GenomeNet

Database: RefSeq
Entry: NC_003745
LinkDB: NC_003745
Original site: NC_003745 
LOCUS       NC_003745               4579 bp ds-RNA     linear   VRL 30-NOV-2009
DEFINITION  Saccharomyces cerevisiae virus L-A (L1), complete genome.
ACCESSION   NC_003745
VERSION     NC_003745.1
DBLINK      BioProject: PRJNA14792
KEYWORDS    RefSeq.
SOURCE      Saccharomyces cerevisiae virus L-A
  ORGANISM  Saccharomyces cerevisiae virus L-A
            Viruses; dsRNA viruses; Totiviridae; Totivirus.
REFERENCE   1  (bases 1 to 4579)
  AUTHORS   Icho,T. and Wickner,R.B.
  TITLE     The double-stranded RNA genome of yeast virus L-A encodes its own
            putative RNA polymerase by fusing two open reading frames
  JOURNAL   J. Biol. Chem. 264 (12), 6716-6723 (1989)
   PUBMED   2651431
REFERENCE   2  (bases 1 to 4579)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (03-MAY-2002) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence is identical to J04692.
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..4579
                     /organism="Saccharomyces cerevisiae virus L-A"
                     /mol_type="genomic RNA"
                     /db_xref="taxon:11008"
                     /clone="pTIL05"
     gene            30..4546
                     /locus_tag="ScVLAgp1"
                     /db_xref="GeneID:940478"
     CDS             join(30..1961,1961..4546)
                     /locus_tag="ScVLAgp1"
                     /codon_start=1
                     /product="ssRNA-binding protein"
                     /protein_id="NP_620493.1"
                     /db_xref="GeneID:940478"
                     /translation="MLRFVTKNSQDKSSDLFSICSDRGTFVAHNRVRTDFKFDNLVFN
                     RVYGVSQKFTLVGNPTVCFNEGSSYLEGIAKKYLTLDGGLAIDNVLNELRSTCGIPGN
                     AVASHAYNITSWRWYDNHVALLMNMLRAYHLQVLTEQGQYSAGDIPMYHDGHVKIKLP
                     VTIDDTAGPTQFAWPSDRSTDSYPDWAQFSESFPSIDVPYLDVRPLTVTEVNFVLMMM
                     SKWHRRTNLAIDYEAPQLADKFAYRHALTVQDADEWIEGDRTDDQFRPPSSKVMLSAL
                     RKYVNHNRLYNQFYTAAQLLAQIMMKPVPNCAEGYAWLMHDALVNIPKFGSIRGRYPF
                     LLSGDAALIQATALEDWSAIMAKPELVFTYAMQVSVALNTGLYLRRVKKTGFGTTIDD
                     SYEDGAFLQPETFVQAALACCTGQDAPLNGMSDVYVTYPDLLEFDAVTQVPITVIEPA
                     GYNIVDDHLVVVGVPVACSPYMIFPVAAFDTANPYCGNFVIKAANKYLRKGAVYDKLE
                     AWKLAWALRVAGYDTHFKVYGDTHGLTKFYADNGDTWTHIPEFVTDGDVMEVFVTAIE
                     RRARHFVELPRLNSPAFFRSVEVSTTIYDTHVQAGAHAVYHASRINLDYVKPVSTGIQ
                     VINAGELKNYWGSVRRTQQGFRSGRSYDASCNAYRRTYSWRCPRRVDRTGGQCFSRVN
                     VIEPSHGPRPTRYILQEPGTYPAWIRFRNRVQAVSRQKATHFLFDIVPAAVISDFTTS
                     DTSSFAYKSHTYAVNVTALRFSDTYALYVQTDTNMTILSPAARRQASATYSQVAGFCY
                     NTPTVMDSLANILDVDRNIRPKHFKGLRLYTRSKVTAQHHTHLRPDELVEAAAKVSPR
                     RKYYLMCVVELLANLQVDLEAAVATILAYVLTLSEKFVPIFLDSRAIWVGEPGPDALT
