLLGLNAAKLKAGEGSMETFGLIREGAARNI
                     VVRDLDGRKIIVIGDRLWPLPFPIVKDEAGKWAFDTYVGLEEIVNRRVGENELEAIET
                     ARAYVEAQRDYVSQDRDADGVLEYAQKLISSPGQTDGLYWPSDQGDGESPVGDAISEA
                     ALEKARTGEGYFGYRFRILTSQGDNIAGGKYDYTINGNMIAGFALVSWPVAYAETGVK
                     TFVINQQGIVYERDLGPSTEEIVPFIDRFDPDEKWSVVTD"
     misc_feature    complement(372494..373303)
                     /locus_tag="SMa0689"
                     /note="Protein of unknown function (DUF2950); Region:
                     DUF2950; pfam11453"
                     /db_xref="CDD:256464"
     gene            complement(373456..374856)
                     /locus_tag="SMa0690"
                     /db_xref="GeneID:1235186"
     CDS             complement(373456..374856)
                     /locus_tag="SMa0690"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction amino terminus match (e-13) to
                     amino terminal domain of larger predicted membrane protein
                     of E. coli"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435612.1"
                     /db_xref="GI:16262819"
                     /db_xref="GeneID:1235186"
                     /translation="MMRGMTLALAGAMTLMLSMQVNGSLAQEPTKAATGTVASTPEPL
                     TDDELEVLVARIALYPDELVALISAVSLYPLQIVEAERFLENHKKKPDLKPKESWDGS
                     VISLLNYPDVVKMMSDDLEWTQALGQAVAYQQKDVLIAIQQLRDEAVAKDIIKSDDKM
                     TVVQEGDNIIIQSANPETIYVPQYPPEMLYEPDYAPVPIDYYDTPYPSYYYPGAAFFA
                     GAVTGAVFGAIVDWDDWGVWGGDWGGDIDVDCDNCFNNVDIDGKVKWNDIDWKNVDRS
                     KLKFDRDQLQKLDRTNLKNNIKANGDNNIRNRATEINRDRLKSGPGGGASQLKDVRKS
                     TLEGLKAQPRRDAAARPTAKPGGGQAVAKAKSSGAKAGVNRPKGKKSSANRPAGKKKM
                     ASKAQNRPKKPSGLGNVNSGRREVSASRRGGHSMGGGQRGGGRPQMSRGGGRPPMGGG
                     GRGGGRGGGGRGGGRR"
     misc_feature    complement(374044..374727)
                     /locus_tag="SMa0690"
                     /note="Protein of unknown function (DUF3300); Region:
                     DUF3300; pfam11737"
                     /db_xref="CDD:256584"
     gene            375708..376937
                     /gene="arcA1"
                     /locus_tag="SMa0693"
                     /db_xref="GeneID:1235187"
     CDS             375708..376937
                     /gene="arcA1"
                     /locus_tag="SMa0693"
                     /EC_number="3.5.3.6"
                     /function="Small molecule metabolism; Degradation; amino
                     acids"
                     /note="catalyzes the degradation of arginine to citruline
                     and ammonia"
                     /codon_start=1
                     /transl_table=11
                     /product="arginine deiminase"
                     /protein_id="NP_435613.1"
                     /db_xref="GI:16262820"
                     /db_xref="GeneID:1235187"
                     /translation="MRTVGVHSEVGKLRTVMVCRPSLAHQRLTPGNCHDLLFDDVIWV
                     HEAQKDHYDFVLKMEERGVEVLELHDLLSDTLIDAEARKFVLDRRVAPNVMGSQIAEL
                     MRPWMEEMDSRRLAAFLIGGISIADLPEGQGKALMASAFHSTQFVLPPIPNTLFQRDP
                     SCWIYNGVTCNPMFWPARRAETLIQRAVYKFHPSFKGAAFDIWWGDSDEQFANATMEG
                     GDVMPIGDGILLVGMGERTTYQAVGQVAKALFKAGAATRVIGCLMPKSRAAMHLDTVF
                     TFCDRDVVTLFADVVDQIRCYSLFPLDDEGNFEVRQEDRPMLEVVAEALGVDKLRTIA
                     TGGNTYEAEREQWDDGNNVVALEPGVVVAYDRNTYTNTLLRKAGIEVITIRGSELGRG
                     RGGGHCMTCPIWREPTD"
     misc_feature    375708..376928
                     /gene="arcA1"
                     /locus_tag="SMa0693"
                     /note="arginine deiminase; Provisional; Region: PRK01388"
                     /db_xref="CDD:234949"
     gene            376973..377977
                     /gene="arcB"
                     /locus_tag="SMa0695"
                     /db_xref="GeneID:1235188"
     CDS             376973..377977
                     /gene="arcB"
                     /locus_tag="SMa0695"
                     /EC_number="2.1.3.3"
                     /function="Small molecule metabolism; Degradation; amino
                     acids"
                     /note="catalyzes the formation of ornithine and
                     carbamylphosphate from citrulline in the arginine
                     catabolic pathway"
                     /codon_start=1
                     /transl_table=11
                     /product="ornithine carbamoyltransferase"
                     /protein_id="NP_435614.1"
                     /db_xref="GI:16262821"
                     /db_xref="GeneID:1235188"
                     /translation="MSFNLRNRSLLTVQDYTPREFRYLVDLARDLKRAKYARTEQEHL
                     KGKEICLIFEKTSTRTRCAFEVACSDQGANVTYLDPAGSQIGHKESFKDTARVLGRMY
                     DAIEYRGASQAGVETLAKYAGVPVYNGLTDEYHPTQMIADVMTMREHSDKPISEIKYA
                     YIGDTRSNMGHSLLIVGCLMGMDVRICGPRSLWPSEEYQTIAKRLKAQSGARLMITDN
                     PREAVEGVDFIHTDVWVSMGEPKEVWKERIQLLTPYQVNAELMAASGNPQTKFMHCLP
                     AYHDTETTIGKQISDDYGMSDGLEVTDEVFESQANIAFEQAENRMHTIKALLVATLGD
                     "
     misc_feature    376973..377974
                     /gene="arcB"
                     /locus_tag="SMa0695"
                     /note="ornithine carbamoyltransferase; Validated; Region:
                     PRK02102"
                     /db_xref="CDD:179366"
     misc_feature    376994..377419
                     /gene="arcB"
                     /locus_tag="SMa0695"
                     /note="Aspartate/ornithine carbamoyltransferase,
                     carbamoyl-P binding domain; Region: OTCace_N; pfam02729"
                     /db_xref="CDD:251498"
     misc_feature    377441..377965
                     /gene="arcB"
                     /locus_tag="SMa0695"
                     /note="Aspartate/ornithine carbamoyltransferase, Asp/Orn
                     binding domain; Region: OTCace; pfam00185"
                     /db_xref="CDD:249663"
     gene            377980..378954
                     /gene="arcC"
                     /locus_tag="SMa0697"
                     /db_xref="GeneID:1235189"
     CDS             377980..378954
                     /gene="arcC"
                     /locus_tag="SMa0697"
                     /EC_number="2.7.2.2"
                     /function="Small molecule metabolism; Nucleotide
                     biosynthesis; pyrimidine ribonucleotide biosynthesis"
                     /note="reversible synthesis of carbamate and ATP from
                     carbamoyl phosphate and ADP"
                     /codon_start=1
                     /transl_table=11
                     /product="carbamate kinase"
                     /protein_id="NP_435615.1"
                     /db_xref="GI:16262822"
                     /db_xref="GeneID:1235189"
                     /translation="MRVVIALGGNALLKRGEPMTAEVQRQNIKIAAEAIAPIAAEHQI
                     VVTHGNGPQVGLLALQGSAYKPEEAYPLDILGAETEGMIGYMLEQELGNVLPFEVPLA
                     TILTMVEVDGNDPGFQNPTKFVGPVYDASEAGELHQQKGWVFKQDGNKWRRVVASPIP
                     RRIFELRPIQWLLDKGAVVICAGGGGIPTMYERGKERTLIGVEAVIDKDLCSALLARD
                     IEADLLILATDAEAVFTGWGTPERKAIFKTNPRRLGEFSFPAGSMGPKVEAACHFVNA
                     TGRVAAIGALADIPAMVRAERGTIISSSFSDITWHVEVPIPGPASRPV"
     misc_feature    377983..378885
                     /gene="arcC"
                     /locus_tag="SMa0697"
                     /note="AAK_CK: Carbamate kinase (CK) catalyzes both the
                     ATP-phosphorylation of carbamate and carbamoyl phosphate
                     (CP) utilization with the production of ATP from ADP and
                     CP. Both CK (this CD) and nonhomologous CP synthetase
                     synthesize carbamoyl phosphate, an...; Region: AAK_CK;
                     cd04235"
                     /db_xref="CDD:239768"
     misc_feature    order(377995..377997,378001..378006,378124..378132,
                     378343..378345,378598..378606)
                     /gene="arcC"
                     /locus_tag="SMa0697"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:239768"
     misc_feature    order(378004..378006,378661..378666,378679..378681,
                     378688..378690,378751..378753,378763..378768,
                     378775..378777)
                     /gene="arcC"
                     /locus_tag="SMa0697"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239768"
     misc_feature    order(378004..378006,378661..378666,378679..378681,
                     378688..378690,378751..378753,378763..378768,
                     378775..378777)
                     /gene="arcC"
                     /locus_tag="SMa0697"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:239768"
     misc_feature    order(378154..378156,378187..378189,378196..378201,
                     378208..378210,378220..378225,378232..378234,
                     378241..378246,378256..378258,378286..378294,
                     378298..378300,378472..378474,378481..378483,
                     378574..378576,378580..378582)
                     /gene="arcC"
                     /locus_tag="SMa0697"
                     /note="homodimer interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:239768"
     gene            379173..379643
                     /locus_tag="SMa0699"
                     /db_xref="GeneID:1235190"
     CDS             379173..379643
                     /locus_tag="SMa0699"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435616.1"
                     /db_xref="GI:16262823"
                     /db_xref="GeneID:1235190"
                     /translation="MAEKQHIDLEAAPASAKDLRMQLLQRQMEEMEKERQFKAVQEQK
                     LTDFAGVFLEEHVTPEEVAVVRRLVANAVRDGKFEAMVYSFPSNLCTDSGRAINSADR
                     DWPQTLQGKAKEFYERYQKFGKPQGFKLKAMIVNFPGGMPGDVGFFLNWAPDDA"
     gene            380049..380483
                     /locus_tag="SMa0702"
                     /db_xref="GeneID:1235191"
     CDS             380049..380483
                     /locus_tag="SMa0702"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction ProDom match (e=0.001) to
                     transmembrane ion channel family"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435617.1"
                     /db_xref="GI:16262824"
                     /db_xref="GeneID:1235191"
                     /translation="MEAWVLFRLAIACGLIAATVAVQASFMSAGLGVFRRLEEDRRDF
                     LLRYPTVTTVIWIVYLIVPIALDVVLWATFYYLSRALPDFEDALYFSTVTFTTVGYGD
                     IVLGRDWRQVATFEAVNGWIIFGWATALMMAVIQRLHFRGND"
     misc_feature    380238..380441
                     /locus_tag="SMa0702"
                     /note="Ion channel; Region: Ion_trans_2; pfam07885"
                     /db_xref="CDD:254488"
     gene            complement(380966..381907)
                     /gene="dgoK2"
                     /locus_tag="SMa0705"
                     /db_xref="GeneID:1235192"
     CDS             complement(380966..381907)
                     /gene="dgoK2"
                     /locus_tag="SMa0705"
                     /EC_number="2.7.1.58"
                     /function="Small molecule metabolism; Degradation"
                     /codon_start=1
                     /transl_table=11
                     /product="DgoK2 2-dehydro-3-deoxygalactonokinase"
                     /protein_id="NP_435618.2"
                     /db_xref="GI:193782598"
                     /db_xref="GeneID:1235192"
                     /translation="MSNSAFEPVTVVLDWGTTGFRAFLVRSDGSLVDQKEGERGIQSI
                     AKGEHGRVVSEALASWRAGYGPLDIVAAGMIGSRNGWIEMPYVPTPASAADVAAAART
                     EGLPEGNRITFLPGLTDPTGFPFPDVMRGEEAQLVGFGLDRDIIVVLPGTHAKWAEIR
                     GGHIERFRTFVTGEIYATLADHSFLSKVATAERDHAADAFAEGVALAQEESTRAGGLL
                     TRLFAVRTGWLAGAIAPDEMKSRLSGLIIGWEFVEARTGGWFKEGDTIAVVGDDDLVE
                     VYGRVAENFGVKLAPAPADAAIRGALTIWRRHRLAAK"
     misc_feature    complement(380969..381889)
                     /gene="dgoK2"
                     /locus_tag="SMa0705"
                     /note="2-keto-3-deoxy-galactonokinase [Carbohydrate
                     transport and metabolism]; Region: DgoK; COG3734"
                     /db_xref="CDD:226257"
     gene            381959..382921
                     /locus_tag="SMa0707"
                     /db_xref="GeneID:1235193"
     CDS             381959..382921
                     /locus_tag="SMa0707"
                     /function="Small molecule metabolism; Amino acid
                     biosynthesis"
                     /note="glimmer prediction match (e-8) to
                     dihydrodipicolinate synthases but family is large with
                     good hits in the range e-57 to proteins from near
                     relatives. match in amino half"
                     /codon_start=1
                     /transl_table=11
                     /product="dihydrodipicolinate synthase"
                     /protein_id="NP_435619.1"
                     /db_xref="GI:16262826"
                     /db_xref="GeneID:1235193"
                     /translation="MVHNIEIKSHNMDRLMRLTGILPVLPTPFTETGVDLDAMRRIVR
                     FALDAGVAGVVFPGFASEVEALTGEERQALLKVVATEVGDRVPIVAGASAPTVDEVVA
                     YGRQALGLGITRLMIQPPKSIGAGAGAVTAFLAAAAAQLPEVEIILQNAPAPRGSDLA
                     PEAVLEVVRRVAAVRYVKEETLPAGPAITAILANAPEHMLGVIGGGGARYILDEYDRG
                     ACAAMPALEIADLHAALDRSYRDGRGSEARALYVKSLPLLVLQAVYRMRLTKHVLGLR
                     GVLDNPIVRAPTPDLDALAVRDIERCFQECGLGSVGADKWRRTK"
     misc_feature    382019..382861
                     /locus_tag="SMa0707"
                     /note="Dihydrodipicolinate synthase family; Region:
                     DHDPS-like; cd00408"
                     /db_xref="CDD:188630"
     misc_feature    order(382028..382030,382121..382123,382130..382138,
                     382403..382405,382490..382492)
                     /locus_tag="SMa0707"
                     /note="inhibitor site; inhibition site"
                     /db_xref="CDD:188630"
     misc_feature    order(382121..382123,382130..382138,382403..382405,
                     382490..382492,382625..382627)
                     /locus_tag="SMa0707"
                     /note="active site"
                     /db_xref="CDD:188630"
     misc_feature    order(382133..382135,382148..382153,382244..382249,
                     382319..382324,382343..382345,382355..382357,
                     382814..382819)
                     /locus_tag="SMa0707"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:188630"
     misc_feature    382490..382492
                     /locus_tag="SMa0707"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:188630"
     gene            382918..384087
                     /locus_tag="SMa0708"
                     /db_xref="GeneID:1235194"
     CDS             382918..384087
                     /locus_tag="SMa0708"
                     /note="glimmer prediction match (e-22) to isomerases,
                     ProDom e-14. DgoA galactonate dehydratase domain homology
                     in E.coli (P31458) but cannot trace assignment Trimmed to
                     met19 of glimmer prediction to get good SD sequence and
                     decrease overlap with SMA0707"
                     /codon_start=1
                     /transl_table=11
                     /product="enolase"
                     /protein_id="NP_435620.1"
                     /db_xref="GI:16262827"
                     /db_xref="GeneID:1235194"
                     /translation="MSDRVKKIESFTLTLPRETPYLGKPRPGEEPNGRGYLVRKANRT
                     VYPTFDRSVLVRIETENGAVGWGETYGLVAPRATMEIIDDLLADFTIGRDPFDAAAIH
                     DDLYDLMRVRGYTGGFYVDALAAIDIALWDLAGKLAGLPVCKLLGGQRRDRIAAYISG
                     LPEDTRAKRAELAAAWQAKGFSSFKFASPVADDGVAKEMEILRERLGPAVRIACDMHW
                     AHTASEAVALIKAMEPHGLWFAEAPVRTEDIDGLARVAASVSTAIAVGEEWRTVHDMV
                     PRVARRALAIVQPEMGHKGITQFMRIGAYAHVHHIKVIPHATIGAGIFLAASLQASAA
                     LANVDCHEFQHSIFEPNRRLLVGDMDCLNGEYVVPTGPGLGVEPSKEAQGLLKKH"
     misc_feature    383029..384048
                     /locus_tag="SMa0708"
                     /note="Mandelate racemase (MR)-like subfamily of the
                     enolase superfamily. Enzymes of this subgroup share three
                     conserved carboxylate ligands for the essential divalent
                     metal ion (usually Mg2+), two aspartates and a glutamate,
                     and conserved catalytic residues; Region: MR_like;
                     cd03316"
                     /db_xref="CDD:239432"
     misc_feature    383056..384081
                     /locus_tag="SMa0708"
                     /note="L-alanine-DL-glutamate epimerase and related
                     enzymes of enolase superfamily [Cell envelope biogenesis,
                     outer membrane / General function prediction only];
                     Region: COG4948"
                     /db_xref="CDD:227284"
     misc_feature    order(383470..383472,383476..383478,383560..383562,
                     383638..383640,383716..383718,383785..383787,
                     383863..383865,383941..383943)
                     /locus_tag="SMa0708"
                     /note="active site pocket [active]"
                     /db_xref="CDD:239432"
     gene            384120..385385
                     /locus_tag="SMa0709"
                     /db_xref="GeneID:1235195"
     CDS             384120..385385
                     /locus_tag="SMa0709"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction moved to met41 of glimmer
                     prediction to align with match, decrease overlap with
                     SMA0707 and get good SD sequence"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435621.1"
                     /db_xref="GI:16262828"
                     /db_xref="GeneID:1235195"
                     /translation="MKTIGKYAVAATVTAMLACTASAVPASAEVLKFVSWQKDEKGIG
                     DWWGSVIKEWEAKHPGNTIEWTKVERSAYSDTMTTLFAGGTPPDIVHLASFEFQTFAN
                     NGWLEDLGPWVEKTGLDLDGWSGQDICKFQDTTVCIMMLYYGTIFGYNEEMLKQAGVD
                     VPTNYEEFLAAARATTKDLNGDGIVDQFGTGHETKGGGGQYIAEIASYLFDAGARFTS
                     AEGEVTIDTPEMVEGLTRWKTVVKENLTPRDLSAGEVRKLFADGKIALKVDGPWIYSI
                     MQQGAAKDKLKLASVPFDPPLGGSSNILAMPSEISEEKKQLVWDFIAIATSDKFQTSF
                     ATLAASTPPSPRADLTEAKAQIPHFHLMAQSQKAAAEHKIDRIPIGLEIQFNEFSKMI
                     QEEAQRMIIEDLDPAAVAKTMHEKAEALQ"
     misc_feature    384120..385379
                     /locus_tag="SMa0709"
                     /note="ABC-type sugar transport system, periplasmic
                     component [Carbohydrate transport and metabolism]; Region:
                     UgpB; COG1653"
                     /db_xref="CDD:224567"
     misc_feature    384249..385112
                     /locus_tag="SMa0709"
                     /note="Bacterial extracellular solute-binding protein;
                     Region: SBP_bac_1; pfam01547"
                     /db_xref="CDD:250698"
     gene            385360..386373
                     /locus_tag="SMa0710"
                     /db_xref="GeneID:1235196"
     CDS             385360..386373
                     /locus_tag="SMa0710"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction match (e-40) to ThuF, a
                     trehalose/maltose transport protein in S. meliloti"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435622.2"
                     /db_xref="GI:193782599"
                     /db_xref="GeneID:1235196"
                     /translation="MRRPRRFNRRLPPSAHKGKPGAPYVASGPRKKQEAIMSLRFLDL
                     ARPSRQHWLGYLLLLPAVALVALIIVYPLFVSLDLSFQKIGMATLSAPRKPFTLENYH
                     KLFASPDFWNSCWVTIKLVVVVSAACFAVGLGTALLVNNRFKGRTLARLFVALPWAVP
                     EVIAVVIFAWIFDSSFGLMNWLFIKLGITSQMINWFSEPTAAFWVVAITMIWKGYPFV
                     SIMTLAGLQSIPEDFYNAAKVDGANAFQRFWYITIPVLMPVLGVTSVLVVLWVFRDFS
                     IIKVLTDGGPLKATQTLSIMTYDQAFGFFNMGYASAIGIVTLVLCVVASLLMLGRKSQ
                     AMY"
     misc_feature    385702..386325
                     /locus_tag="SMa0710"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(385747..385752,385759..385764,385774..385776,
                     385804..385815,385819..385848,385855..385860,
                     385864..385866,385990..385995,385999..386001,
                     386008..386010,386017..386022,386026..386028,
                     386038..386043,386050..386052,386101..386103,
                     386143..386148,386155..386157,386176..386187,
                     386194..386199,386242..386247,386275..386280,
                     386287..386292,386296..386301,386308..386313,
                     386320..386325)
                     /locus_tag="SMa0710"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(385822..385866,386176..386193)
                     /locus_tag="SMa0710"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(385864..385866,385975..385977,386194..386196,
                     386236..386238,386245..386247,386275..386277)
                     /locus_tag="SMa0710"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(386053..386091,386107..386112,386122..386124)
                     /locus_tag="SMa0710"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            386385..387215
                     /locus_tag="SMa0711"
                     /db_xref="GeneID:1235197"
     CDS             386385..387215
                     /locus_tag="SMa0711"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction match (e-47) to several
                     transporter proteins over entire length"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435623.1"
                     /db_xref="GI:16262830"
                     /db_xref="GeneID:1235197"
                     /translation="MQRTTLQTLSLYAGLAVVCGVLLFPIYWLFVTALSTLAEIRQLP
                     PSFWPAEPQWSTFAKVGTERPIFLWLWNSTLAALGSVALSMVVSVFAGYSLSRFSVKG
                     GRSLGLFILTAKMLPATLLVIPLFGIFRSMGLIGSLWSLVLAHATLIIPFTTWMLKGY
                     FDTIPRELEQAAMVDGCSPLGALFRVVLPVATPGLAATALYAFVLSWADYAYARTFLT
                     NAQGSWTANLGITTMKGEYVTDWNEISAAAVFIALPIILIYLFLERYLVGGLTAGAEK
                     "
     misc_feature    386391..387212
                     /locus_tag="SMa0711"
                     /note="ABC-type sugar transport system, permease component
                     [Carbohydrate transport and metabolism]; Region: UgpE;
                     COG0395"
                     /db_xref="CDD:223472"
     misc_feature    386592..387152
                     /locus_tag="SMa0711"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(386640..386645,386652..386657,386670..386672,
                     386700..386711,386715..386744,386751..386756,
                     386760..386762,386823..386828,386832..386834,
                     386838..386840,386847..386852,386856..386858,
                     386868..386873,386880..386882,386931..386933,
                     386973..386978,386985..386987,387006..387017,
                     387027..387032,387069..387074,387102..387107,
                     387114..387119,387123..387128,387135..387140,
                     387147..387152)
                     /locus_tag="SMa0711"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(386718..386762,387006..387023)
                     /locus_tag="SMa0711"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(386760..386762,386808..386810,387027..387029,
                     387063..387065,387072..387074,387102..387104)
                     /locus_tag="SMa0711"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(386883..386921,386937..386942,386952..386954)
                     /locus_tag="SMa0711"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            387217..387810
                     /locus_tag="SMa0713"
                     /db_xref="GeneID:1235198"
     CDS             387217..387810
                     /locus_tag="SMa0713"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction  Homology abruptly stops at LPTS
                     (109920) sequence BUT alternate reading frame (ASNL>MTMA)
                     gives e-15 hits to same class of proteins as SMA0713. ABC
                     transport ATP binding protein hits (e-57) to amino
                     terminus of matches"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435624.1"
                     /db_xref="GI:16262831"
                     /db_xref="GeneID:1235198"
                     /translation="MAGISIQNVYKDYGALNVLKEFSLEIADGEFVVLVGPSGCGKST
                     MLKILAGLEPASGGKIMIGDRDVTDLAPGDRDIAMVFQNYALYPHLTVGQNMGFGLKM
                     RGMPKAEIDRRVRAAAKILAVDHLLDRRPKALSGGQRQRVALGRAIVREPRAFLMDEP
                     LPTSTPSCASIRAPRSARFTSASASRRSMSRTIRSRR"
     misc_feature    387226..>387699
                     /locus_tag="SMa0713"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    387301..387756
                     /locus_tag="SMa0713"
                     /note="ATPases associated with a variety of cellular
                     activities; Region: AAA; smart00382"
                     /db_xref="CDD:214640"
     misc_feature    387322..387345
                     /locus_tag="SMa0713"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(387331..387336,387340..387348,387460..387462,
                     387688..387693)
                     /locus_tag="SMa0713"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    387451..387462
                     /locus_tag="SMa0713"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    387616..387645
                     /locus_tag="SMa0713"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    387676..387693
                     /locus_tag="SMa0713"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     gene            387807..388304
                     /locus_tag="SMa0714"
                     /db_xref="GeneID:1235199"
     CDS             387807..388304
                     /locus_tag="SMa0714"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction,  Homology of SMA0713 abruptly
                     stops at LPTS (109920) sequence BUT alternate reading
                     frame (ASNL>MTMA) gives e-15 hits to same class of
                     proteins as SMA0713 and SMA0714. ABC transport ATP binding
                     protein hits (e-22) to carboxyl terminus of matches"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435625.1"
                     /db_xref="GI:16262832"
                     /db_xref="GeneID:1235199"
                     /translation="MTMADRVVIMRDGAIQQIADPDTLFAKPENLFVAGFIGSPGMNF
                     LRARIEAGKLTLFGQTFNAAVGVGAGEIIVGIRPEHLALGPGDVTFTVKPTLVESLGS
                     EKYVYFEPGEHAYRADARDEERGKGLIARIAHAGPIREGEELVLSFNASEVHLFDAKT
                     EKAVN"
     misc_feature    <387807..388283
                     /locus_tag="SMa0714"
                     /note="ABC-type sugar transport systems, ATPase components
                     [Carbohydrate transport and metabolism]; Region: MalK;
                     COG3839"
                     /db_xref="CDD:226359"
     misc_feature    <387807..387920
                     /locus_tag="SMa0714"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    388026..388274
                     /locus_tag="SMa0714"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            388306..389286
                     /locus_tag="SMa0715"
                     /db_xref="GeneID:1235200"
     CDS             388306..389286
                     /locus_tag="SMa0715"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction match (e-23) to several
                     UDP-glucose 4-epimerase over entire length"
                     /codon_start=1
                     /transl_table=11
                     /product="Nucleoside-diphosphate-sugar epimerase"
                     /protein_id="NP_435626.1"
                     /db_xref="GI:16262833"
                     /db_xref="GeneID:1235200"
                     /translation="MKVLVTGSAGRVGAFVVRRLIAGGHQVRGFDLRSAGIEDGGFDE
                     VIGAFDDREAAIRACEGTDAVLHLGAFMSWLASDRDKLFRANVEGTRIVLEAAAAAKV
                     GRFVFASSGEVYPENKPEFQPITEDHPKKPLSPYGLTKLLGEELVTFQGRVSSMETVI
                     LRFSHTQNASELLDPESFFSGPRFFLRPKIEQQENFGNKAAADLLRAADPGRPALVLT
                     RNEEGRPFRMHITDTRDMAQGVLLALTHQKAAGGIFNLGATEPVDFAQILPVMAQMTG
                     LPLLTVDLPGAGVWYHTSNQRIRETLGFEPDWPIMRMLDEAVAEWTIRQA"
     misc_feature    388306..389283
                     /locus_tag="SMa0715"
                     /note="Nucleoside-diphosphate-sugar epimerases [Cell
                     envelope biogenesis, outer membrane / Carbohydrate
                     transport and metabolism]; Region: WcaG; COG0451"
                     /db_xref="CDD:223528"
     misc_feature    388309..389271
                     /locus_tag="SMa0715"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     misc_feature    order(388324..388326,388330..388335,388339..388341,
                     388396..388404,388507..388515,388627..388635,
                     388711..388713,388723..388725,388792..388803)
                     /locus_tag="SMa0715"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:187535"
     misc_feature    order(388561..388563,388633..388635,388711..388713,
                     388723..388725)
                     /locus_tag="SMa0715"
                     /note="active site"
                     /db_xref="CDD:187535"
     gene            389265..390974
                     /locus_tag="SMa0717"
                     /db_xref="GeneID:1235201"
     CDS             389265..390974
                     /locus_tag="SMa0717"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction carboxyl half match (e-42) to
                     calcium binding regulatory protein regucalcin from Xenopus
                     amino half match (e-18) to bacterial transcription
                     regulatory protein ProDom domain family #PD002768"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435627.1"
                     /db_xref="GI:16262834"
                     /db_xref="GeneID:1235201"
                     /translation="MDDKAGLGGLEDRGAPAGAAALAKGLALLDLIAEAPKPLRFADL
                     QKMSGVPKPTLARMLKTLMVFRLIRQDETTGAYLLGHRFVELSHRVWDKFDLVSAAIP
                     ELDRLASELGETVALCRLDGQRVVYLEERSSGGLGVLIEVGRRVPVHCTAAGKVLLAF
                     QEPSFARSLAGQITYDRFTPNTITDSQALEADLVLTRARGYAVSYEEHLAGVNSVAAP
                     IAGRDGVPLGALVVLGPASRLDSSAIHPAGRELMAAARRITGTVGAVAISSGPRPRTR
                     SGGFSDVQCVLPWGAQLGEAPVWVEREKRLYWVDILHPAVHRFDPVTGKNESCNVAKL
                     VSAVLPTRNEGLIVASQDGVEHFDFDRGDFNPFAEPEPGLPENRLNDAKVDPSGRLWV
                     GSMRLDVSRPTGSLYRLTSAGEVTRAGSGFTVANGLAWSPDSSTFYFVDTVPGIIYAY
                     DFDAREGSIANRRVFVTVPEAEGRPDGLAVDADGGVWCAIWDGWRVNRYRPDGRLDRA
                     VELPVPRPTSVAFGGDELATLFITSARTRLPASTLTEAPLSGGIFACNPGARGLPTSL
                     FGV"
     misc_feature    389346..389588
                     /locus_tag="SMa0717"
                     /note="IclR helix-turn-helix domain; Region: HTH_IclR;
                     cl17605"
                     /db_xref="CDD:248159"
     misc_feature    389358..390056
                     /locus_tag="SMa0717"
                     /note="Transcriptional regulator [Transcription]; Region:
                     IclR; COG1414"
                     /db_xref="CDD:224332"
     misc_feature    389676..390047
                     /locus_tag="SMa0717"
                     /note="Bacterial transcriptional regulator; Region: IclR;
                     pfam01614"
                     /db_xref="CDD:250746"
     misc_feature    390141..390869
                     /locus_tag="SMa0717"
                     /note="SMP-30/Gluconolaconase/LRE-like region; Region:
                     SGL; pfam08450"
                     /db_xref="CDD:254808"
     gene            391032..391751
                     /locus_tag="SMa0719"
                     /db_xref="GeneID:1235202"
     CDS             391032..391751
                     /locus_tag="SMa0719"
                     /note="glimmer prediction match (e-25) to full length of
                     proteins assigned as gluconate dehydrogenase,
                     3-oxoacyl-acyl carrier protein reductase,
                     3-ketoacyl-ACP/CoA reductase, acetoacetyl-CoA reductase,
                     2-hydroxycyclohexanecarboxyl-CoA dehydrogenase, NodG-type
                     reductase"
                     /codon_start=1
                     /transl_table=11
                     /product="short-chain alcohol dehydrogenase"
                     /protein_id="NP_435628.1"
                     /db_xref="GI:16262835"
                     /db_xref="GeneID:1235202"
                     /translation="MTGSSRGIGASIAQAYAAYGARVVLHGQRPGATAEIEKAIRAAG
                     GDAVSIHRELSPPSAGRDLIAAAEGAAGPLDILVINASAQINGALHDVTPEDFATQID
                     VNLRSTVEMLQAALPAMAERGWGRVVNIGSINQLRPKSIVSIYAATKAAQHNLIQSLA
                     RDYASRGVLLNTLAPGLIDTDRNAARRDGDPEAWSNYVRTLNWIGRAGRPDEMVGAAL
                     FLASDACSFMTGEAVVLSGGF"
     misc_feature    391035..391745
                     /locus_tag="SMa0719"
                     /note="3-ketoacyl-(acyl-carrier-protein) reductase;
                     Validated; Region: fabG; PRK05653"
                     /db_xref="CDD:235546"
     misc_feature    391035..391736
                     /locus_tag="SMa0719"
                     /note="classical (c) SDRs; Region: SDR_c; cd05233"
                     /db_xref="CDD:212491"
     misc_feature    order(391038..391040,391044..391055,391110..391118,
                     391185..391193,391269..391277,391338..391340,
                     391419..391427,391464..391466,391476..391478,
                     391554..391565,391569..391574)
                     /locus_tag="SMa0719"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:212491"
     misc_feature    order(391341..391343,391425..391427,391464..391466,
                     391476..391478)
                     /locus_tag="SMa0719"
                     /note="active site"
                     /db_xref="CDD:212491"
     gene            391850..392461
                     /locus_tag="SMa0722"
                     /db_xref="GeneID:1235203"
     CDS             391850..392461
                     /locus_tag="SMa0722"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction match (e-4) to hypothetical
                     Agrobacterium tumefaciens protein"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="NP_435629.1"
                     /db_xref="GI:16262836"
                     /db_xref="GeneID:1235203"
                     /translation="MRFDRWNTAFCDMDFQILSLSYRTHRVTAGTQEPRSNELRSRSV
                     EVISGEDRFRIDADAIRSASWMKRIAGIVGRADAQAPRPGRITFRVRNHGWTEESPLS
                     FMHERVGGWSYVIATDGQCVEMLEDDYQQLPIGLVGRHRRCRYDPASKNRLVAACLEP
                     FASAARLALEHRVNANLLCKRIKKRAEPASRPVLITGDYPSSV"
     misc_feature    391991..392323
                     /locus_tag="SMa0722"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    392270..392443
                     /locus_tag="SMa0722"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            392499..393287
                     /locus_tag="SMa0723"
                     /db_xref="GeneID:1235204"
     CDS             392499..393287
                     /locus_tag="SMa0723"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction carboxyl half match (e-3) to two
                     hypothetical proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435630.1"
                     /db_xref="GI:16262837"
                     /db_xref="GeneID:1235204"
                     /translation="MAAADLAGTCDGVRGSALEKSCAFSSPTTVSASLPNGVMLECGH
                     VDALMAVIGALGVHFALAMLTLGGGASRPKKKQLSVITGPLTVGASAAMLCRRKDSAK
                     LDVPSHYFTGELLVKPRISVLTLGVADLERSLAFYRDGLGLHTPGIVGREFEHGAVAF
                     FDLSNGVKLAIWDQDDLAHDSGLTKAPASSTSFSIGHNVSQRSEVDEVMEQAREAGAA
                     IVKPAQETFYGGYAGYFTDPDGHLWEIVWNPGNLAERTDLSPLP"
     misc_feature    392862..393242
                     /locus_tag="SMa0723"
                     /note="This conserved domain belongs to a superfamily
                     including the bleomycin resistance protein, glyoxalase I,
                     and type I ring-cleaving dioxygenases; Region:
                     Glo_EDI_BRP_like_10; cd07251"
                     /db_xref="CDD:211351"
     gene            393877..394269
                     /locus_tag="SMa0726"
                     /db_xref="GeneID:1235206"
     CDS             393877..394269
                     /locus_tag="SMa0726"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435632.2"
                     /db_xref="GI:193782600"
                     /db_xref="GeneID:1235206"
                     /translation="MGSRARPYLPPDFTDSSVVPIGEDGKAIGFLTYDCGRESWDITL
                     SYVDPEHRRKHIHTALFNALRDKAKEQGNVVSITCVTHATRRKPHSWPEQQTVTNGHW
                     VRLSPRRLRLGHQAPEANRTHFMLGTSR"
     misc_feature    393943..394092
                     /locus_tag="SMa0726"
                     /note="N-Acyltransferase superfamily: Various enzymes that
                     characteristically catalyze the transfer of an acyl group
                     to a substrate; Region: NAT_SF; cd04301"
                     /db_xref="CDD:173926"
     misc_feature    order(394009..394017,394045..394050)
                     /locus_tag="SMa0726"
                     /note="Coenzyme A binding pocket [chemical binding]; other
                     site"
                     /db_xref="CDD:173926"
     gene            394691..394891
                     /locus_tag="SMa0728"
                     /db_xref="GeneID:1235207"
     CDS             394691..394891
                     /locus_tag="SMa0728"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435633.1"
                     /db_xref="GI:16262840"
                     /db_xref="GeneID:1235207"
                     /translation="MQVKQWFGFVPDFIITLDAEYCRACGAPVFTIRGHNVEEFVGVV
                     RRYGANAAGVRAIVDAAPARQR"
     gene            395232..395579
                     /locus_tag="SMa0731"
                     /db_xref="GeneID:1235208"
     CDS             395232..395579
                     /locus_tag="SMa0731"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435634.1"
                     /db_xref="GI:16262841"
                     /db_xref="GeneID:1235208"
                     /translation="MAKAKLSDEVKTYIVQALACFDSPSVVAAAVKKEFGVDVSRQLV
                     QSHEPNKKAESGRAPPQNHAVPALARPIWRADDGAGRGRRAVPCCYAGNSIINWDRDF
                     FVMDESGKKARRV"
     misc_feature    395238..395576
                     /locus_tag="SMa0731"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5556"
                     /db_xref="CDD:227843"
     gene            395775..396098
                     /locus_tag="SMa0734"
                     /db_xref="GeneID:1235209"
     CDS             395775..396098
                     /locus_tag="SMa0734"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435635.1"
                     /db_xref="GI:16262842"
                     /db_xref="GeneID:1235209"
                     /translation="MSGQETLVAINGEAPKTVGAGVVHQMMGSDPMTPDLKYVSSTCS
                     GTQKHEDAIEKQKEAAVMAGAGMFEQEKSTQESGEARRLRFARETANLMSVSQVSVLH
                     CSSVA"
     misc_feature    395778..396050
                     /locus_tag="SMa0734"
                     /note="Domain of unknown function (DUF4055); Region:
                     DUF4055; pfam13264"
                     /db_xref="CDD:257613"
     gene            396113..396385
                     /locus_tag="SMa0736"
                     /db_xref="GeneID:1235210"
     CDS             396113..396385
                     /locus_tag="SMa0736"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435636.1"
                     /db_xref="GI:16262843"
                     /db_xref="GeneID:1235210"
                     /translation="MKGLDDADIVVAPPKDLLDSTMSAADFAQLFGVYTQGGMSWETF
                     YERGQADGIFRLSGTRKTNTPSSILRAQRTSGRQPSSDLEHSWPFV"
     gene            complement(396650..396853)
                     /gene="cspA6"
                     /locus_tag="SMa0738"
                     /db_xref="GeneID:1235211"
     CDS             complement(396650..396853)
                     /gene="cspA6"
                     /locus_tag="SMa0738"
                     /function="Cell processes; Adaptation"
                     /note="glimmer prediction match (e-16) to various cold
                     shock proteins, including ones from S. meliloti and NGR234
                     plasmid"
                     /codon_start=1
                     /transl_table=11
                     /product="CspA6 cold shock protein transcriptional
                     regulator"
                     /protein_id="NP_435637.1"
                     /db_xref="GI:16262844"
                     /db_xref="GeneID:1235211"
                     /translation="MATGTVKFFAQDKGFGFITPDNGGPDVFVHISALGFGGSLQDGQ
                     KVSYELGQDRKTGKSKAENVSIL"
     misc_feature    complement(396656..396847)
                     /gene="cspA6"
                     /locus_tag="SMa0738"
                     /note="Cold-Shock Protein (CSP) contains an S1-like
                     cold-shock domain (CSD) that is found in eukaryotes,
                     prokaryotes, and archaea.  CSP's include the major
                     cold-shock proteins CspA and CspB in bacteria and the
                     eukaryotic gene regulatory factor Y-box...; Region:
                     CSP_CDS; cd04458"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(396689..396691,396770..396772,
                     396803..396805,396830..396832))
                     /gene="cspA6"
                     /locus_tag="SMa0738"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:239905"