                     ARLKASSGQIKSIHTADYEPLTELFELAVLMNRGVGHVSWQAEKDHRLNPDVAVVDQA
                     RLYSCVRDMFEGSKQTYKYPFMTWDDYTANRWEWVPGGSVHSQYEEDNDYIYPGQYTR
                     NKFITVNKMPKHKISRMIASPPEVRAWTSTKYEWGKQRAIYGTDLRSTLITNFAMFRC
                     EDVLTHKFPVGDQAEAAKVHKRVNMMLDGASSFCFDYDDFNSQHSIASMYTVLCAFRD
                     TFSRNMSDEQAEAMNWVCESVRHMWVLDPDTKEWYRLQGTLLSGWRLTTFMNTVLNWA
                     YMKLAGVFDLDDVQDSVHNGDDVMISLNRVSTAVRIMDAMHRINARAQPAKCNLFSIS
                     EFLRVEHGMSGGDGLGAQYLSRSCATLVHSRIESNEPLSVVRVMEADQARLRDLANRT
                     RVQSAVTAIKEQLDKRVTKIFGVGDDVVRDIHTAHRVCGGISTDTWAPVETKIITDNE
                     AYEIPYEIDDPSFWPGVNDYAYKVWKNFGERLEFNKIKDAVARGSRSTIALKRKARIT
                     SKKNEFANKSEWERTMYKAYKGLAVSYYANLSKFMSIPPMANIEFGQARYAMQAALDS
                     SDPLRALQVIL"
     misc_feature    30..1337
                     /locus_tag="ScVLAgp1"
                     /note="L-A virus, major coat protein; Region:
                     LA-virus_coat; pfam09220"
                     /db_xref="CDD:286324"
     misc_feature    2468..3907
                     /locus_tag="ScVLAgp1"
                     /note="Viral RNA-directed RNA-polymerase; Region: RdRP_4;
                     pfam02123"
                     /db_xref="CDD:280316"
     misc_feature    order(3398..3415,3593..3598,3695..3697,3701..3706)
                     /locus_tag="ScVLAgp1"
                     /note="active site"
                     /db_xref="CDD:238185"
     misc_feature    order(3398..3415,3593..3595,3701..3703)
                     /locus_tag="ScVLAgp1"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238185"
     misc_feature    3596..3598
                     /locus_tag="ScVLAgp1"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
     gene            30..2072
                     /locus_tag="ScVLAgp2"
                     /db_xref="GeneID:940477"
     CDS             30..2072
                     /locus_tag="ScVLAgp2"
                     /codon_start=1
                     /product="major coat protein"
                     /protein_id="NP_620494.1"
                     /db_xref="GeneID:940477"
                     /translation="MLRFVTKNSQDKSSDLFSICSDRGTFVAHNRVRTDFKFDNLVFN
                     RVYGVSQKFTLVGNPTVCFNEGSSYLEGIAKKYLTLDGGLAIDNVLNELRSTCGIPGN
                     AVASHAYNITSWRWYDNHVALLMNMLRAYHLQVLTEQGQYSAGDIPMYHDGHVKIKLP
                     VTIDDTAGPTQFAWPSDRSTDSYPDWAQFSESFPSIDVPYLDVRPLTVTEVNFVLMMM
                     SKWHRRTNLAIDYEAPQLADKFAYRHALTVQDADEWIEGDRTDDQFRPPSSKVMLSAL
                     RKYVNHNRLYNQFYTAAQLLAQIMMKPVPNCAEGYAWLMHDALVNIPKFGSIRGRYPF
                     LLSGDAALIQATALEDWSAIMAKPELVFTYAMQVSVALNTGLYLRRVKKTGFGTTIDD
                     SYEDGAFLQPETFVQAALACCTGQDAPLNGMSDVYVTYPDLLEFDAVTQVPITVIEPA
                     GYNIVDDHLVVVGVPVACSPYMIFPVAAFDTANPYCGNFVIKAANKYLRKGAVYDKLE