     misc_feature    complement(order(396764..396775,396794..396814))
                     /gene="cspA6"
                     /locus_tag="SMa0738"
                     /note="RNA-binding motif; other site"
                     /db_xref="CDD:239905"
     gene            complement(396954..397382)
                     /locus_tag="SMa0739"
                     /db_xref="GeneID:1235212"
     CDS             complement(396954..397382)
                     /locus_tag="SMa0739"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435638.1"
                     /db_xref="GI:16262845"
                     /db_xref="GeneID:1235212"
                     /translation="MTKTEDKTAEFREARVMRTLEDGVGTAIEVDLAVMHPRQRRTYA
                     GPEQYRGPVEVRGVQELAKELPNPADLCYLRCRDGVAVSGDRAIRYADALLRSRLSCG
                     GPPATATGGKQKARRYHFEPLKHVGASRHPNWEQAFEQNT"
     gene            397665..398045
                     /locus_tag="SMa0740"
                     /db_xref="GeneID:1235213"
     CDS             397665..398045
                     /locus_tag="SMa0740"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435639.1"
                     /db_xref="GI:16262846"
                     /db_xref="GeneID:1235213"
                     /translation="MFKSSGSHLAGKLEIAAPNVNARRPSCLLRTRIRAMAVPDPVQS
                     IAALDEPPIYFAAVGAKTDTDEPLISIALSDVAPDGRDAARIDQARLPRPFRTDRCRH
                     LRLSIFANFPAHLHRAAHTVACDF"
     gene            complement(398183..398623)
                     /locus_tag="SMa0742"
                     /db_xref="GeneID:1235214"
     CDS             complement(398183..398623)
                     /locus_tag="SMa0742"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435640.1"
                     /db_xref="GI:16262847"
                     /db_xref="GeneID:1235214"
                     /translation="MRGGRYAERDICSKSQGRSRAVKTLISHRGTKPAVTLVARSRVS
                     GRMESGPFDGRYKPPQALANTPQIVQLLRVICLRYIFEIVDDEGQSRAYVASHMYRKA
                     DKLIVLHRGAEVGIDICRICDWCAVDEDEAQRAGTAQTGWLHDC"
     gene            complement(399043..400680)
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /db_xref="GeneID:1235215"
     CDS             complement(399043..400680)
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /EC_number="1.3.1.-"
                     /function="Cell processes; Chaperoning"
                     /note="60 kDa chaperone family; promotes refolding of
                     misfolded polypeptides especially under stressful
                     conditions; forms two stacked rings of heptamers to form a
                     barrel-shaped 14mer; ends can be capped by GroES;
                     misfolded proteins enter the barrel where they are
                     refolded when GroES binds; many bacteria have multiple
                     copies of the groEL gene which are active under different
                     environmental conditions; the B.japonicum protein in this
                     cluster is expressed constitutively; in Rhodobacter,
                     Corynebacterium and Rhizobium this protein is not
                     essential for growth"
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone GroEL"
                     /protein_id="NP_435641.1"
                     /db_xref="GI:16262848"
                     /db_xref="GeneID:1235215"
                     /translation="MAAKEVKFGRSAREKMLRGVDILADAVKVTLGPKGRNVVIDKSF
                     GAPRITKDGVTVAKEIELEDKFENMGAQMVREVASKTNDIAGDGTTTATVLAQAIVRE
                     GAKAVAAGMNPMDLKRGIDLAVAEVVKDLLAKAKKINTSDEVAQVGTISANGEKQIGL
                     DIAEAMQKVGNEGVITVEEAKTAETELEVVEGMQFDRGYLSPYFVTNPEKMVADLEDA
                     FILLHEKKLSNLQAMLPVLEAVVQTGKPLLIIAEDVEGEALATLVVNKLRGGLKIAAV
                     KAPGFGDRRKAMLEDIAILTGGTVISEDLGIKLESVTLDMLGRAKKVSITKENTTIVD
                     GAGQKSDIEGRVAQIKAQIEETTSDYDREKLQERLAKLAGGVAVIRVGGATEVEVKEK
                     KDRIDDALNATRAAVQEGIVPGGGVALLRSSVKITVKGENDDQDAGVNIVRRALQSPA
                     RQIVENAGDEASIVVGKILEKNTDDFGYNAQTGEYGDMIAMGIIDPVKVVRTALQDAA
                     SVASLLITTEAMIAELPKKDAPAMPGGMGGMGGMDMM"
     misc_feature    complement(399088..400680)
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /note="chaperonin GroEL; Reviewed; Region: groEL;
                     PRK12850"
                     /db_xref="CDD:237231"
     misc_feature    complement(399112..400671)
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /note="GroEL_like type I chaperonin. Chaperonins are
                     involved in productive folding of proteins. They share a
                     common general morphology, a double toroid of 2 stacked
                     rings, each composed of 7-9 subunits. The symmetry of type
                     I is seven-fold and they are found...; Region: GroEL;
                     cd03344"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(399115..399135,399142..399144,
                     399307..399309,399523..399525,399529..399531,
                     399910..399912,399994..399996,400090..400092,
                     400453..400455,400462..400464,400474..400476,
                     400498..400500,400504..400506,400534..400536,
                     400540..400545,400558..400560,400564..400575,
                     400606..400608,400657..400659,400669..400671))
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /note="ring oligomerisation interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(399196..399198,399202..399204,
                     399322..399324,399436..399438,399487..399489,
                     400231..400233,400408..400410,400420..400422,
                     400582..400590))
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /note="ATP/Mg binding site [chemical binding]; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(399283..399285,399292..399297,
                     399301..399303,399328..399330,399382..399384,
                     400354..400356))
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /note="stacking interactions; other site"
                     /db_xref="CDD:239460"
     misc_feature    complement(order(399451..399456,399556..399558,
                     400102..400104,400123..400125,400258..400260))
                     /gene="groEL"
                     /locus_tag="SMa0744"
                     /note="hinge regions; other site"
                     /db_xref="CDD:239460"
     gene            complement(400756..401052)
                     /gene="groES"
                     /locus_tag="SMa0745"
                     /db_xref="GeneID:1235216"
     CDS             complement(400756..401052)
                     /gene="groES"
                     /locus_tag="SMa0745"
                     /function="Cell processes; Chaperoning"
                     /note="10 kDa chaperonin; Cpn10; GroES; forms
                     homoheptameric ring; binds to one or both ends of the
                     GroEL double barrel in the presence of adenine nucleotides
                     capping it; folding of unfolded substrates initiates in a
                     GroEL-substrate bound and capped by GroES; release of the
                     folded substrate is dependent on ATP binding and
                     hydrolysis in the trans ring"
                     /codon_start=1
                     /transl_table=11
                     /product="co-chaperonin GroES"
                     /protein_id="NP_435642.1"
                     /db_xref="GI:16262849"
                     /db_xref="GeneID:1235216"
                     /translation="MASTDFRPLHDRVVVRRVESEEKTKGGVIIPDTAKEKPQEGEIV
                     AVGSGARDESGKVVPLDVKAGDRILFGKWSGTEVKINGEDLLIMKEADIMGVIG"
     misc_feature    complement(400762..401037)
                     /gene="groES"
                     /locus_tag="SMa0745"
                     /note="Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10
                     cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase,
                     to assist the folding and assembly of proteins and is
                     found in eubacterial cytosol, as well as in the matrix of
                     mitochondria and chloroplasts. It...; Region: cpn10;
                     cd00320"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(400765..400773,400819..400821,
                     400825..400827,400840..400842,400870..400872,
                     400933..400938,401017..401019,401026..401028,
                     401032..401034))
                     /gene="groES"
                     /locus_tag="SMa0745"
                     /note="oligomerisation interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(400951..400992)
                     /gene="groES"
                     /locus_tag="SMa0745"
                     /note="mobile loop; other site"
                     /db_xref="CDD:238197"
     misc_feature    complement(order(400876..400878,400909..400911))
                     /gene="groES"
                     /locus_tag="SMa0745"
                     /note="roof hairpin; other site"
                     /db_xref="CDD:238197"
     gene            401607..401768
                     /locus_tag="SMa0747"
                     /db_xref="GeneID:1235217"
     CDS             401607..401768
                     /locus_tag="SMa0747"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435643.1"
                     /db_xref="GI:16262850"
                     /db_xref="GeneID:1235217"
                     /translation="MRLPGLSLSEKVPAAKDKPAKLAQKDRDARWTVKYSKVNATDEN
                     AVIWRDQAV"
     gene            402138..402587
                     /locus_tag="SMa0748"
                     /db_xref="GeneID:1235218"
     CDS             402138..402587
                     /locus_tag="SMa0748"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction Excellent match (e-58, 111/141)
                     to hypothetical MucR family regulatory protein (O33682)
                     near SyrB in R. meliloti"
                     /codon_start=1
                     /transl_table=11
                     /product="MucR family transcriptional regulator"
                     /protein_id="NP_435644.2"
                     /db_xref="GI:193782601"
                     /db_xref="GeneID:1235218"
                     /translation="MTESHSNELRLELTSRIVSAYLSRNVIAPSELPHLIQQTYGSLG
                     KTSEPTKTPATVEEQRPAVPIKKSVTDDFIVCLEDGKSFKSLKRHLMAKYALTPEQYR
                     EKWKLPADYPMVAPNYARKRSELARATGLGKKSAANLSPSLQAVRSA"
     misc_feature    402138..402563
                     /locus_tag="SMa0748"
                     /note="Predicted transcriptional regulator
                     [Transcription]; Region: COG4957"
                     /db_xref="CDD:227293"
     gene            complement(402820..403107)
                     /locus_tag="SMa5003"
                     /db_xref="GeneID:6435266"
     CDS             complement(402820..403107)
                     /locus_tag="SMa5003"
                     /note="Has weak similarity to short length of sequence
                     found in carboxy-terminus of transposases; Probable
                     protein fragment"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000344.1"
                     /db_xref="GI:193782602"
                     /db_xref="GeneID:6435266"
                     /translation="MGMNRVVGGGGVQGWWRSTSRWSAMARGGTIHRAALACDQIRGG
                     LYHAYKTVPEALAGIGRYLTFYNRRHPHSSLDRQTPDQAYFNTLTPMMAAA"
     misc_feature    complement(402868..>402972)
                     /locus_tag="SMa5003"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(403178..404056)
                     /locus_tag="SMa0750"
                     /db_xref="GeneID:1235219"
     CDS             complement(403178..404056)
                     /locus_tag="SMa0750"
                     /function="Miscellaneous; Not classified regulator"
                     /note="glimmer prediction match (e-21) to several
                     transcriptional activator proteins controlling D-serine
                     deaminase and glycine cleavage system. ProDom finds match
                     (e-8) to superfamily containing nodD and to DNA binding
                     domain in parts of protein match begins around aa68 but
                     left untrimmed from glimmer prediction"
                     /codon_start=1
                     /transl_table=11
                     /product="LysR family transcriptional regulator"
                     /protein_id="NP_435645.1"
                     /db_xref="GI:16262852"
                     /db_xref="GeneID:1235219"
                     /translation="MPRPYEFSSMTALVCFEAAARNASFKKAAQEMNVTPAAISHQIK
                     ALEMDLKCSLFLRHHRGVELTEKGALLFVVIQRGFETISETLTQIRERPETVDVTIGA
                     TTAFSSLWLTPKISAFWKIHPSITVSQVVSDVPGMTSRCDLTIHYGNPQENGVEYRKL
                     FQDHIIALGTTRFAAEHRIARLEDLLKAPLIHSSSNETGWTAWDDWFAVLGCPAPKGR
                     SFYVNNYMIALQAAQDDVGAVLGWDGLVGSLVNEGRLVKLVQESIPSPVGFHLRIHRR
                     ATAKARLFADWLVEAT"
     misc_feature    complement(403184..404032)
                     /locus_tag="SMa0750"
                     /note="putative choline sulfate-utilization transcription
                     factor; Region: chol_sulf_TF; TIGR03418"
                     /db_xref="CDD:188320"
     misc_feature    complement(403853..404029)
                     /locus_tag="SMa0750"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    complement(403193..403765)
                     /locus_tag="SMa0750"
                     /note="The substrate binding domain of LysR-type
                     transcriptional regulators (LTTRs), a member of the type 2
                     periplasmic binding fold protein superfamily; Region:
                     PBP2_LTTR_substrate; cl11398"
                     /db_xref="CDD:264351"
     misc_feature    complement(order(403355..403360,403364..403369,
                     403385..403390,403397..403408,403664..403684,
                     403688..403690,403700..403702,403709..403714,
                     403718..403723))
                     /locus_tag="SMa0750"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:176102"
     gene            404204..405442
                     /locus_tag="SMa0751"
                     /db_xref="GeneID:1235220"
     CDS             404204..405442
                     /locus_tag="SMa0751"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction, start codon changed based on
                     codon usage and S_D consensus; match (e-25) to benzene,
                     anthranillate, toluene dioxygenases from various sources
                     in amino half of protein"
                     /codon_start=1
                     /transl_table=11
                     /product="Ring-hydroxylating dioxygenase"
                     /protein_id="NP_435646.1"
                     /db_xref="GI:16262853"
                     /db_xref="GeneID:1235220"
                     /translation="MTANPTSIHQRLDRRLSGFSLEQPFYTSPEVYALDLQHIFYKQW
                     LYAVPVCQLAKAGSYTTLRVGAYEVVIVRSRDGEVRAFHNSCRHRGSLICKARQGQVA
                     KLVCPYHQWTYELDGKLIWANDMGPDFDASKYGLKPVNLRNLDGLIYICLSDTPPDFQ
                     TFAQLARPYLEVHDLKDAKVAFTSTIIEKGNWKLVWENNRECYHCSSNHPALCRSFPL
                     DPEVAGVQADGGVSKKLQAHFDRCEAAGTPAQFVLAGDGQYRLARMPLQEKALSYTMD
                     GKAAVSRHLGRVAPPDAGTLLMFHYPSTWNHFLPDHSLTFRVMPISPTETEVTTTWLV
                     HKDAVEGVDYDLKRLTEVWIATNDEDREIVETNQQGILSPAYVPGPYSPGQESGVMQF
                     VDWYAASLERALAPRQVAAE"
     misc_feature    404261..405418
                     /locus_tag="SMa0751"
                     /note="Phenylpropionate dioxygenase and related
                     ring-hydroxylating dioxygenases, large terminal subunit
                     [Inorganic ion transport and metabolism / General function
                     prediction only]; Region: HcaE; COG4638"
                     /db_xref="CDD:226985"
     misc_feature    404333..404680
                     /locus_tag="SMa0751"
                     /note="Rieske non-heme iron oxygenase (RO) family,
                     N-terminal Rieske domain of the oxygenase alpha subunit;
                     The RO family comprise a large class of aromatic
                     ring-hydroxylating dioxygenases found predominantly in
                     microorganisms. These enzymes enable...; Region:
                     Rieske_RO_Alpha_N; cd03469"
                     /db_xref="CDD:239551"
     misc_feature    order(404459..404461,404465..404470,404519..404521,
                     404528..404530,404534..404536)
                     /locus_tag="SMa0751"
                     /note="[2Fe-2S] cluster binding site [ion binding]; other
                     site"
                     /db_xref="CDD:239551"
     misc_feature    404720..405403
                     /locus_tag="SMa0751"
                     /note="C-terminal catalytic domain of GbcA (glycine
                     betaine catabolism A) from Pseudomonas aeruginosa PAO1 and
                     related aromatic ring hydroxylating dioxygenases; Region:
                     RHO_alpha_C_GbcA-like; cd08884"
                     /db_xref="CDD:176893"
     misc_feature    order(404768..404773,404783..404785,404792..404797,
                     404804..404806,404810..404815,404825..404827,
                     405173..405178,405287..405295,405299..405313,
                     405344..405352,405356..405358,405368..405370,
                     405377..405379,405389..405391)
                     /locus_tag="SMa0751"
                     /note="putative alpha subunit interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176893"
     misc_feature    order(404795..404800,404804..404809,404813..404818,
                     404828..404830,405083..405088,405092..405094,
                     405116..405118,405122..405124,405143..405145,
                     405149..405151,405239..405241,405248..405253,
                     405269..405274,405281..405283)
                     /locus_tag="SMa0751"
                     /note="putative active site [active]"
                     /db_xref="CDD:176893"
     misc_feature    order(404795..404800,404804..404809,404813..404818,
                     404828..404830,405083..405088,405092..405094,
                     405116..405118,405122..405124,405143..405145,
                     405149..405151,405239..405241,405248..405253,
                     405269..405274)
                     /locus_tag="SMa0751"
                     /note="putative substrate binding site [chemical binding];
                     other site"
                     /db_xref="CDD:176893"
     misc_feature    order(404813..404815,404828..404830,405281..405283)
                     /locus_tag="SMa0751"
                     /note="Fe binding site [ion binding]; other site"
                     /db_xref="CDD:176893"
     gene            405447..406508
                     /locus_tag="SMa0752"
                     /db_xref="GeneID:1235221"
     CDS             405447..406508
                     /locus_tag="SMa0752"
                     /function="Small molecule metabolism; Degradation"
                     /note="glimmer prediction Trimmed to met20 of glimmer
                     prediction to eliminate overlap with SMA0751 match (e-31)
                     to aromatic (aniline, phthalate) dioxygenase reductase
                     subunit over most of protein length ProDom finds three
                     domains with matches to oxidoreductases"
                     /codon_start=1
                     /transl_table=11
                     /product="dioxygenase reductase subunit"
                     /protein_id="NP_435647.1"
                     /db_xref="GI:16262854"
                     /db_xref="GeneID:1235221"
                     /translation="MTQFKQLSFWSDAEPLECVTRTPEAPNVVTFSFQSPSGALFNHD
                     PGQFVTLELPAPGGPLYRTYTISSAPSRPTALTITVKAQDGSTGTRWMLDNLHKGMRI
                     RAIGPAGKFSIVHHPADKYLFISAGSGITPMVAMTTWLYDSGREPDVVFINCARRPSE
                     IILRDRMELMASRIVGIDLKWVVEEPDPFRSWTGYRGMFNQIMLGLMAQDYLEREVFC
                     CGPEPFMRAVREALAGLGYDMSRYHQESFTAEPGHAEDVPEDVIPDEQNHAEIAFALS
                     GVTTRCSETDTILAAAKAAGLVIPSGCSMGICGTCKVRKTEGQVHMVHNGGITDEDVE
                     DGYILACCSKPLRRVSVEA"
     misc_feature    405474..406322
                     /locus_tag="SMa0752"
                     /note="Flavodoxin reductases (ferredoxin-NADPH reductases)
                     family 1 [Energy production and conversion]; Region: Hmp;
                     COG1018"
                     /db_xref="CDD:223949"
     misc_feature    405492..406187
                     /locus_tag="SMa0752"
                     /note="Iron-sulfur binding ferredoxin reductase (FNR)
                     proteins combine the FAD and NAD(P) binding regions of FNR
                     with an iron-sulfur binding cluster domain.
                     Ferredoxin-NADP+ (oxido)reductase is an FAD-containing
                     enzyme that catalyzes the reversible electron...; Region:
                     FNR_iron_sulfur_binding_1; cd06215"
                     /db_xref="CDD:99811"
     misc_feature    order(405588..405590,405630..405641,405681..405689,
                     405693..405695,405705..405713,405828..405830,
                     405837..405839,406179..406181,406185..406187)
                     /locus_tag="SMa0752"
                     /note="FAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(405630..405632,405636..405641)
                     /locus_tag="SMa0752"
                     /note="FAD binding motif [chemical binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(405702..405704,405711..405713,405720..405722,
                     405741..405743,405765..405767,405771..405773)
                     /locus_tag="SMa0752"
                     /note="phosphate binding motif [ion binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(405813..405815,405825..405836,405840..405842)
                     /locus_tag="SMa0752"
                     /note="beta-alpha-beta structure motif; other site"
                     /db_xref="CDD:99811"
     misc_feature    order(405828..405833,405906..405914,406104..406109)
                     /locus_tag="SMa0752"
                     /note="NAD binding pocket [chemical binding]; other site"
                     /db_xref="CDD:99811"
     misc_feature    406254..406502
                     /locus_tag="SMa0752"
                     /note="2Fe-2S iron-sulfur cluster binding domain.
                     Iron-sulfur proteins play an important role in electron
                     transfer processes and in various enzymatic reactions. The
                     family includes plant and algal ferredoxins, which act as
                     electron carriers in photosynthesis...; Region: fer2;
                     cd00207"
                     /db_xref="CDD:238126"
     misc_feature    order(406341..406346,406353..406355,406362..406364,
                     406368..406379,406464..406469)
                     /locus_tag="SMa0752"
                     /note="catalytic loop [active]"
                     /db_xref="CDD:238126"
     misc_feature    order(406353..406355,406368..406370,406377..406379,
                     406467..406469)
                     /locus_tag="SMa0752"
                     /note="iron binding site [ion binding]; other site"
                     /db_xref="CDD:238126"
     gene            406804..407496
                     /locus_tag="SMa0753"
                     /db_xref="GeneID:1235222"
     CDS             406804..407496
                     /locus_tag="SMa0753"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; flavin reductase like domain.
                     Similar to SMA0758 of S. meliloti pSyma"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435648.1"
                     /db_xref="GI:16262855"
                     /db_xref="GeneID:1235222"
                     /translation="MKADVFDPRALREAFGAFPTAVTVITASDPAGRPVGFTANSFTS
                     VSLDPPLLLVCVAKTARDYSTMTAAEHFAINILSEAQKDVSIKFARPLEDRFAAVDWA
                     RAPNGCPIFAQVAAWFECSMHDVIEAGDHVMMVGRVTAFKSSGLNGLGYARGGYFAPS
                     VAAKANSSAAGGEIGAVAVLERHAALFPLGDQNLSLPRYSAAGGDPAKTLASQLERSG
                     LSVHDWLSLLDL"
     misc_feature    406846..407271
                     /locus_tag="SMa0753"
                     /note="Flavin reductase like domain; Region:
                     Flavin_Reduct; smart00903"
                     /db_xref="CDD:214900"
     gene            407780..408106
                     /locus_tag="SMa0754"
                     /db_xref="GeneID:1235223"
     CDS             407780..408106
                     /locus_tag="SMa0754"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435649.1"
                     /db_xref="GI:16262856"
                     /db_xref="GeneID:1235223"
                     /translation="MRVPRSSIWIERHKRAAGFWLAEDYFTGTKCIGVILRAGGEVLR
                     NRDCAGQGHSARQPRDYRSGEEVTSARQADWEKLRRMPADDTLVAPGWWFRSHQVWYL
                     QARGRW"
     gene            409254..410186
                     /gene="nodD2"
                     /locus_tag="SMa0757"
                     /db_xref="GeneID:1235224"
     CDS             409254..410186
                     /gene="nodD2"
                     /locus_tag="SMa0757"
                     /function="Nodulation"
                     /note="LysR family; bacterial regulatory helix-turn-helix
                     motif"
                     /codon_start=1
                     /transl_table=11
                     /product="NodD2 nod box-dependent transcription activator"
                     /protein_id="NP_435650.1"
                     /db_xref="GI:16262857"
                     /db_xref="GeneID:1235224"
                     /translation="MRFRGLDLNLLVALDALMTERKLTAAARRVKLSQPAMSAAIARL
                     RTYFGDELFSMQGRELIPTPRAEALAPAVRDALLHIQLSVIAWDPINPAQSDRRFRII
                     LSDFMTLVFFERVVERLAREAPGVSFELLPLDDDPYELLRRGDVDFLVLPDLFMSSAH
                     PKAKLFAEALVCVGCPTNEQLLGELSFEKYMSMGHVAAQFGRALKPSFEQWLLLEHGF
                     KRRVELVVPGFTLIPPLLPHTNRIAIIPLRLVKYFEQTIPLRIVKHPLPPLWFTEAVQ
                     WPALHNKDPGNIWMREILLQEASRSEFQGETSLE"
     misc_feature    409269..410156
                     /gene="nodD2"
                     /locus_tag="SMa0757"
                     /note="Transcriptional regulator [Transcription]; Region:
                     LysR; COG0583"
                     /db_xref="CDD:223656"
     misc_feature    409275..409454
                     /gene="nodD2"
                     /locus_tag="SMa0757"
                     /note="Bacterial regulatory helix-turn-helix protein, lysR
                     family; Region: HTH_1; pfam00126"
                     /db_xref="CDD:249610"
     misc_feature    409545..410144
                     /gene="nodD2"
                     /locus_tag="SMa0757"
                     /note="The C-terminal substsrate binding domain of NodD
                     family of LysR-type transcriptional regulators that
                     regulates the expression of nodulation (nod) genes;
                     contains the type 2 periplasmic binding fold; Region:
                     PBP2_NodD; cd08462"
                     /db_xref="CDD:176151"
     misc_feature    order(409563..409565,409569..409574,409584..409586,
                     409755..409757,409866..409868,410070..410072)
                     /gene="nodD2"
                     /locus_tag="SMa0757"
                     /note="putative substrate binding pocket [chemical
                     binding]; other site"
                     /db_xref="CDD:176151"
     misc_feature    order(409566..409568,409575..409580,409587..409592,
                     409599..409604,409608..409613,409620..409625,
                     409629..409643,409647..409649,409833..409835,
                     409920..409934,409941..409946,409953..409958,
                     409965..409967,410007..410009)
                     /gene="nodD2"
                     /locus_tag="SMa0757"
                     /note="putative dimerization interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:176151"
     gene            411107..411682
                     /locus_tag="SMa0758"
                     /db_xref="GeneID:1235441"
     CDS             411107..411682
                     /locus_tag="SMa0758"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; flavin reductase like domain.
                     Similar to SMA0753 of S. meliloti pSyma"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435651.2"
                     /db_xref="GI:193782603"
                     /db_xref="GeneID:1235441"
                     /translation="MKADVFDARALREAFGAFPTAVTAITASDPAGRPVGFTANSFTS
                     VSLDPPLLLVCVAKTARDYSTMTAAEHFAINILSEAQKDVSIKFARPLEDRFAAVDWA
                     RAPNGCPIFAQVAAWFECSMHDVIEAGDHVMMVGRVTAFKSSGLNGLGYARGGYFAPS
                     VAAKANSSAAGGEIGAVAVLERHAALFPLGD"
     misc_feature    411149..411574
                     /locus_tag="SMa0758"
                     /note="Flavin reductase like domain; Region:
                     Flavin_Reduct; smart00903"
                     /db_xref="CDD:214900"
     gene            411913..412314
                     /locus_tag="SMa0759"
                     /db_xref="GeneID:1235442"
     CDS             411913..412314
                     /locus_tag="SMa0759"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; similarity to middle of FixJ"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435652.1"
                     /db_xref="GI:16262859"
                     /db_xref="GeneID:1235442"
                     /translation="MVVEVKKAGAVDFIEKPFENTVIIEVIERASEHLVVPQADADEV
                     NDIRARLQTLSERERQVLSAVVADLPNKSIAYDLDIQSSLRRGASRERHGQNEGEEPS
                     PPRANGSHRWLRSFLSRRVDLAQCGALPQAA"
     misc_feature    <411913..412299
                     /locus_tag="SMa0759"
                     /note="Response regulator [Signal transduction
                     mechanisms]; Region: TtrR; COG4566"
                     /db_xref="CDD:226932"
     misc_feature    <411913..412002
                     /locus_tag="SMa0759"
                     /note="Signal receiver domain; originally thought to be
                     unique to bacteria (CheY, OmpR, NtrC, and PhoB), now
                     recently identified in eukaroytes ETR1 Arabidopsis
                     thaliana; this domain receives the signal from the sensor
                     partner in a two-component systems; Region: REC; cl19078"
                     /db_xref="CDD:267431"
     misc_feature    411958..411966
                     /locus_tag="SMa0759"
                     /note="dimerization interface [polypeptide binding]; other
                     site"
                     /db_xref="CDD:238088"
     misc_feature    412063..>412152
                     /locus_tag="SMa0759"
                     /note="C-terminal DNA-binding domain of LuxR-like
                     proteins. This domain contains a helix-turn-helix motif
                     and binds DNA. Proteins belonging to this group are
                     response regulators; some act as transcriptional
                     activators, others as transcriptional repressors. Many...;
                     Region: LuxR_C_like; cl17315"
                     /db_xref="CDD:266624"
     gene            412363..412710
                     /gene="fixT2"
                     /locus_tag="SMa0760"
                     /db_xref="GeneID:1235443"
     CDS             412363..412710
                     /gene="fixT2"
                     /locus_tag="SMa0760"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="Interacts with FixL, counteracts activity of FixLJ
                     two-component system"
                     /codon_start=1
                     /transl_table=11
                     /product="FixT2 anti-kinase"
                     /protein_id="NP_435653.1"
                     /db_xref="GI:16262860"
                     /db_xref="GeneID:1235443"
                     /translation="MLDGKTIIVVAADQGLRRSVAFALEVEGYSTESYDTVQKAEASS
                     GEALCTILDDEILKSETVAATQLLKNLGRRAILLVDGLSAPQPPADYTTLTKPFSGAD
                     LLGVINSPTEAAK"
     misc_feature    412363..>412683
                     /gene="fixT2"
                     /locus_tag="SMa0760"
                     /note="Response regulator containing CheY-like receiver,
                     AAA-type ATPase, and DNA-binding domains [Signal
                     transduction mechanisms]; Region: AtoC; COG2204"
                     /db_xref="CDD:225114"
     gene            412790..413425
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /db_xref="GeneID:1235444"
     CDS             412790..413425
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="transcriptional regulator that positively regulated
                     fixLJ operon; upregulated transcription by FixJ; part of
                     global network that controls expression of aerobic
                     respiratory terminal oxidases and carbon and nitrogen
                     metabolic enzymes"
                     /codon_start=1
                     /transl_table=11
                     /product="transcriptional regulator FixK"
                     /protein_id="NP_435654.1"
                     /db_xref="GI:16262861"
                     /db_xref="GeneID:1235444"
                     /translation="MYAAAQAKPQSIEVEHLGPAPMSGPHLVATYKPGREIYAQGDLN
                     DKCYQVSTGAVRVYRLLSDGRRQVVSFHLPGEMFGFEAGSNHSFFAEAITETTLAIFG
                     RRNMQERSRELLALALTGMARAQQHLLVIGRQCAVERIAAFLVDLCERQGGGRQLRLP
                     MSRQDIADYLGLTIETVSRVVTKLKERSLIALRDARTIDIVRLEALRSLCS"
     misc_feature    412796..413419
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="transcriptional regulator FixK; Provisional;
                     Region: fixK; PRK09391"
                     /db_xref="CDD:236494"
     misc_feature    412871..413143
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="effector domain of the CAP family of transcription
                     factors; members include CAP (or cAMP receptor protein
                     (CRP)), which binds cAMP, FNR (fumarate and nitrate
                     reduction), which uses an iron-sulfur cluster to sense
                     oxygen) and CooA, a heme containing CO...; Region: CAP_ED;
                     cd00038"
                     /db_xref="CDD:237999"
     misc_feature    order(413024..413029,413045..413053)
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:237999"
     misc_feature    order(413111..413119,413129..413137)
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="flexible hinge region; other site"
                     /db_xref="CDD:237999"
     misc_feature    413195..413389
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="helix_turn_helix, cAMP Regulatory protein
                     C-terminus; DNA binding domain of prokaryotic regulatory
                     proteins belonging to the catabolite activator protein
                     family; Region: HTH_CRP; cd00092"
                     /db_xref="CDD:238044"
     misc_feature    413204..413209
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="putative switch regulator; other site"
                     /db_xref="CDD:238044"
     misc_feature    order(413267..413269,413273..413281,413306..413308)
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="non-specific DNA interactions [nucleotide binding];
                     other site"
                     /db_xref="CDD:238044"
     misc_feature    413306..413326
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:238044"
     misc_feature    order(413309..413314,413324..413326)
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="sequence specific DNA binding site [nucleotide
                     binding]; other site"
                     /db_xref="CDD:238044"
     misc_feature    413309..413314
                     /gene="fixK"
                     /locus_tag="SMa0762"
                     /note="putative cAMP binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238044"
     gene            413437..414084
                     /locus_tag="SMa0763"
                     /db_xref="GeneID:1235445"
     CDS             413437..414084
                     /locus_tag="SMa0763"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction. local similarity to SMA1151 and
                     SMA1223 of S. meliloti pSyma"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435655.1"
                     /db_xref="GI:16262862"
                     /db_xref="GeneID:1235445"
                     /translation="MRAQPSPRVAAADRAWWEQGKKRCSYGRFLVLNVTDSRRWRSGA
                     IGLLQGRPALHRADHVRALGQLHLLFFYVRPENRLDAQQSKMSLQIAEFASNRQWKSV
                     VVTGRYQELPATQGCHHERIHAWSLREKKPNWWKPGGHKPVAKPSAHIFVCVVMDEIA
                     GRAASAAVAGVLRAELASRPQRARVTGPAKGPGCRVSDVAVTPVSEARAATLPLS"
     misc_feature    413449..413913
                     /locus_tag="SMa0763"
                     /note="Predicted flavin-nucleotide-binding protein
                     [General function prediction only]; Region: COG3467"
                     /db_xref="CDD:225998"
     gene            414187..415806
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /db_xref="GeneID:1235446"
     CDS             414187..415806
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="CcoN; FixN"
                     /codon_start=1
                     /transl_table=11
                     /product="cbb3-type cytochrome c oxidase subunit I"
                     /protein_id="NP_435656.1"
                     /db_xref="GI:16262863"
                     /db_xref="GeneID:1235446"