                     AWKLAWALRVAGYDTHFKVYGDTHGLTKFYADNGDTWTHIPEFVTDGDVMEVFVTAIE
                     RRARHFVELPRLNSPAFFRSVEVSTTIYDTHVQAGAHAVYHASRINLDYVKPVSTGIQ
                     VINAGELKNYWGSVRRTQQGLGVVGLTMPAVMPTGEPTAGAAHEELIEQADNVLVE"
     misc_feature    30..1337
                     /locus_tag="ScVLAgp2"
                     /note="L-A virus, major coat protein; Region:
                     LA-virus_coat; pfam09220"
                     /db_xref="CDD:286324"
     gene            2351..4546
                     /locus_tag="ScVLAgp3"
                     /db_xref="GeneID:940476"
     CDS             2351..4546
                     /locus_tag="ScVLAgp3"
                     /note="RNA-dependent RNA polymerase of icosahedral RNA
                     viruses; putative"
                     /codon_start=1
                     /product="RNA polymerase"
                     /protein_id="NP_620495.1"
                     /db_xref="GeneID:940476"
                     /translation="MTILSPAARRQASATYSQVAGFCYNTPTVMDSLANILDVDRNIR
                     PKHFKGLRLYTRSKVTAQHHTHLRPDELVEAAAKVSPRRKYYLMCVVELLANLQVDLE
                     AAVATILAYVLTLSEKFVPIFLDSRAIWVGEPGPDALTARLKASSGQIKSIHTADYEP
                     LTELFELAVLMNRGVGHVSWQAEKDHRLNPDVAVVDQARLYSCVRDMFEGSKQTYKYP
                     FMTWDDYTANRWEWVPGGSVHSQYEEDNDYIYPGQYTRNKFITVNKMPKHKISRMIAS
                     PPEVRAWTSTKYEWGKQRAIYGTDLRSTLITNFAMFRCEDVLTHKFPVGDQAEAAKVH
                     KRVNMMLDGASSFCFDYDDFNSQHSIASMYTVLCAFRDTFSRNMSDEQAEAMNWVCES
                     VRHMWVLDPDTKEWYRLQGTLLSGWRLTTFMNTVLNWAYMKLAGVFDLDDVQDSVHNG
                     DDVMISLNRVSTAVRIMDAMHRINARAQPAKCNLFSISEFLRVEHGMSGGDGLGAQYL
                     SRSCATLVHSRIESNEPLSVVRVMEADQARLRDLANRTRVQSAVTAIKEQLDKRVTKI
                     FGVGDDVVRDIHTAHRVCGGISTDTWAPVETKIITDNEAYEIPYEIDDPSFWPGVNDY
                     AYKVWKNFGERLEFNKIKDAVARGSRSTIALKRKARITSKKNEFANKSEWERTMYKAY
                     KGLAVSYYANLSKFMSIPPMANIEFGQARYAMQAALDSSDPLRALQVIL"
     misc_feature    2468..3907
                     /locus_tag="ScVLAgp3"
                     /note="Viral RNA-directed RNA-polymerase; Region: RdRP_4;
                     pfam02123"
                     /db_xref="CDD:280316"
     misc_feature    order(3398..3415,3593..3598,3695..3697,3701..3706)
                     /locus_tag="ScVLAgp3"
                     /note="active site"
                     /db_xref="CDD:238185"
     misc_feature    order(3398..3415,3593..3595,3701..3703)
                     /locus_tag="ScVLAgp3"
                     /note="NTP binding site [chemical binding]; other site"
                     /db_xref="CDD:238185"
     misc_feature    3596..3598
                     /locus_tag="ScVLAgp3"
                     /note="nucleic acid binding site [nucleotide binding];
                     other site"
                     /db_xref="CDD:238185"
ORIGIN      
        1 gaaaaatttt taaattcata taactcccca tgctaagatt tgttactaaa aactctcaag