                     /translation="MKHTVEMVVLAVGAFLALVGAGLAQDRLFGAHMWVLFFVLLGGT
                     LVLMRRVDFRPAAAGRRAGETEYFDEVVKYGVIATVFWGVVGFLVGVVVALQLAFPDL
                     NVEPWFNFGRVRPLHTSAVIFAFGGNALIATSFYVVQRTSRARLFGGDLGWFVFWGYQ
                     LFIVLAATGYLLGITQSREYAEPEWYVDLWLTIVWVAYLAVFLGTVLMRKEPHIYVAN
                     WFYLAFIVTIAMLHIVNNLAVPVSFMGSKSYSAFAGVQDALTQWWYGHNAVGFFLTAG
                     FLAMMYYFIPKQVNRPVYSYRLSIIHFWALIFMYIWAGPHHLHYTALPDWAQTLGMVF
                     SIMLWMPSWGGMINGLMTLSGAWDKIRTDPVVRMMVMAVAFYGMATFEGPMMSIKTVN
                     SLSHYTDWTIGHVHSGALGWNGLITFGAVYYLVPKLWNRERLYSLQMVNWHFWLATLG
                     IVVYAATMWVAGIQQGLMWREYDDQGFLVYSFAESVAAMFPYYVMRAAGGALFLAGAL
                     VMAFNVTMTILGRVRDEAAALDAAPLPAPAE"
     misc_feature    414256..415740
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /note="Cytochrome cbb3 oxidase subunit I.  Cytochrome cbb3
                     oxidase, the terminal oxidase in the respiratory chains of
                     proteobacteria, is a multi-chain transmembrane protein
                     located in the cell membrane. Like other cytochrome
                     oxidases, it catalyzes the reduction...; Region:
                     cbb3_Oxidase_I; cd01661"
                     /db_xref="CDD:238831"
     misc_feature    414397..415695
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /note="Cytochrome C and Quinol oxidase polypeptide I;
                     Region: COX1; pfam00115"
                     /db_xref="CDD:249600"
     misc_feature    order(414406..414408,415402..415404,415414..415416,
                     415546..415548,415657..415659)
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /note="Low-spin heme binding site [chemical binding];
                     other site"
                     /db_xref="CDD:238831"
     misc_feature    order(414943..414945,414958..414963,415360..415362,
                     415372..415377,415591..415593)
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /note="Putative water exit pathway; other site"
                     /db_xref="CDD:238831"
     misc_feature    order(414982..414984,415132..415137,415396..415398)
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /note="Binuclear center (active site) [active]"
                     /db_xref="CDD:238831"
     misc_feature    order(415135..415137,415372..415377,415591..415596)
                     /gene="fixN2"
                     /locus_tag="SMa0765"
                     /note="Putative proton exit pathway; other site"
                     /db_xref="CDD:238831"
     gene            415818..416549
                     /gene="fixO2"
                     /locus_tag="SMa0766"
                     /db_xref="GeneID:1235447"
     CDS             415818..416549
                     /gene="fixO2"
                     /locus_tag="SMa0766"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="CcoO; FixO"
                     /codon_start=1
                     /transl_table=11
                     /product="cbb3-type cytochrome c oxidase subunit II"
                     /protein_id="NP_435657.1"
                     /db_xref="GI:16262864"
                     /db_xref="GeneID:1235447"
                     /translation="MSILDKHALLERNATLLLVGSLLVVSIGGIVEIAPLFYLENTIE
                     KVEGMRPYSPLELAGRDIYVREGCYVCHSQMIRPFRDEVERYGHYSLAAESMYDHPFQ
                     WGSKRTGPDLARVGDRYSNEWHVQHMIEPRSVVPESVMPSYAFLKDTPLEVTNIAMNL
                     EANRAVGVPYTDEMIDNATADLKAQADPDADASGVEARYPKAKLGDFDGDPQRLSEMD
                     ALIAYLQMLGTLVDFSTYDDTTGYR"
     misc_feature    415836..416513
                     /gene="fixO2"
                     /locus_tag="SMa0766"
                     /note="Cytochrome C oxidase, mono-heme subunit/FixO;
                     Region: FixO; pfam02433"
                     /db_xref="CDD:111339"
     gene            416561..416713
                     /gene="fixQ2"
                     /locus_tag="SMa0767"
                     /db_xref="GeneID:1235448"
     CDS             416561..416713
                     /gene="fixQ2"
                     /locus_tag="SMa0767"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /codon_start=1
                     /transl_table=11
                     /product="FixQ2 nitrogen fixation protein"
                     /protein_id="NP_435658.1"
                     /db_xref="GI:16262865"
                     /db_xref="GeneID:1235448"
                     /translation="METYTAMRHFADSWGLLAMTLFFLGVVLFIFRPGAKKSAAQASA
                     IPLNED"
     misc_feature    416561..>416662
                     /gene="fixQ2"
                     /locus_tag="SMa0767"
                     /note="Cytochrome cbb oxidase CcoQ.  Cytochrome cbb3
                     oxidase, the terminal oxidase in the respiratory chains of
                     proteobacteria, is a multi-chain transmembrane protein
                     located in the cell membrane. Like other cytochrome
                     oxidases, it catalyzes the reduction of O2...; Region:
                     cbb3_Oxidase_CcoQ; cd01324"
                     /db_xref="CDD:238647"
     gene            416717..417580
                     /gene="fixP2"
                     /locus_tag="SMa0769"
                     /db_xref="GeneID:1235449"
     CDS             416717..417580
                     /gene="fixP2"
                     /locus_tag="SMa0769"
                     /EC_number="1.9.3.1"
                     /function="Small molecule metabolism; Energy transfer;
                     electron transport"
                     /note="translation start extended 57 residues upstream
                     from glimmer prediction to better coincide with starts of
                     other cytochrome c oxidases"
                     /codon_start=1
                     /transl_table=11
                     /product="FixP2 Diheme c-type cytochrome"
                     /protein_id="NP_435659.1"
                     /db_xref="GI:16262866"
                     /db_xref="GeneID:1235449"
                     /translation="MTDKHIDEISGVETTGHEWDGIRELNNPLPRWWVYSFYATIIWA
                     IGYAVAYPSWPMLTESTKGVLGYSSRAEVSAELAEAKAAQAGNLERIASSAVEDIMAN
                     PELKQFAITIGASAFKVNCAQCHGSGTAGGKGFTNLNDDEWLWGGKPEEIYQTIAHGI
                     RYSGDGETRVSEMPAFTDTLAPREVRATAAYVASLTGTPSNPALVEPGKQLFAENCAS
                     CHGADAKGTREFGAPNLADAIWLNGEGEQAIIDQMKSPKHGVMPAWLQRIGDPVVKEL
                     AVFVHSLGGGE"
     misc_feature    416744..416884
                     /gene="fixP2"
                     /locus_tag="SMa0769"
                     /note="N-terminal domain of cytochrome oxidase-cbb3, FixP;
                     Region: FixP_N; pfam14715"
                     /db_xref="CDD:258852"
     misc_feature    416747..417577
                     /gene="fixP2"
                     /locus_tag="SMa0769"
                     /note="cytochrome c oxidase, cbb3-type, subunit III;
                     Region: ccoP; TIGR00782"
                     /db_xref="CDD:129864"
     misc_feature    417041..417292
                     /gene="fixP2"
                     /locus_tag="SMa0769"
                     /note="Cytochrome C oxidase, cbb3-type, subunit III;
                     Region: Cytochrome_CBB3; pfam13442"
                     /db_xref="CDD:257767"
     misc_feature    417329..417565
                     /gene="fixP2"
                     /locus_tag="SMa0769"
                     /note="Cytochrome c; Region: Cytochrom_C; pfam00034"
                     /db_xref="CDD:249527"
     gene            417769..418242
                     /locus_tag="SMa0771"
                     /db_xref="GeneID:1235450"
     CDS             417769..418242
                     /locus_tag="SMa0771"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; heavy metal associated domain;
                     partial similarity to FixI"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435660.1"
                     /db_xref="GI:16262867"
                     /db_xref="GeneID:1235450"
                     /translation="MHHHHRDGVAGKIQVEQSKRARVNLSTRRVSIVWKEEVAGKRSD
                     PGELVRAISERGHETHIFTHGEGEGDAVGEPISVSSGDAVEAGTLNLTGPLVAPGDGK
                     RAQLLPCRDHGADGGGRRREGAKLVSSTARIKVIQTIDFTNHQVCSIGDKAKEFK"
     misc_feature    <417985..>418056
                     /locus_tag="SMa0771"
                     /note="Cation transport ATPase [Inorganic ion transport
                     and metabolism]; Region: ZntA; COG2217"
                     /db_xref="CDD:225127"
     gene            418345..418896
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /db_xref="GeneID:1235451"
     CDS             418345..418896
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /function="Nodulation"
                     /codon_start=1
                     /transl_table=11
                     /product="NodL Nod factor acetyltransferase"
                     /protein_id="NP_435661.1"
                     /db_xref="GI:16262868"
                     /db_xref="GeneID:1235451"
                     /translation="MTRTQKEKMLAGEMYNAADPEIQADLLAAGAWLKRYNSTLGDSA
                     EQWHLFLREGLGEVGPGAVIRPPFHCDYGFNISIGAHAYMNFNCVILDVAKVTIGDGT
                     AIGPAVQIYTADHPDDPEQRQAGLQLGRPVRIGKHVWIGGGAIILPGVTIGDHAVVGA
                     GSVVTRDVPPGAKVMGSPARVRG"
     misc_feature    418354..418887
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /note="maltose O-acetyltransferase; Provisional; Region:
                     PRK10092"
                     /db_xref="CDD:182235"
     misc_feature    418384..418887
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /note="Maltose O-acetyltransferase (MAT) and Galactoside
                     O-acetyltransferase (GAT): MAT and GAT catalyze the
                     CoA-dependent acetylation of the 6-hydroxyl group of their
                     respective sugar substrates. MAT acetylates maltose and
                     glucose exclusively at the C6...; Region: LbH_MAT_GAT;
                     cd03357"
                     /db_xref="CDD:100047"
     misc_feature    order(418393..418395,418420..418422,418555..418557,
                     418591..418593,418597..418599,418615..418617,
                     418621..418623,418651..418653,418657..418659,
                     418675..418677,418681..418683,418687..418689,
                     418693..418695,418714..418719,418723..418725,
                     418759..418761,418765..418770,418783..418785,
                     418819..418824,418831..418833,418837..418842,
                     418867..418878,418882..418884)
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /note="active site"
                     /db_xref="CDD:100047"
     misc_feature    order(418393..418395,418420..418422,418555..418557,
                     418591..418593,418597..418599,418615..418617,
                     418621..418623,418651..418653,418681..418683,
                     418687..418689,418714..418719,418723..418725)
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:100047"
     misc_feature    order(418423..418425,418432..418434,418444..418446,
                     418465..418467,418543..418545,418549..418554,
                     418600..418605,418645..418647,418651..418653,
                     418663..418665,418669..418671,418675..418677,
                     418687..418689,418693..418701,418705..418710,
                     418726..418728,418732..418734,418753..418755,
                     418759..418761,418768..418776,418783..418785,
                     418807..418809,418813..418815,418822..418827,
                     418837..418839,418873..418875)
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:100047"
     misc_feature    order(418675..418677,418681..418683,418687..418689,
                     418693..418695,418759..418761,418765..418770,
                     418783..418785,418819..418824,418837..418842,
                     418867..418872,418876..418878)
                     /gene="nodL"
                     /locus_tag="SMa0772"
                     /note="CoA binding site [chemical binding]; other site"
                     /db_xref="CDD:100047"
     gene            419284..420714
                     /gene="noeA"
                     /locus_tag="SMa0773"
                     /db_xref="GeneID:1235452"
     CDS             419284..420714
                     /gene="noeA"
                     /locus_tag="SMa0773"
                     /function="Nodulation"
                     /note="Required for nodulation of Medicago littoralis"
                     /codon_start=1
                     /transl_table=11
                     /product="NoeA host specific nodulation protein"
                     /protein_id="NP_435662.1"
                     /db_xref="GI:16262869"
                     /db_xref="GeneID:1235452"
                     /translation="MARMADSKLVAAAPRPGRVAGSFRDPSGQVFHFQDRILRTMDSA
                     AAIEFASAERVMRQLVDEGRLVDFSDAEPSLHQLFQGSIARVLQHPLLEQITYPYEWS
                     FAGLKAAALFHLQLQLDLLDQGFCLSDATAYNVQFEGSRPTFIDHLSIKPYRDGQLWY
                     GHKQFCEQFLVPLLLRSVFDITHHSWYRGNLEGVPSADFVKLLSTRHWFSHKLFMHII
                     LPAKLQSSRTSQTKVDLGDSRARRLPKDAFRAMLAQLYSWISGLKVDVGKQSVWQGYA
                     ANNTYTATQRSDKGQYVAEFVAQHKPRTIIDLGCNTGDFSYVALENGAEKAIGFDFDP
                     HALDAAFDRSVQTSKNFLPLYLDARNPSPSQGWGERERQGFSSRFSADAVLALAFEHH
                     LAIAHNVPLAEVVAWVTQVAPKGIIEFVPKEDETVRRMLAGREDIFSDYNEEAFASAL
                     SQKARVVNKHLIPGSKRTLYTFERSE"
     misc_feature    419371..420708
                     /gene="noeA"
                     /locus_tag="SMa0773"
                     /note="Ribosomal protein L11 methylase [Translation,
                     ribosomal structure and biogenesis]; Region: PrmA;
                     COG2264"
                     /db_xref="CDD:225173"
     misc_feature    420193..>420303
                     /gene="noeA"
                     /locus_tag="SMa0773"
                     /note="S-adenosylmethionine-dependent methyltransferases
                     (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes
                     that use S-adenosyl-L-methionine (SAM or AdoMet) as a
                     substrate for methyltransfer, creating the product
                     S-adenosyl-L-homocysteine (AdoHcy); Region: AdoMet_MTases;
                     cd02440"
                     /db_xref="CDD:100107"
     misc_feature    order(420205..420225,420274..420279)
                     /gene="noeA"
                     /locus_tag="SMa0773"
                     /note="S-adenosylmethionine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:100107"
     gene            420721..422382
                     /gene="noeB"
                     /locus_tag="SMa0774"
                     /db_xref="GeneID:1235453"
     CDS             420721..422382
                     /gene="noeB"
                     /locus_tag="SMa0774"
                     /function="Nodulation"
                     /note="Required for host specific nodulation of Medicago
                     littoralis"
                     /codon_start=1
                     /transl_table=11
                     /product="NoeB host specific nodulation protein"
                     /protein_id="NP_435663.1"
                     /db_xref="GI:16262870"
                     /db_xref="GeneID:1235453"
                     /translation="MKRIVLLLSPLVILLSPIIDAFQGVYIDPRSDAGYAVIACVAII
                     GLALGMIATFCYKRGAVGNVVTAGTLAVTLFLFGDLSYGVFWRLADHIGMEGAAALAF
                     AGLVVLILILFKLMAAVPRMMAAFAVALLGSTVLDRGLITEASAEEPAPAVIYIVTDE
                     MIGISGIDTRLPHGAEAKAALSRVFQKHGFRLHSKAFSRHILTQVSVPAALNMDYSYN
                     FPGDRSHYAYPGEVTKFKVLSLFNLWHRQGLSVNVFQSAHLDFCKTEALVDCHTFASF
                     DGSRFIQRQRTEGGPYRDVPPASASLADVKALVEGNRQSLAMAAVGFVASNLLETKET
                     ALQEWHPRSYDQLAFPYWLGQFQNMILDKGRGNAFFAHFLFPHSPSVYNKDCKPTNRW
                     VERSYLTEVRGLAGQELDEARVKEYGFYFAQTLCLAKQLDKFFNAVLSDKRFQDATIV
                     VHGDHGSRISAGRNVETMSPRDYVDNYSALYAVRKPGVATGTDYKLHSVQWLNASLFR
                     GNVSEVAPTVVGSIQGKSDDPAVYAPITDPDHVAIMPMHDFDASH"
     gene            complement(422708..423034)
                     /locus_tag="SMa0775"
                     /db_xref="GeneID:1235454"
     CDS             complement(422708..423034)
                     /locus_tag="SMa0775"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435664.1"
                     /db_xref="GI:16262871"
                     /db_xref="GeneID:1235454"
                     /translation="MLLSEVLLVRSEHVVSSAHDVFERIVESLDPLAGGRTPSFAEEK
                     MPNETQSASVPGNTTLSGLIISVPETAGGPFPPLPLENKGEFVDVDSCAVERTVATQT
                     CFSLLR"
     repeat_region   complement(423316..424975)
                     /standard_name="ISRm23 fragment"
                     /note="Sma4004; 96% identical over length to ISRm23 of S.
                     meliloti pSyma"
                     /rpt_family="ISRm23 fragment"
     gene            complement(423440..424177)
                     /locus_tag="SMa0776"
                     /db_xref="GeneID:1235455"
     CDS             complement(423440..424177)
                     /locus_tag="SMa0776"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /note="glimmer prediction; similarity to IstB-like ATP
                     binding protein; identical to Sma1073"
                     /codon_start=1
                     /transl_table=11
                     /product="TRm23b IS ATP-binding protein"
                     /protein_id="NP_435665.1"
                     /db_xref="GI:16262872"
                     /db_xref="GeneID:1235455"
                     /translation="MLAHPTLDKLNAMGLAGMAKAFGELVANGEAEHLSHAEWLGLLL
                     EREWSSRYDRKLAARLRFAKLRHQATPEDVDYRADRGLDRALFMKLLGGDWINAHDNL
                     AICGPSGVGKSWLACALGHKACRDDRSVLYQRVPRLFAQLALARGDGRYARLQRTLGH
                     VQLLILDDWGLEPLNEQARHDLLEILEDRYGRRSTIITSQLPVSAWHSVIGDPTYADA
                     ILDRLVHNAHRVELSGDSLRRNLPRKA"
     misc_feature    complement(423446..424177)
                     /locus_tag="SMa0776"
                     /note="DNA replication protein [DNA replication,
                     recombination, and repair]; Region: DnaC; COG1484"
                     /db_xref="CDD:224401"
     misc_feature    complement(424022..424108)
                     /locus_tag="SMa0776"
                     /note="IstB-like ATP binding N-terminal; Region:
                     IstB_IS21_ATP; pfam08483"
                     /db_xref="CDD:117060"
     misc_feature    complement(423572..423937)
                     /locus_tag="SMa0776"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(423839..423862)
                     /locus_tag="SMa0776"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(423578..423580,423677..423679,
                     423836..423859))
                     /locus_tag="SMa0776"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(423674..423691)
                     /locus_tag="SMa0776"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     gene            complement(424190..425086)
                     /locus_tag="SMa0779"
                     /db_xref="GeneID:1235456"
     CDS             complement(424190..425086)
                     /locus_tag="SMa0779"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; similarity to  transposases;
                     local identity to SMA1070"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435666.1"
                     /db_xref="GI:16262873"
                     /db_xref="GeneID:1235456"
                     /translation="MACRQNEALSAPRMERVRNLKLYAGLSVSTNCSPGLERRRKWKL
                     RFVSSNVGCWAGCAIAHSIVWPRSMRRLANCSMISMISAFCAVSAPPAANCSRSLIVR
                     PLRPLPVERYVFAEWRIRRAGLDYHVEIERHYYSVPYRFAREQVEARITANTIEIFHK
                     GERIAAHRRSSGNGKHTTIPDHMPSAHRRFADWTIERIEREASAMGPDVALLCERILA
                     DRPHPEQGFRACLGIIRLNKSFGRDRVNAACGRALEIGARTYGSVRSILDNHLDRTAA
                     SNGAAPHEPIHHANIRGPRYYH"
     misc_feature    complement(424193..425059)
                     /locus_tag="SMa0779"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     gene            424904..425281
                     /locus_tag="SMa5028"
                     /db_xref="GeneID:6435267"
     CDS             424904..425281
                     /locus_tag="SMa5028"
                     /note="Has similarity to hypothetical proteins from
                     Rhizobium sp; NGR234 plasmid pNGR234a and partial
                     similarity to ISRm30 transposase of S; meliloti; Possible
                     truncated ORF"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_002000345.1"
                     /db_xref="GI:193782604"
                     /db_xref="GeneID:6435267"
                     /translation="MCDGAAGPTANVRRYEPQLPLSPSFKSRTAVRTDAQARIEFEVT
                     HPFHPWRGQRFVLSTRQQNWGEDRVMFYDAQGRLRSLPASWTDVNEADLFSQVAAGRS
                     FSRPDDLSALASLIDRIKRRQEE"
     repeat_region   424972..428289
                     /standard_name="ISRm30"
                     /note="SMa4015; nucleotide sequence is 99% identical to a
                     region on the S. meliloti chromosome (SMc04870)"
                     /rpt_family="ISRm30"
     gene            425462..425911
                     /locus_tag="SMa0781"
                     /db_xref="GeneID:1235457"
     CDS             425462..425911
                     /locus_tag="SMa0781"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; similar to hypothetical 16.8
                     kDa protein Y4OM from NGR234. Identical to S. meliloti
                     chromosomal protein Smc02302"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435667.1"
                     /db_xref="GI:16262874"
                     /db_xref="GeneID:1235457"
                     /translation="MTKEGKPDRLRQMGALNPKPEGVRAPWFREAGFFDPLDLVQVKY
                     EMLRHAREEGTNKADAAALFGLSRQTYYQAEAAFERDGMSGLLPRTRGPKSAHKLTGE
                     VMRLVEEHLDANGQLQARSLADLVHARLGISVHPRSIERAVARKKKR"
     misc_feature    425588..425743
                     /locus_tag="SMa0781"
                     /note="Helix-turn-helix domain; Region: HTH_28; pfam13518"
                     /db_xref="CDD:257838"
     misc_feature    425594..425896
                     /locus_tag="SMa0781"
                     /note="Winged helix-turn helix; Region: HTH_29; pfam13551"
                     /db_xref="CDD:257869"
     gene            425934..426203
                     /locus_tag="SMa0783"
                     /db_xref="GeneID:1235458"
     CDS             425934..426203
                     /locus_tag="SMa0783"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; similar to hypothetical 9.6 kDa
                     protein Y40L from NGR234"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435668.1"
                     /db_xref="GI:16262875"
                     /db_xref="GeneID:1235458"
                     /translation="MSESGKDVYEALRADVICGTACARRMGAIVFHGLWRGLAVLIAP
                     HQSAVARQQSAPRFKTTSMVAHDRQLVHMLANMVLAAETGGSHVY"
     gene            426193..428277
                     /locus_tag="SMa0785"
                     /db_xref="GeneID:1235459"
     CDS             426193..428277
                     /locus_tag="SMa0785"
                     /function="Elements of external origin; Phage-related
                     functions and prophages"
                     /note="glimmer prediction; very similar to hypothetical
                     78.7 kDa protein Y4BA/Y4PH of NGR234; local similarity to
                     IS-like sequences"
                     /codon_start=1
                     /transl_table=11
                     /product="Recombinase"
                     /protein_id="NP_435669.1"
                     /db_xref="GI:16262876"
                     /db_xref="GeneID:1235459"
                     /translation="MSTDNAMKISADHLRRDAFLYVRQSSLRQVFENTESTKRQYALR
                     DRAVALGWPIERVHVIDNDLGLSGAQSQDRDGFQRLVTEVAMGHAGIVLGLEVSRLAR
                     NNADWHRLLELAAMSRTLIMDEDGVYDAASFNDRMLLGLKGTMSEAELHILKSRLQGG
                     ILNKARRGELELPLPIGLVYTPDMRVVLDPDRQIQDTVRMLFDTFREVGSACAVVRRL
                     RSEKILFPRRIRRGIGKGDVLWSEIDHSRVIQILHNPRYAGAFAYGRTRTIYNAKLKS
                     VQQKMPRSDWQVLIPQAHEGYISWDEFERNQTSLEQNAVGFSPGLRGRMPRQGNGLLQ
                     GRVLCGRCGARMRVHYEQFEGNLRPYYICNEAVVRHAGKACQWARGPAIDEAVSALLL
                     EAMAPTAIEVALAVQEEISQRVEQAASLRDKQLQRARYEAELARRRYLKVDPDNRLVA
                     DALEADWNGKLRDLDTLQREHERRNETDQSLLDGAMQERIRALAADFPGIWNNERTSP
                     VERKRMLGLLIEDVTLLVDEQINMHIRWRGGRTQSLAVARPRPMAVIRKTPEAVVALI
                     NELLETDNDQQIASRLNALGHRNWRGEAFTLKKVMLVRRAYGLKTRFERLRESGMLTG
                     EEVARRFGVSATTVHQLGRDGVLKRHRYATNHRYLYEPPGNVRLAKGVGGRYGSRKPR
                     LIDAQPIQQGAS"
     misc_feature    426238..426951
                     /locus_tag="SMa0785"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    426250..426672
                     /locus_tag="SMa0785"
                     /note="Serine Recombinase family, catalytic domain; a DNA
                     binding domain may be present either N- or C-terminal to
                     the catalytic domain. These enzymes perform site-specific
                     recombination of DNA molecules by a concerted, four-strand
                     cleavage and rejoining...; Region: Ser_Recombinase;
                     cd00338"
                     /db_xref="CDD:238206"
     misc_feature    order(426259..426261,426265..426267,426484..426489,
                     426496..426498)
                     /locus_tag="SMa0785"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:238206"
     misc_feature    426265..426267
                     /locus_tag="SMa0785"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:238206"
     misc_feature    426781..427131
                     /locus_tag="SMa0785"
                     /note="Recombinase; Region: Recombinase; pfam07508"
                     /db_xref="CDD:254248"
     misc_feature    427186..427368
                     /locus_tag="SMa0785"
                     /note="Recombinase zinc beta ribbon domain; Region:
                     Zn_ribbon_recom; pfam13408"
                     /db_xref="CDD:257733"
     misc_feature    427333..>427506
                     /locus_tag="SMa0785"
                     /note="GrpE is the adenine nucleotide exchange factor of
                     DnaK (Hsp70)-type ATPases. The GrpE dimer binds to the
                     ATPase domain of Hsp70 catalyzing the dissociation of ADP,
                     which enables rebinding of ATP, one step in the Hsp70
                     reaction cycle in protein folding; Region: GrpE; cl03075"
                     /db_xref="CDD:261574"
     gene            complement(428239..429057)
                     /locus_tag="SMa0787"
                     /db_xref="GeneID:1235460"
     CDS             complement(428239..429057)
                     /locus_tag="SMa0787"
                     /function="Elements of external origin; Transposon-related
                     functions"
                     /note="glimmer prediction; Integrase core domain
                     similarity; identical to N-terminus of SMA1070"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase, fragment"
                     /protein_id="NP_435670.1"
                     /db_xref="GI:16262877"
                     /db_xref="GeneID:1235460"
                     /translation="MPAERLEMRRVREILRYRFEQGLGHKSIAVRVGAAPSTVRETLR
                     RAAIAELSWPLGDDVSDAVLEAALYKAAGTKTGHRRSPEPDWTQVHRELKRKHMTLQI
                     LWDEYISRYPEGYRYSRFCDLYRGWAMKLPVTMRQDHAAGDKLFVDYAGDTVTVVVDR
                     LSGKTRQAHLFVAVLGASSLSYAQARWSETLPDWIECHILALEFFGGAPALLVPDNAK
                     VAIIKACHFDPQVNRTYCGMAAHYGSAVLPTRPRRPRDKEQTSRCTLLDWLSVN"
     misc_feature    complement(428920..>429033)
                     /locus_tag="SMa0787"
                     /note="Sigma70, region (SR) 4 refers to the most
                     C-terminal of four conserved domains found in Escherichia
                     coli (Ec) sigma70, the main housekeeping sigma, and
                     related sigma-factors (SFs). A SF is a dissociable subunit
                     of RNA polymerase, it directs bacterial or...; Region:
                     Sigma70_r4; cl17257"
                     /db_xref="CDD:266592"
     misc_feature    complement(order(428923..428928,428932..428940,
                     428944..428949,428953..428955,428983..428988,
                     429004..429006))
                     /locus_tag="SMa0787"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:100119"
     misc_feature    complement(428245..428967)
                     /locus_tag="SMa0787"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    complement(428287..428649)
                     /locus_tag="SMa0787"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     repeat_region   complement(428282..429227)
                     /standard_name="ISRm23 fragment"
                     /note="Sma4005; 98% identical over length to ISRm23 of S.
                     meliloti pSyma"
                     /rpt_family="ISRm23 fragment"
     gene            429441..430136
                     /locus_tag="SMa0789"
                     /db_xref="GeneID:1235461"
     CDS             429441..430136
                     /locus_tag="SMa0789"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="GntR family transcriptional regulator"
                     /protein_id="NP_435671.2"
                     /db_xref="GI:193782605"
                     /db_xref="GeneID:1235461"
                     /translation="MNDALAGNAIRVERPTKTLRELALDKVRDAIVDGYFRPGDRLVE
                     RDLCAQLGVSRTIVREVLRHLESEGLVANLPNKGPIVARLDLNEAKQIYEIRGALEGM
                     AARLCAERNDSTIVAALEASLEGIRQSYAAKDMPAVLNHTSAFYQTLFTKVDRHVAWG
                     VVSLLTVRINHLRSMTIKTRNRDVEGPAQMEKIVEAIRKGDGEAAYKAALDHVARASV
                     IAEAVLSAQQTGD"
     misc_feature    429471..430124
                     /locus_tag="SMa0789"
                     /note="Transcriptional regulators [Transcription]; Region:
                     FadR; COG2186"
                     /db_xref="CDD:225097"
     misc_feature    429492..429686
                     /locus_tag="SMa0789"
                     /note="Winged helix-turn-helix (WHTH) DNA-binding domain
                     of the GntR family of transcriptional regulators; Region:
                     WHTH_GntR; cd07377"
                     /db_xref="CDD:153418"
     misc_feature    order(429492..429494,429498..429500,429567..429569,
                     429570..429575,429597..429611,429615..429620,
                     429627..429629,429657..429662,429666..429677)
                     /locus_tag="SMa0789"
                     /note="DNA-binding site [nucleotide binding]; DNA binding
                     site"
                     /db_xref="CDD:153418"
     misc_feature    429711..430085
                     /locus_tag="SMa0789"
                     /note="FCD domain; Region: FCD; pfam07729"
                     /db_xref="CDD:254389"
     gene            430599..431201
                     /locus_tag="SMa0791"
                     /db_xref="GeneID:1235463"
     CDS             430599..431201
                     /locus_tag="SMa0791"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435673.1"
                     /db_xref="GI:16262880"
                     /db_xref="GeneID:1235463"
                     /translation="MPVQIRKTLLQMETTLIEGGKAAPRPLKLFSAVAVVKNPWAGHG
                     FVEDLRPEIHRAAPVLGELLTRMIIDAVGSAEAVEAYGKAAVVGIDGEIEHASALIHT
                     LRFGNHYRQAVGAKSYLAFCNTRGPANAPIMIPLMDKNDEGRRSHYLTIQTAVPDAPA
                     ADEIVVALGASTGGRPHHRIGDRYEDLKELGQDVTNPAGV"
     misc_feature    430611..431141
                     /locus_tag="SMa0791"
                     /note="Amino acid synthesis; Region: AA_synth; pfam06684"
                     /db_xref="CDD:253859"
     gene            431220..432053
                     /locus_tag="SMa0792"
                     /db_xref="GeneID:1235464"
     CDS             431220..432053
                     /locus_tag="SMa0792"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; alpha/beta hydrolase fold
                     similarity"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435674.1"
                     /db_xref="GI:16262881"
                     /db_xref="GeneID:1235464"
                     /translation="MQTVTSHTSGEGGASLPRKTTARGTAYFEAGNGETLILIHGVGM
                     RLEAWAPQIEAFAKTHRVFALDMPGHGASEKIPAGSTVRDYVAWFGCFLEDLSIARAS
                     IAGHSMGALISGGAVATFSDRITRVAYLNGVYRRDAAAKAAVLARAEAIRKNGVDAEG
                     PLERWFGEDPESQRARELTRTWLEMVDPEGYAIAYAAFAGGDEIYADCWPSVECPALF
                     LTGSGDPNSTPEMAKQMASVTPKGWARIVDGHRHMVNLTAPEIVNALMSEWLTSREKP
                     R"
     misc_feature    431325..432014
                     /locus_tag="SMa0792"
                     /note="Alpha/beta hydrolase family; Region: Abhydrolase_6;
                     pfam12697"
                     /db_xref="CDD:257231"
     misc_feature    431325..432005
                     /locus_tag="SMa0792"
                     /note="Putative lysophospholipase; Region: Hydrolase_4;
                     cl19140"
                     /db_xref="CDD:267493"
     gene            432050..432985
                     /locus_tag="SMa0793"
                     /db_xref="GeneID:1235465"
     CDS             432050..432985
                     /locus_tag="SMa0793"
                     /function="Miscellaneous; Hypothetical/Partial homology"
                     /note="glimmer prediction; Flavin reductase like domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435675.2"
                     /db_xref="GI:193782606"
                     /db_xref="GeneID:1235465"
                     /translation="MTAEVFDPRALRDAFGAFATGVTVVTASDAAGKPIGFTANSFTS
                     VSLDPPLLLVCLAKSSRNYESMTSAGRFAINVLSETQKDVSNTFARPVEDRFAAVDWR
                     LGRDGCPIFSDVAAWFECSMQDIIEAGDHVIIIGRVTAFENSGLNGLGYARGGYFTPR
                     LAGKAVSAAVEGEIRLGAVLEQQGAVFLAGNETLSLPNCTVEGGDPARTLAAYLEQLT
                     GLNVTIGFLYSVYEDKSDGRQNIVYHALASDGAPRQGRFLRPAELAAAKFSSSATADI
                     INRFVLESSIGNFGIYFGDETGGTVHPIANKDAHS"
     misc_feature    432092..432517
                     /locus_tag="SMa0793"
                     /note="Flavin reductase like domain; Region:
                     Flavin_Reduct; smart00903"
                     /db_xref="CDD:214900"
     gene            432982..434022
                     /locus_tag="SMa0794"
                     /db_xref="GeneID:1235466"
     CDS             432982..434022
                     /locus_tag="SMa0794"
                     /function="Miscellaneous; Hypothetical/Global homology"
                     /note="glimmer prediction; bacterial luciferase
                     similarity"
                     /codon_start=1
                     /transl_table=11
                     /product="Monoxygenase"
                     /protein_id="NP_435676.1"
                     /db_xref="GI:16262883"
                     /db_xref="GeneID:1235466"
                     /translation="MKFSLFVHMERLDASQDHKTLYEEFIKLCEIADKGGMHAIWTGE
                     HHGMEFTIAPNPFVTIADLARRTKTARLGTGTVIAPFWHPIKLAGEAAMTDLICEGRL
                     DIGIARGAYSFEYERLLPGLDAWSAGQRMRELIPAVKGIWAGDYAHDGEFFKFPATTS
                     SPKPLQKPHPPIWVAARDPNSHEFAVANGCNVQVTPLWQDDEEVRSLMARFNDACAKD
                     PEVPRPKIMLLRHTYVGSDEADIAQAAHEMSVYYNYFFAWFKNERPIRQGLIDRIPEE
                     EIAANAMLSGEAMRRNNVVGAADEVIARIKSYEAMGYDEYSFWIDTGMTFERKKASLE
                     RFIADVMPAFAE"
     misc_feature    433015..434019
                     /locus_tag="SMa0794"
                     /note="Coenzyme F420-dependent N5,N10-methylene
                     tetrahydromethanopterin reductase and related
                     flavin-dependent oxidoreductases [Energy production and
                     conversion]; Region: COG2141"
                     /db_xref="CDD:225052"
     gene            434028..435491
                     /locus_tag="SMa0796"
                     /db_xref="GeneID:1235467"
     CDS             434028..435491
                     /locus_tag="SMa0796"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435677.1"
                     /db_xref="GI:16262884"
                     /db_xref="GeneID:1235467"
                     /translation="MQRFQCYINGEFADGEARFESIDPTTGRAWAEMPEAREADVNRA