       61 ataaatcgtc tgatctattc tctatttgtt ctgatcgcgg aacttttgtt gcccataata
      121 gagttcggac tgatttcaag tttgacaact tagtattcaa ccgagtttat ggtgtttctc
      181 aaaaatttac gttagtcggt aacccgacag tctgctttaa tgaaggcagt tcttacctag
      241 aaggtattgc taaaaagtac ctaactttgg atggaggact tgccattgac aatgtcctca
      301 atgagttgag atccacttgc ggtatcccag gtaatgctgt tgcatctcat gcgtataata
      361 ttacatcctg gcgttggtat gacaatcacg tggcactgtt gatgaacatg ttgcgtgctt
      421 accacttaca agtattgacc gaacagggcc aatatagcgc tggagatatc cctatgtacc
      481 atgatggaca tgtcaaaatc aagctaccag tgactatcga tgacacggca ggcccaacac
      541 aattcgcttg gcctagtgac aggtctactg attcgtatcc tgattgggca cagttttctg
      601 aatcatttcc atcaatcgac gtcccgtacc tagatgttag gccattgacc gtaacggaag
      661 tcaatttcgt gcttatgatg atgagtaagt ggcatagacg tactaactta gcgatagact
      721 acgaggcacc ccaactagct gataagttcg cttaccgcca tgcgcttact gttcaagacg
      781 ctgacgagtg gatagaaggc gatagaactg atgaccagtt ccgccccccc tcgtctaaag
      841 taatgttatc ggcacttcgt aagtacgtga accataacag gctgtacaat cagttttaca
      901 ctgcagcaca actgttagct caaattatga tgaaacctgt ccctaactgc gctgagggct
      961 acgcttggct gatgcatgac gcattggtca atataccaaa atttgggtct attcgaggaa
     1021 ggtacccctt tttgttatca ggtgatgcag cgttgattca ggctacagcc ctagaagact
     1081 ggtctgctat catggcgaaa cccgagctgg tgttcactta cgcgatgcag gtgtcagtag
     1141 cgttaaacac cggactatac ttacgtcgcg ttaagaaaac aggcttcggc acaactatag
     1201 atgacagcta tgaagatgga gcgtttttgc aaccggagac gttcgttcag gccgcactag
     1261 catgttgtac cggacaagat gcgcccctaa atgggatgtc agatgtgtat gtcacttatc
     1321 cagatcttct agaatttgat gctgttacac aagtacccat cacggtcatt gagcccgctg
     1381 gctataacat tgttgatgat catttagtgg ttgtgggtgt acctgtggca tgttcaccat
     1441 acatgatatt tccagtagct gcgtttgata ctgcaaatcc ttactgtggg aattttgtca
     1501 ttaaggctgc taacaagtat ctccgtaagg gtgccgtgta tgataaactc gaagcatgga
     1561 agttggcctg ggcactgagg gtagccgggt atgacactca cttcaaagtg tatggcgata
     1621 cacacggctt aactaagttc tatgctgaca acggtgacac atggacacac atacctgaat
     1681 ttgtcactga cggtgacgtg atggaagtat tcgttactgc catcgaacgc agagctagac
     1741 atttcgttga actacctaga ctgaattcac cagcattctt cagatctgta gaagtcagca
     1801 ccactatata tgatactcat gtgcaggctg gtgcgcatgc ggtgtatcat gctagtcgaa
     1861 tcaatcttga ttatgttaag cctgtttcga ccggcattca ggtgatcaat gcgggcgaac
     1921 ttaagaacta ctggggtagt gtgcgtcgta ctcagcaggg tttaggagtg gtaggtctta
     1981 cgatgccagc tgtaatgcct accggagaac ctacagctgg cgctgcccac gaagagttga
     2041 tagaacaggc ggacaatgtt ttagtagagt aaacgtaatc gaaccctcac acggaccccg
     2101 ccctacaagg tacatactgc aggaaccagg tacgtaccct gcgtggatta gattcaggaa
     2161 cagagtacaa gctgtatcgc gtcagaaagc cactcacttc ttgtttgaca tcgtacctgc
     2221 cgcagtaatt agtgatttta ctacgtctga cacgtcttcg tttgcataca aatcgcacac
     2281 ctacgctgta aatgtaacag cattgaggtt cagtgacact tatgccttgt acgtacagac