                     VEAARIALHDQPWSTLTATQRGKLLYKLADLVAENAGRLAELETRDTGKIIRETSSQI
                     AYVADYYRYYAGIADKIEGSYLPIDKPDMDVWLRREPIGVVAMVVPWNSQLFLSAVKI
                     GPALAAGCTMVVKASEDGPAPLLEFARLVHAAGFPAGVVNIVTGFGPSCGAALSRHPQ
                     VDHIAFTGGPETARHIVRNSAENLASTSLELGGKSPFIVFADADLESAANAQIAGIFA
                     ATGQSCVAGSRLIVEKSVKDRFLQILKAKAETIRIGSPLEMSTEVGPLATERQSNHVK
                     TLVARSLAAGAKLVTGGTAPEGAGFYYRPTILDCDGSASPSLENEFFGPVLSVLSFET
                     EAEALHLANDSRFGLAAGVFTQNLTRAHRLMKGIRAGIVWVNTYRAVSPVAPFGGFGL
                     SGHGREGGLEAALDYTRSKTVWLRTSDDPIPDPFVMR"
     misc_feature    434088..435446
                     /locus_tag="SMa0796"
                     /note="Uncharacterized Candidatus pelagibacter aldehyde
                     dehydrogenase, DhaS-like; Region: ALDH_DhaS; cd07114"
                     /db_xref="CDD:143432"
     misc_feature    order(434463..434477,434499..434501,434544..434546,
                     434550..434555,434697..434708,434715..434717,
                     434724..434729,434769..434777,434871..434873,
                     435162..435164,435168..435170,435246..435248,
                     435360..435362)
                     /locus_tag="SMa0796"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143432"
     misc_feature    order(434475..434477,434769..434771,434862..434864,
                     434871..434873)
                     /locus_tag="SMa0796"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143432"
     gene            435497..435823
                     /locus_tag="SMa0797"
                     /db_xref="GeneID:1235468"
     CDS             435497..435823
                     /locus_tag="SMa0797"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction; trimmed three residues to give
                     better Shine- Dalgarno and initiating Met; similarity to
                     4-nitrophenylphosphatase domain"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435678.1"
                     /db_xref="GI:16262885"
                     /db_xref="GeneID:1235468"
                     /translation="MFYEIRTYRLRNGAIPTYLKVVEEEGIAIQRKHLGELVGYFFSE
                     IGPINEIVHIWAYPSLDERERRRAALMNDAAWRDFLPKVRDLIEVAENKIMKAARFSP
                     TGAVAS"
     misc_feature    435503..435802
                     /locus_tag="SMa0797"
                     /note="NIPSNAP; Region: NIPSNAP; pfam07978"
                     /db_xref="CDD:254560"
     gene            435861..436871
                     /locus_tag="SMa0799"
                     /db_xref="GeneID:1235469"
     CDS             435861..436871
                     /locus_tag="SMa0799"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; similarity to bacterial
                     extracellular solute-binding proteins"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter substrate-binding protein"
                     /protein_id="NP_435679.2"
                     /db_xref="GI:193782607"
                     /db_xref="GeneID:1235469"
                     /translation="MNRIFVLAATAATIATAMPATAADLVFTSWGGTTQDAQKIAWAE
                     KFTEKTGINVLQDGPTDYGKLKAMVEANAVTWDVVDVEGDYAAQAGKKGLLEKLDFSV
                     IDKSKLDPRFVTDYSVGSFYYSFVIGCNKDAVDACPKTWADLFDAQKFPGMRAFYKWS
                     APGVIEAALLADGVSPDKLYPLDLDRAFKKLDTIKSDIIWWSGGAQSQQLLASAEAPF
                     GSVWNGRMTALAQSGINVETSWEQNITAADALVVPKGSRNKEAAMQFIALATSPEAQA
                     DLAKITGYAPINLDSPKMMDPELANTLPDAQTASQVNADMNYWAENRDAIGERWYAWQ
                     AK"
     misc_feature    435930..436862
                     /locus_tag="SMa0799"
                     /note="Spermidine/putrescine-binding periplasmic protein
                     [Amino acid transport and metabolism]; Region: PotD;
                     COG0687"
                     /db_xref="CDD:223759"
     gene            436964..437839
                     /locus_tag="SMa0800"
                     /db_xref="GeneID:1235470"
     CDS             436964..437839
                     /locus_tag="SMa0800"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; similarity to
                     spermidine/putrescine ABC transporter permease (potB)"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435680.1"
                     /db_xref="GI:16262887"
                     /db_xref="GeneID:1235470"
                     /translation="MVSQTETGSGRPYSPAQVRRLTDFDLTLPALGLLILFFVLPVAM
                     LLTRSVTEPVPGLGNYAELLGSSTYLRIFANTFIVSSLVTLVSLLIGFPVAWALAIMP
                     SRAASIVFAILLLSMWTNLLARTYAWMVLLQRTGVINKMLLGMGLIDTPLPLVNNLTG
                     VTIGMTYIMLPFIILPLYGVIRKIDPAILQAAALCGANRWQSLVRVLLPLAMPGMAAG
                     ALMVFVMSLGYFVTPALLGGTSNMMLAELIAQFVQSLVNWGMGGAAALVLLVVTLALY
                     AVQLRFFGTNRIGGR"
     misc_feature    437180..437746
                     /locus_tag="SMa0800"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(437228..437233,437240..437245,437258..437260,
                     437288..437299,437303..437332,437339..437344,
                     437348..437350,437459..437464,437468..437470,
                     437477..437479,437486..437491,437495..437497,
                     437507..437512,437519..437521,437570..437572,
                     437612..437617,437624..437626,437645..437656,
                     437663..437668,437705..437710,437738..437743)
                     /locus_tag="SMa0800"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(437306..437350,437645..437662)
                     /locus_tag="SMa0800"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(437348..437350,437444..437446,437663..437665,
                     437699..437701,437708..437710,437738..437740)
                     /locus_tag="SMa0800"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(437522..437560,437576..437581,437591..437593)
                     /locus_tag="SMa0800"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            437841..438641
                     /locus_tag="SMa0802"
                     /db_xref="GeneID:1235471"
     CDS             437841..438641
                     /locus_tag="SMa0802"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; similarity to
                     spermidine/putrescine transport system permease potC"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter permease"
                     /protein_id="NP_435681.1"
                     /db_xref="GI:16262888"
                     /db_xref="GeneID:1235471"
                     /translation="MLLNFDRLGWWKLVLIGITLLTTAFLLLPILFIAVLSFGSSQWL
                     IFPPPGWTLRWYQELLEDPRWLDSAWTSFRIAIIVTVLSVLLGLVTSFGLNRGRFLFR
                     EALKALFLTPMILPVVVLAVALYAFFLQIGLNGTLTGFVISHLVLALPFSILSITNAL
                     EGFDKSIEDAAVLCGASPFEAKIRVTLPAISHGVFSAAIFSFLTSWDEVVVAIFMASP
                     TLQTLPVKVWSTLRQDLTPVVAAASTLLILLTVLLMVLVAIVRKGLKS"
     misc_feature    437859..438572
                     /locus_tag="SMa0802"
                     /note="ABC-type spermidine/putrescine transport system,
                     permease component II [Amino acid transport and
                     metabolism]; Region: PotC; COG1177"
                     /db_xref="CDD:224098"
     misc_feature    438045..438566
                     /locus_tag="SMa0802"
                     /note="Transmembrane subunit (TM) found in Periplasmic
                     Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC)
                     transporters which generally bind type 2 PBPs. These types
                     of transporters consist of a PBP, two TMs, and two
                     cytoplasmic ABC ATPase subunits, and...; Region: TM_PBP2;
                     cd06261"
                     /db_xref="CDD:119394"
     misc_feature    order(438093..438098,438105..438110,438123..438125,
                     438153..438164,438168..438197,438204..438209,
                     438213..438215,438291..438293,438300..438305,
                     438309..438311,438321..438326,438333..438335,
                     438384..438386,438426..438431,438438..438440,
                     438459..438470,438477..438482,438519..438524,
                     438552..438557,438564..438566)
                     /locus_tag="SMa0802"
                     /note="dimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(438171..438215,438459..438476)
                     /locus_tag="SMa0802"
                     /note="conserved gate region; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(438213..438215,438273..438275,438477..438479,
                     438513..438515,438522..438524,438552..438554)
                     /locus_tag="SMa0802"
                     /note="putative PBP binding loops; other site"
                     /db_xref="CDD:119394"
     misc_feature    order(438336..438374,438390..438395,438405..438407)
                     /locus_tag="SMa0802"
                     /note="ABC-ATPase subunit interface; other site"
                     /db_xref="CDD:119394"
     gene            438638..439717
                     /locus_tag="SMa0803"
                     /db_xref="GeneID:1235472"
     CDS             438638..439717
                     /locus_tag="SMa0803"
                     /function="Cell processes; Transport of small molecules"
                     /note="glimmer prediction; conserved hypothetical
                     ABC-transporter ATP-binding protein"
                     /codon_start=1
                     /transl_table=11
                     /product="ABC transporter ATP-binding protein"
                     /protein_id="NP_435682.1"
                     /db_xref="GI:16262889"
                     /db_xref="GeneID:1235472"
                     /translation="MNRPFLQIRGIRKEYGPVTAVQDVTLDVAQGEFLTFLGPSGSGK
                     STTLYILAGFENPTRGDILLNGETLLATPSHKRNIGMVFQRYTLFPHLSVGENIAFPL
                     KVRRLPKAEIDAKVRAMLKLVRLEGFEDRKPAQMSGGQQQRVALARALAYDPPVLLMD
                     EPLSALDKKLREEIQHEIRRIHQQTEVTILYVTHDQEEALRLSDRIAVFSKGVIDQIG
                     TGPELYANPATRFVAEFIGDSDFLPCDVVSTVNGRAEIAVCGSMTFSNIPLHGTASLG
                     SKAALMLRPERLLLSKTKSDIGLPVTVSDITFLGNNVHVATKTRKGNDLSVRLPFGHE
                     AISGLNRGDAVWLRFDAGSAHVFGQ"
     misc_feature    438638..439708
                     /locus_tag="SMa0803"
                     /note="ABC-type spermidine/putrescine transport systems,
                     ATPase components [Amino acid transport and metabolism];
                     Region: PotA; COG3842"
                     /db_xref="CDD:226361"
     misc_feature    438653..439348
                     /locus_tag="SMa0803"
                     /note="ATP-binding cassette transporter nucleotide-binding
                     domain; Region: ABC_ATPase; cl17201"
                     /db_xref="CDD:266551"
     misc_feature    438749..438772
                     /locus_tag="SMa0803"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    order(438758..438763,438767..438775,438887..438889,
                     439115..439120,439217..439219)
                     /locus_tag="SMa0803"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:213179"
     misc_feature    438878..438889
                     /locus_tag="SMa0803"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213179"
     misc_feature    439043..439072
                     /locus_tag="SMa0803"
                     /note="ABC transporter signature motif; other site"
                     /db_xref="CDD:213179"
     misc_feature    439103..439120
                     /locus_tag="SMa0803"
                     /note="Walker B; other site"
                     /db_xref="CDD:213179"
     misc_feature    439127..439138
                     /locus_tag="SMa0803"
                     /note="D-loop; other site"
                     /db_xref="CDD:213179"
     misc_feature    439205..439225
                     /locus_tag="SMa0803"
                     /note="H-loop/switch region; other site"
                     /db_xref="CDD:213179"
     misc_feature    439478..439708
                     /locus_tag="SMa0803"
                     /note="TOBE domain; Region: TOBE_2; pfam08402"
                     /db_xref="CDD:254779"
     gene            439799..441271
                     /gene="gabD4"
                     /locus_tag="SMa0805"
                     /db_xref="GeneID:1235473"
     CDS             439799..441271
                     /gene="gabD4"
                     /locus_tag="SMa0805"
                     /EC_number="1.2.1.16"
                     /function="Small molecule metabolism"
                     /codon_start=1
                     /transl_table=11
                     /product="GabD4 succinate-semialdehyde dehdyrogenase"
                     /protein_id="NP_435683.1"
                     /db_xref="GI:16262890"
                     /db_xref="GeneID:1235473"
                     /translation="MTISETLLVKLKDPSLAVDKGLIGAEWLDRSDSGKTFDVSNPAT
                     GEVIAILPDMSRSETARAIDAAHAAQRAWAEKTGKERAAVLRNLYDLVVANADDLATI
                     LTMEMGKPLTEAKGEILYGASYVEWFGEEAKRVYGDTIPGHQPDKRIIVLKQPIGVVA
                     AITPWNFPNAMLARKLAPAAAAGCAVVSKPAAETPLSALALALLAERAGLPAGVFNVI
                     LSTDSAEVGKEMCANDKVRKLTFTGSTNVGKILMRQGADQIMKLGLELGGNAPFIVFD
                     DADLDAAVEGAMVAKYRNNGQTCVCANRIFVQAGIYDAFAARLTAKVSEMTIGDGFEP
                     DVDAGPLISEKALAKVEEHIRDAVTKGADLVLGGNARGGLFFEPTVLTGATMDMKIAG
                     EETFGPVAPLFKFETENEVVSMANKTEFGLASYFYSKDVSKVFRVAEALEYGMVGINT
                     GLISTEVAPFGGVKQSGQGREGSKYGIDDYVETKYLCLSI"
     misc_feature    439913..441262
                     /gene="gabD4"
                     /locus_tag="SMa0805"
                     /note="Mitochondrial succinate-semialdehyde dehydrogenase
                     and ALDH family members 5A1 and 5F1-like; Region:
                     ALDH_F5_SSADH_GabD; cd07103"
                     /db_xref="CDD:143421"
     misc_feature    order(440027..440029,440054..440056,440177..440179,
                     440186..440191,440195..440221,440237..440245,
                     440258..440260,440507..440509,440543..440545,
                     440555..440557,440564..440566,440735..440737,
                     440747..440749,440885..440887,441083..441085,
                     441089..441094,441104..441106,441110..441112,
                     441119..441121,441125..441145,441161..441163,
                     441170..441175,441191..441193,441206..441208,
                     441242..441262)
                     /gene="gabD4"
                     /locus_tag="SMa0805"
                     /note="tetramerization interface [polypeptide binding];
                     other site"
                     /db_xref="CDD:143421"
     misc_feature    order(440282..440296,440318..440320,440363..440365,
                     440369..440374,440519..440530,440537..440539,
                     440546..440551,440591..440599,440693..440695,
                     440978..440980,440984..440986,441062..441064,
                     441176..441178)
                     /gene="gabD4"
                     /locus_tag="SMa0805"
                     /note="NAD(P) binding site [chemical binding]; other site"
                     /db_xref="CDD:143421"
     misc_feature    order(440294..440296,440591..440593,440684..440686,
                     440693..440695)
                     /gene="gabD4"
                     /locus_tag="SMa0805"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:143421"
     gene            441631..442086
                     /gene="syrB3"
                     /locus_tag="SMa0806"
                     /db_xref="GeneID:1235474"
     CDS             441631..442086
                     /gene="syrB3"
                     /locus_tag="SMa0806"
                     /function="Miscellaneous; Not classified regulator"
                     /note="trimmed 44 amino acids from glimmer prediction to
                     give better Shine-Dalgarno and initiating Met and better
                     match to SyrB"
                     /codon_start=1
                     /transl_table=11
                     /product="SyrB-like regulator"
                     /protein_id="NP_435684.1"
                     /db_xref="GI:16262891"
                     /db_xref="GeneID:1235474"
                     /translation="MVDESNAGPVAPAVVADAEVKAPTGKKRSSSRPQKAPPEPAQPK
                     MPAAKRRGYSEQERSEKLRLIETKVSEGNTLKDAIKSAGISEQTYYHWKGAAKSAARE
                     DIERTRPLSAGDEFAELVQLEEENQRLRKQLAEKLRTENTELRKRLGLD"
     misc_feature    441775..442035
                     /gene="syrB3"
                     /locus_tag="SMa0806"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            442329..442967
                     /locus_tag="SMa0809"
                     /db_xref="GeneID:1235475"
     CDS             442329..442967
                     /locus_tag="SMa0809"
                     /function="Miscellaneous; Unknown"
                     /note="glimmer prediction;trimmed seven residues to give
                     better Shine- Dalgarno and initiating Met"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435685.2"
                     /db_xref="GI:193782608"
                     /db_xref="GeneID:1235475"
                     /translation="MKRPQQTFVVEKKTKRRQPNAQTKSIWGDTDLKALAREVEDMAS
                     LPFNSNEGRGTFGSRETRLVDPINAEPLNGRVEVALPEIQRANGTKVEISQHRVADTP
                     TEAVAQTKERHTPSQRLSTSGTARNRTKRLHDLKVGHEGRKAQTRTVDDPISLDELAA
                     LGADNKLLKRLLAELLLAQNLWLKKMLERFDAERDVAPLASGRKAREPEFRG"
     gene            complement(443587..443793)
                     /gene="fixU"
                     /locus_tag="SMa0810"
                     /db_xref="GeneID:1235476"
     CDS             complement(443587..443793)
                     /gene="fixU"
                     /locus_tag="SMa0810"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogen fixation protein FixU"
                     /protein_id="NP_435686.1"
                     /db_xref="GI:16262893"
                     /db_xref="GeneID:1235476"
                     /translation="MKVTIRITGDALSAYIPKKDLEEPIISVANEDLWGGSILLRNGW
                     RLALPHLPQDTRLPVTVEANIRRH"
     misc_feature    complement(443590..443793)
                     /gene="fixU"
                     /locus_tag="SMa0810"
                     /note="Nitrogen fixation protein [Secondary metabolites
                     biosynthesis, transport, and catabolism]; Region: NifU;
                     COG5554"
                     /db_xref="CDD:227841"
     gene            complement(443981..444175)
                     /gene="fdxN"
                     /locus_tag="SMa0811"
                     /db_xref="GeneID:1235477"
     CDS             complement(443981..444175)
                     /gene="fdxN"
                     /locus_tag="SMa0811"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="Similarity to 4Fe-4S binding domain"
                     /codon_start=1
                     /transl_table=11
                     /product="FdxN ferredoxin"
                     /protein_id="NP_435687.1"
                     /db_xref="GI:16262894"
                     /db_xref="GeneID:1235477"
                     /translation="MAFKIIASQCTQCGACEFECPRGAVNFKGEKYVIDPTKCNECKG
                     GFDTQQCASVCPVSNTCVPA"
     misc_feature    complement(<444008..>444172)
                     /gene="fdxN"
                     /locus_tag="SMa0811"
                     /note="The HCP family of iron-sulfur proteins includes
                     hybrid cluster protein (HCP), acetyl-CoA synthase (ACS),
                     and carbon monoxide dehydrogenase (CODH), all of which
                     contain [Fe4-S4] metal clusters at their active sites.
                     These proteins have a conserved...; Region: HCP_like;
                     cl19102"
                     /db_xref="CDD:267455"
     gene            complement(444206..445678)
                     /gene="nifB"
                     /locus_tag="SMa0814"
                     /db_xref="GeneID:1235478"
     CDS             complement(444206..445678)
                     /gene="nifB"
                     /locus_tag="SMa0814"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="trimmed 14 residues from glimmer prediction to give
                     better Shine-Dalgarno and initiating Met"
                     /codon_start=1
                     /transl_table=11
                     /product="NifB FeMo cofactor biosynthesis protein"
                     /protein_id="NP_435688.1"
                     /db_xref="GI:16262895"
                     /db_xref="GeneID:1235478"
                     /translation="MSTPMILRESRTSTTFSDQLLENAKSVGCSPPSTAPGDIDPGTW
                     DKIKNHPCFSEEAHHYFARMHVAVAPACNIQCNYCNRKYDCANESRPGVASEKLTPDQ
                     AVRKVIAVANEVPQLSVLGIAGPGDACYDWKKTRATFERVAREIPDIRLCISTNGLSL
                     PDHVDELAEMNVDHVTITINMVDPRVGVKIYPWIYYGQRRHTGIDAARILHERQMLGL
                     EMLAERGILTKVNSVMIPGVNDEHLIEVNKVVKGRGALLHNVMPLISNRIHGTYYGLT
                     GQRGPEAFELQALQDRLEGTKLMRHCRHCRADAIGLLGDDRGHEFTLAEIPDEITYDA
                     SKRQAYRQLVARERGDHLVAKNEANRTVMSVEYGGSLLIAVATKGGGRINEHFGHAKE
                     FHVYTVSQRGIKLAGRRRVEQYCLGGWGEVATLDHIVVALEGIDILLCVKIGDYPRKQ
                     LTQAGLRATEAYGHDYIESALGALYAAEFGIEPPVKTATA"
     misc_feature    complement(444248..445561)
                     /gene="nifB"
                     /locus_tag="SMa0814"
                     /note="nitrogenase cofactor biosynthesis protein NifB;
                     Region: nifB; TIGR01290"
                     /db_xref="CDD:233344"
     misc_feature    complement(<444938..445483)
                     /gene="nifB"
                     /locus_tag="SMa0814"
                     /note="Radical SAM superfamily. Enzymes of this family
                     generate radicals by combining a 4Fe-4S cluster and
                     S-adenosylmethionine (SAM) in close proximity. They are
                     characterized by a conserved CxxxCxxC motif, which
                     coordinates the conserved iron-sulfur cluster; Region:
                     Radical_SAM; cd01335"
                     /db_xref="CDD:100105"
     misc_feature    complement(order(444980..444982,445145..445147,
                     445211..445219,445298..445303,445319..445321,
                     445439..445447,445451..445453,445457..445459,
                     445463..445465))
                     /gene="nifB"
                     /locus_tag="SMa0814"
                     /note="FeS/SAM binding site; other site"
                     /db_xref="CDD:100105"
     misc_feature    complement(444254..444565)
                     /gene="nifB"
                     /locus_tag="SMa0814"
                     /note="NifB belongs to a family of iron-molybdenum
                     cluster-binding proteins that includes NifX, and NifY, all
                     of which are involved in the synthesis of an
                     iron-molybdenum cofactor (FeMo-co) that binds the active
                     site of the dinitrogenase enzyme as part of...; Region:
                     NifB; cd00852"
                     /db_xref="CDD:238432"
     gene            complement(445895..447520)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /db_xref="GeneID:1235479"
     CDS             complement(445895..447520)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="sigma54-dependent; Activator of nif operons"
                     /codon_start=1
                     /transl_table=11
                     /product="Fis family transcriptional regulator"
                     /protein_id="NP_435689.2"
                     /db_xref="GI:193782609"
                     /db_xref="GeneID:1235479"
                     /translation="MRKQDKRSAEIYSISKALMAPTRLETTLNNFVNTLSLILRMRRG
                     GLEIPASEGETKITAATRNSGSPSAADYTVPKAAIDQVMTAGRLVVPDVCNSELFKDQ
                     IKWRGIGPTAFIAAAVEVDHETGGMLWFECAEESDYDYEEEVHFLSMAANLAGRAIRL
                     HRTISRRERTFAEEQQEQQNSRDEQSQSSARQRLLKNDGIIGESTALMTAVDTAKVMA
                     ETNSIVLLRGETGTGKECFAKLIHQHSTRQKKPFIKFNCPALSESLLESELFGHEKGA
                     FTGAIAQRVGRFESANGGTLLLDEIGEIPPAFQAKLLRVIQEGEFERVGGTKTLKVDV
                     RLIFATNKDLEMAVQNGEFREDLYYRISGVPLILPPLRHRDGDIPLLARAFLQRFNEE
                     NGRDLHFAPSALDHLSKCKFPGNVRELENCVRRTATLARSKTITSSDFACQTDQCFSS
                     RLWKGVHCSHGHIEIDAPAGTTPLLGAPANDVPPKEPGSAGVASNLIERDRLISALEE
                     AGWNQAKAARILEKTPRQVGYALRRHGVDVRKL"
     misc_feature    complement(445898..447508)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="Nif-specific regulatory protein; Region: nifA;
                     TIGR01817"
                     /db_xref="CDD:233584"
     misc_feature    complement(447023..447454)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="Domain present in phytochromes and cGMP-specific
                     phosphodiesterases; Region: GAF; smart00065"
                     /db_xref="CDD:214500"
     misc_feature    complement(446435..446866)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(446816..446839)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(order(446498..446500,446624..446626,
                     446813..446836))
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(446621..446638)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(446441..446443)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="arginine finger; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(445919..446032)
                     /gene="nifA"
                     /locus_tag="SMa0815"
                     /note="Bacterial regulatory protein, Fis family; Region:
                     HTH_8; pfam02954"
                     /db_xref="CDD:251640"
     gene            complement(447740..448036)
                     /gene="fixX"
                     /locus_tag="SMa0816"
                     /db_xref="GeneID:1235480"
     CDS             complement(447740..448036)
                     /gene="fixX"
                     /locus_tag="SMa0816"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="Possible 3Fe-4S cluster-containing protein"
                     /codon_start=1
                     /transl_table=11
                     /product="FixX ferredoxin-like protein"
                     /protein_id="NP_435690.1"
                     /db_xref="GI:16262897"
                     /db_xref="GeneID:1235480"
                     /translation="MKTAIAERIEDKLYQNRYLVDAGRPHITVRPHRSPSLNLLALTR
                     VCPAKCYELNETGQVEVTADGCMECGTCRVLCEANGDVEWSYPRGGFGVLFKFG"
     misc_feature    complement(447743..448015)
                     /gene="fixX"
                     /locus_tag="SMa0816"
                     /note="Ferredoxin-like protein [Energy production and
                     conversion]; Region: FixX; COG2440"
                     /db_xref="CDD:225289"
     gene            complement(448049..449356)
                     /gene="fixC"
                     /locus_tag="SMa0817"
                     /db_xref="GeneID:1235481"
     CDS             complement(448049..449356)
                     /gene="fixC"
                     /locus_tag="SMa0817"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="trimmed five residues from glimmer prediction to
                     give better Shine-Dalgarno and initiating Met; probable
                     electron acceptor from FixAB"
                     /codon_start=1
                     /transl_table=11
                     /product="oxidoreductase FixC"
                     /protein_id="NP_435691.1"
                     /db_xref="GI:16262898"
                     /db_xref="GeneID:1235481"
                     /translation="MTKEKFDAIVVGAGMSGNAAAYAMASRGLKVLQLERGEYPGSKN
                     VQGAIMYANMLEAIIPDFRNDAPLERHLVEQRFWIMDDTSHTGMHYRSDDFNEVTPNR
                     YTIIRAQFDKWLSRKVCEAGGTVLCETTATGLEWDSAGKAIGVRTDRAGDVVLADVVV
                     LAEGVNGLLGTRAGLREMPKSKNVALAVKELHFLPEEVIAERFGLTGDEGCVIEAGGT
                     ISRGMAGLGFLYTNKESISLGIGCLISNFAETMERPYALLDAFKRHPSIQPLIAGSEV
                     KEYAAHLIPEGGFNAIPRLCGNGWVVVGDAAQLNNAVHREGSNLAMASGRMAGEAISI
                     IKSRGGVMDKASLSLYKTMLDKSFVVEDLSKQKDMPSLLHTNSPNFFTTYPQLISHAA
                     QNFVRVDGTPKIEREIATTAAFLRARSRWGLVSDAVRLASAWR"
     misc_feature    complement(448151..449356)
                     /gene="fixC"
                     /locus_tag="SMa0817"
                     /note="NAD(P)-binding Rossmann-like domain; Region:
                     NAD_binding_8; cl19134"
                     /db_xref="CDD:267487"
     misc_feature    complement(448055..449350)
                     /gene="fixC"
                     /locus_tag="SMa0817"
                     /note="Dehydrogenases (flavoproteins) [Energy production
                     and conversion]; Region: FixC; COG0644"
                     /db_xref="CDD:223717"
     gene            complement(449368..450429)
                     /gene="fixB"
                     /locus_tag="SMa0819"
                     /db_xref="GeneID:1235482"
     CDS             complement(449368..450429)
                     /gene="fixB"
                     /locus_tag="SMa0819"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="trimmed 17 residues from glimmer prediction to give
                     better Shine-Dalgarno and initiating Met; similarity to
                     electron transfer flavoprotein alpha subunits"
                     /codon_start=1
                     /transl_table=11
                     /product="FixB electron transfer flavoprotein alpha chain"
                     /protein_id="NP_435692.1"
                     /db_xref="GI:16262899"
                     /db_xref="GeneID:1235482"
                     /translation="MKKGLPKQFQDYRNVWVFIELEHGQVHPVSIELLGEGRKLADKL
                     GVHLAGVVIGPPGGQGTANAIADAFAYGADLSYLVESPLLAHYRNEPFTKALTDLVLA
                     NKPEILLLGATTLGRDLAGSVATTLKTGLTADCTELNVDSDGSLAATRPTFGGSLLCT
                     IYTLKCRPQMATVRPSVMATPQRVNRPTGSIIRHDLKMLEEEIATKVLAFFSDCDSTI
                     ANLAYADVVVAGGLGLGAVQNLQLLKDLARTLGGDFGCSRPLVQKGWMPFDRQIGQTG
                     NTIRPKLYIAAGISGAVQHRVGVEGSDLIVAINTDPNAPIFDFAHLGVVADAISFLPA
                     LTEVFTKRLEPRNLEKFVQ"
     misc_feature    complement(449404..450393)
                     /gene="fixB"
                     /locus_tag="SMa0819"
                     /note="Electron transfer flavoprotein, alpha subunit
                     [Energy production and conversion]; Region: FixB; COG2025"
                     /db_xref="CDD:224936"
     misc_feature    complement(449845..450390)
                     /gene="fixB"
                     /locus_tag="SMa0819"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_alpha; cd01715"
                     /db_xref="CDD:238848"
     misc_feature    complement(449521..449775)
                     /gene="fixB"
                     /locus_tag="SMa0819"
                     /note="Electron transfer flavoprotein FAD-binding domain;
                     Region: ETF_alpha; pfam00766"
                     /db_xref="CDD:189709"
     gene            complement(450461..451339)
                     /gene="fixA"
                     /locus_tag="SMa0822"
                     /db_xref="GeneID:1235483"
     CDS             complement(450461..451339)
                     /gene="fixA"
                     /locus_tag="SMa0822"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="trimmed eight residues from glimmer prediction to
                     give better Shine-Dalgarno and initiating Met"
                     /codon_start=1
                     /transl_table=11
                     /product="FixA electron transfer flavoprotein beta chain"
                     /protein_id="NP_435693.1"
                     /db_xref="GI:16262900"
                     /db_xref="GeneID:1235483"
                     /translation="MHLVVCIKQVPDSAQIRVHPVTNTIMRQGVPTIINPHDLAALEE
                     ALKLCDTYGGEVTVVTMGPKMAEDALRKALTFGAHRAVLLTDRHFAGSDTLATSFALA
                     QAIAEIGETFGTPDVVFTGKQTIDGDTAQVGPGIAKRLDLQQLTYVAKILSIDAASRE
                     ITVERRAEGGSQILRTGLPCLVTMLDGADAIRRGRLDDALRAARTKVVKWSAADAGIA
                     EPANCGLRGSPTVVKRVFAPTSREQKARQIDTTNKPLREIADGLIAAIFADRPALKHD
                     LGSTGQQGAPDVDRES"
     misc_feature    complement(450707..451336)
                     /gene="fixA"
                     /locus_tag="SMa0822"
                     /note="The electron transfer flavoprotein (ETF) serves as
                     a specific electron acceptor for various mitochondrial
                     dehydrogenases. ETF transfers electrons to the main
                     respiratory chain via ETF-ubiquinone oxidoreductase. ETF
                     is an heterodimer that consists of an...; Region:
                     ETF_beta; cd01714"
                     /db_xref="CDD:238847"
     misc_feature    complement(order(450944..450955,450968..450973,
                     450977..450982,451157..451159,451226..451228,
                     451235..451237,451319..451324))
                     /gene="fixA"
                     /locus_tag="SMa0822"
                     /note="Ligand binding site [chemical binding]; other site"
                     /db_xref="CDD:238847"
     gene            452858..453325
                     /locus_tag="SMa0824"
                     /db_xref="GeneID:1235484"
     CDS             452858..453325
                     /locus_tag="SMa0824"
                     /function="Miscellaneous; Unknown"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="NP_435694.1"
                     /db_xref="GI:16262901"
                     /db_xref="GeneID:1235484"
                     /translation="MLLDDDIVDVLKKTGVDIARRTVAKYRGAMNIHPLSKAAARSVH
                     CRGPPDSEGCRQPASTLEQAGPVLLERDCDISRPVFWAALFCSPAAGRHSRSQQLSIC
                     GRNSVVPDREEGPKRSRYPEQPVQRHRLSSGHSACRRPVTRASTHGGNSLSDF"
     misc_feature    <452861..452968
                     /locus_tag="SMa0824"
                     /note="Sigma-54, DNA binding domain; Region: Sigma54_DBD;
                     pfam04552"
                     /db_xref="CDD:252667"
     gene            453556..454449
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /db_xref="GeneID:1235485"
     CDS             453556..454449
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /EC_number="1.18.6.1"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="nitrogenase iron protein; nitrogenase component 2;
                     with component 1, an molybdenum-iron protein, catalyzes
                     the fixation of nitrogen to ammonia; nitrogen reductase
                     provides electrons to the nitrogenase complex; in R. etli
                     there are three essentially identical copies of nifH which
                     are actively expressed during symbiosis"
                     /codon_start=1
                     /transl_table=11
                     /product="nitrogenase reductase"
                     /protein_id="NP_435695.1"
                     /db_xref="GI:16262902"
                     /db_xref="GeneID:1235485"
                     /translation="MAALRQIAFYGKGGIGKSTTSQNTLAALVDLGQKILIVGCDPKA
                     DSTRLILNAKAQDTVLHLAATEGSVEDLELEDVLKVGYRGIKCVESGGPEPGVGCAGR
                     GVITSINFLEENGAYNDVDYVSYDVLGDVVCGGFAMPIRENKAQEIYIVMSGEMMALY
                     AANNIAKGILKYAHAGGVRLGGLICNERQTDRELDLAEALAARLNSKLIHFVPRDNIV
                     QHAELRKMTVIQYAPNSKQAGEYRALAEKIHANSGRGTVPTPITMEELEDMLLDFGIM
                     KSDEQMLAELHAKEAKVIAPH"
     misc_feature    453556..454440
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /note="nitrogenase reductase; Reviewed; Region: nifH;
                     PRK13234"
                     /db_xref="CDD:183906"
     misc_feature    453565..454377
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /note="NifH gene encodes component II (iron protein) of
                     nitrogenase. Nitrogenase is responsible for the biological
                     nitrogen fixation, i.e. reduction of molecular nitrogen to
                     ammonia. NifH consists of two oxygen-sensitive
                     metallosulfur proteins: the...; Region: NifH; cd02040"
                     /db_xref="CDD:238996"
     misc_feature    order(453586..453588,453595..453597,453601..453609,
                     453676..453678,453682..453684,453688..453690,
                     453931..453933,453940..453945)
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /note="Nucleotide-binding sites [chemical binding]; other
                     site"
                     /db_xref="CDD:238996"
     misc_feature    453586..453609
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238996"
     misc_feature    453673..453693
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /note="Switch I region of nucleotide binding site; other
                     site"
                     /db_xref="CDD:238996"
     misc_feature    order(453850..453852,453952..453954)
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /note="Fe4S4 binding sites [ion binding]; other site"
                     /db_xref="CDD:238996"
     misc_feature    453931..453945
                     /gene="nifH"
                     /locus_tag="SMa0825"
                     /note="Switch II region of nucleotide binding site; other
                     site"
                     /db_xref="CDD:238996"
     gene            454549..456051
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /db_xref="GeneID:1235486"
     CDS             454549..456051
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /EC_number="1.18.6.1"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /codon_start=1
                     /transl_table=11
                     /product="NifD nitrogenase molybdenum-iron protein alpha
                     chain"
                     /protein_id="NP_435696.1"
                     /db_xref="GI:16262903"
                     /db_xref="GeneID:1235486"
                     /translation="MSLDYENDNALHEKLIEEVLSHYPDKAAKRRKKHLSVAKNKQET
                     AEEGQVVSECDVKSNIKSIPGVMTIRGCAYAGSKGVVWGPIKDMVHISHGPVGCGQYS
                     WSQRRNYYVGTTGIDAFVTMQFTSDFQEKDIVFGGDKKLEKIIDEIEELFPLNNGVTV
                     QSECPIGLIGDDIEAVSRKKAEEYKTTIVPVRCEGFRGVSQSLGHHIANDAIRDWVFD
                     TTEVAYEAGRYDVNVIGDYNIGGDAWASRILLEEIGLHVVGNWSGDATLAEIERAPTA
                     KLNLIHCYRSMNYICRHMEEKYGVPWMEYNFFGPSQIEASLRQIAKHFGPEIEERAER
                     VIAKYSGLTDAVIDKYWPRLHGKRVMLYVGGLRPRHVITAYEDLGMEIVGTGYEFAHN
                     DDYQRTGHYVKEGTLIYDDVTGYELEKFIERIRPDLVGSGIKEKYSVQKMGIPFRQMH
                     SWDYSGPYHGYDGFAIFARDMDLAVNNPVWDLYDAPWQKVTMPAASGAAE"
     misc_feature    454621..456033
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /note="Nitrogenase molybdenum-iron protein, alpha and beta
                     chains [Energy production and conversion]; Region: NifD;
                     COG2710"
                     /db_xref="CDD:225335"
     misc_feature    454714..455979
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /note="Nitrogenase_MoFe_alpha_II: Nitrogenase MoFe
                     protein, beta subunit. A group of proteins similar to the
                     alpha subunit of the MoFe protein of the molybdenum (Mo-)
                     nitrogenase. The nitrogenase enzyme catalyzes the
                     ATP-dependent reduction of dinitrogen to...; Region:
                     Nitrogenase_MoFe_alpha; cd01976"
                     /db_xref="CDD:238935"
     misc_feature    order(454729..454734,454738..454749,454756..454761,
                     454771..454773,454804..454806,454831..454833,
                     454846..454857,454861..454863,454867..454869,
                     454873..454878,454912..454917,454921..454923,
                     454927..454938,454945..454947,454966..454968,
                     454987..454992,454996..455004,455131..455136,
                     455140..455145,455266..455271,455278..455280,
                     455317..455322,455350..455355,455572..455574,
                     455788..455793,455800..455802,455845..455850,
                     455857..455862,455866..455871,455887..455889,
                     455914..455916,455932..455934,455941..455946,
                     455953..455955,455968..455970,455977..455979)
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /note="MoFe protein alpha/beta subunit interactions; other
                     site"
                     /db_xref="CDD:238935"
     misc_feature    order(454762..454764,454768..454770,454831..454833,
                     454837..454842,455038..455040,455131..455133)
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /note="Alpha subunit P cluster binding residues; other
                     site"
                     /db_xref="CDD:238935"
     misc_feature    order(454786..454788,454864..454866,455161..455163,
                     455257..455259,455263..455265,455395..455397,
                     455635..455643,455647..455649,455713..455715,
                     455896..455898)
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /note="FeMoco binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:238935"
     misc_feature    order(454936..454941,454945..454950,455047..455049,
                     455053..455064,455128..455130,455134..455136,
                     455155..455157)
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /note="MoFe protein alpha subunit/Fe protein contacts;
                     other site"
                     /db_xref="CDD:238935"
     misc_feature    order(455557..455562,455566..455574,455581..455586,
                     455590..455592,455854..455856,455863..455865,
                     455929..455931,455965..455970)
                     /gene="nifD"
                     /locus_tag="SMa0827"
                     /note="MoFe protein dimer/ dimer interactions; other site"
                     /db_xref="CDD:238935"
     gene            456142..457683
                     /gene="nifK"
                     /locus_tag="SMa0829"
                     /db_xref="GeneID:1235487"
     CDS             456142..457683
                     /gene="nifK"
                     /locus_tag="SMa0829"
                     /EC_number="1.18.6.1"
                     /function="Small molecule metabolism; Central intermediary
                     metabolism; nitrogen fixation"
                     /note="translation start moved 63 codons upstream of
                     glimmer prediction to give better Shine-Dalgarno and
                     initiating Met, and concordance with ORFS from other
                     organisms"
                     /codon_start=1
                     /transl_table=11
                     /product="NifK nitrogenase molybdenum-iron protein beta
                     chain"
                     /protein_id="NP_435697.1"
                     /db_xref="GI:16262904"
                     /db_xref="GeneID:1235487"
                     /translation="MPQSAEKVLDHAPLFREPEYRKMLAEKKRNFERPYPDR