     2341 tgataccaac atgacaattt taagcccagc ggcgcgtcgc caggcttctg cgacgtactc
     2401 acaggtggca gggttttgtt ataacacacc taccgttatg gattcgctag cgaatatctt
     2461 ggacgtagac cgcaatatac gacccaaaca cttcaagggt ttacggctat acacaaggtc
     2521 taaggtcact gctcaacatc atactcactt gcggccagac gagctagtgg aagcggccgc
     2581 aaaggtctcg cctagacgta aatactactt aatgtgtgta gttgagctgc tcgcgaactt
     2641 acaagtagat cttgaagcag cagtagctac tattctcgca tatgtcctga cactaagtga
     2701 aaaatttgta ccaattttct tggattctag agcaatatgg gtcggtgagc ctgggcctga
     2761 tgctctgact gcacgtctca aggccagtag tgggcagatc aagagcatac acacggctga
     2821 ttacgaacca ctcactgaac tattcgagtt agcagtattg atgaaccgag gtgttggcca
     2881 tgtctcttgg caagctgaaa aggatcatcg cttgaatccc gacgtggctg tagttgatca
     2941 agcacggcta tattcgtgtg tgcgcgacat gttcgaagga tcaaagcaga cgtataaata
     3001 tccctttatg acgtgggatg actacactgc aaacagatgg gagtgggttc caggtggcag
     3061 tgtccactct caatacgaag aagacaacga ttatatctat cctggtcagt atactaggaa
     3121 caagttcata actgttaaca aaatgcccaa acacaaaata tctagaatga tagcatcacc
     3181 gcctgaggta cgagcttgga cgtcgacgaa gtacgaatgg ggcaagcaac gtgctatcta
     3241 cgggacggat ctacgaagta cactgataac taactttgca atgttcaggt gcgaggatgt
     3301 tctcactcac aagttcccag taggcgacca ggcagaggca gcaaaggtgc acaaacgggt
     3361 gaacatgatg ctggacggtg cctctagttt ctgcttcgat tatgatgact tcaattctca
     3421 gcattcaata gctagtatgt atacggtttt gtgcgctttc agggacacat ttagtcgcaa
     3481 catgtctgat gaacaagcag aggcgatgaa ctgggtgtgt gagtccgtca gacacatgtg
     3541 ggtactagat cctgatacca aggagtggta cagactacaa ggtacattac tgtcaggatg
     3601 gcggttaacc acatttatga acactgtgct aaactgggcg tatatgaaat tagctggcgt
     3661 atttgatctg gatgacgttc aagactcggt acacaacggt gatgatgtta tgattagtct
     3721 caaccgcgtg agcacagcag taagaataat ggacgctatg caccggataa atgcgcgagc
     3781 acagccggcg aagtgtaact tgttttcgat aagtgaattt ctgagggtag aacacggtat
     3841 gagcggaggc gatggtcttg gggctcagta cttaagtagg tcttgtgcta ctcttgtaca
     3901 cagtaggatt gagtctaacg aaccactgtc agtagtacga gttatggaag cagaccaggc
     3961 tagattgcgc gacctggcaa acagaacgcg ggtacaatct gcggtaacag cgataaaaga
     4021 acaactcgac aaacgtgtca ctaagatatt cggagttggt gatgacgttg tgcgcgacat
     4081 acacacagct cacagggtgt gtggcggtat ctcgactgat acctgggcac cggttgaaac
     4141 taagataata acagacaatg aagcatatga aataccatac gaaatagatg atccatcatt
     4201 ttggccaggg gtaaatgatt atgcttataa agtctggaaa aatttcggag aacgactcga
     4261 atttaataag attaaagatg ccgtagctag agggagtagg agcactatag ctctgaaacg
     4321 taaggctagg ataacatcta agaagaatga attcgctaac aagtcggaat gggaaaggac
     4381 aatgtacaaa gcctataagg gtttggcagt ctcatactat gctaacctga gcaaattcat
     4441 gagtatacca ccaatggcga acattgaatt tgggcaggct agatatgcta tgcaagcagc
     4501 ccttgatagt tctgatccac tccgggcatt acaggtcata ctgtaattgc caaaaagata
     4561 atgggaatta cccatatgc
//
DBGET integrated database retrieval system