GenomeNet

Database: RefSeq
Entry: NC_006153
LinkDB: NC_006153
Original site: NC_006153 
LOCUS       NC_006153              68525 bp    DNA     circular CON 19-MAY-2017
DEFINITION  Yersinia pseudotuberculosis IP32953 pYV plasmid, complete sequence.
ACCESSION   NC_006153
VERSION     NC_006153.2
DBLINK      BioProject: PRJNA224116
            BioSample: SAMEA3138251
            Assembly: GCF_000047365.1
KEYWORDS    RefSeq.
SOURCE      Yersinia pseudotuberculosis IP 32953
  ORGANISM  Yersinia pseudotuberculosis IP 32953
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales;
            Yersiniaceae; Yersinia.
REFERENCE   1
  AUTHORS   Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O.,
            Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L.,
            Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C.,
            Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D.,
            Elliott,J.M., Derbise,A., Hauser,L.J. and Garcia,E.
  TITLE     Insights into the evolution of Yersinia pestis through whole-genome
            comparison with Yersinia pseudotuberculosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004)
   PUBMED   15358858
REFERENCE   2  (bases 1 to 68525)
  AUTHORS   Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2004) Biology and Biotechnology Research Program,
            Lawrence Livermore National Laboratory, Livermore, CA 94550 USA,
            Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15,
            France, and the Genome Analysis Group, Oak Ridge National
            Laboratory, Oak Ridge, TN 37831 USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            BX936399.
            On Sep 1, 2006 this sequence version replaced NC_006153.1.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: https://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider               :: NCBI
            Annotation Date                   :: 05/16/2017 07:53:30
            Annotation Pipeline               :: NCBI Prokaryotic Genome
                                                 Annotation Pipeline
            Annotation Method                 :: Best-placed reference protein
                                                 set; GeneMarkS+
            Annotation Software revision      :: 4.2
            Features Annotated                :: Gene; CDS; rRNA; tRNA; ncRNA;
                                                 repeat_region
            Genes (total)                     :: 4,495
            CDS (total)                       :: 4,379
            Genes (coding)                    :: 4,249
            CDS (coding)                      :: 4,249
            Genes (RNA)                       :: 116
            rRNAs                             :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                    :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                             :: 82
            ncRNAs                            :: 12
            Pseudo Genes (total)              :: 130
            Pseudo Genes (ambiguous residues) :: 0 of 130
            Pseudo Genes (frameshifted)       :: 83 of 130
            Pseudo Genes (incomplete)         :: 45 of 130
            Pseudo Genes (internal stop)      :: 25 of 130
            Pseudo Genes (multiple problems)  :: 21 of 130
            CRISPR Arrays                     :: 2
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..68525
                     /organism="Yersinia pseudotuberculosis IP 32953"
                     /mol_type="genomic DNA"
                     /strain="IP 32953"
                     /db_xref="taxon:273123"
                     /plasmid="pYV"
     gene            complement(12..2210)
                     /locus_tag="YPTB_RS21465"
                     /old_locus_tag="pYV0001"
     CDS             complement(12..2210)
                     /locus_tag="YPTB_RS21465"
                     /old_locus_tag="pYV0001"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395206.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase YpkA"
                     /protein_id="WP_011191359.1"
                     /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRII
                     DNQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPN
                     ALSNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRL
                     VAKIERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVD
                     GWRCSDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNV
                     VFDRASGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLH
                     CIEGFEKNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVS
                     ADSRPDSNEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSD
                     LLRTHLSSAATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVI
                     EDYVKGREGDTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAH
                     KHLETLLEVLVTLSQQGQPVSSETYGFLNRLAEAKITLSQQLNTLQQQQESAKAQLSI
                     LINRSGSWADVARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDD
                     MRNFTVDSIPLLIQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
     gene            complement(2218..2667)
                     /locus_tag="YPTB_RS21470"
                     /old_locus_tag="pYV0002"
     CDS             complement(2218..2667)
                     /locus_tag="YPTB_RS21470"
                     /old_locus_tag="pYV0002"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395207.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002229809.1"
                     /translation="MINTTFTELLPKIASHFGLDKLSQDEYGLCELILNDRVVIMLRA
                     DEILNRLTLLGPILGFSGPEARSAASQLFFCYSINALNKDGPCFAWSEELGLIAFKHL
                     SLDELNVENVSKEIANFYDWLSLVSLPAETQQELPLHTQSTQSVKWG"
     gene            2825..>2920
                     /locus_tag="YPTB_RS23395"
                     /pseudo
     CDS             2825..>2920
                     /locus_tag="YPTB_RS23395"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611384.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
     gene            complement(2919..3374)
                     /locus_tag="YPTB_RS23400"
                     /old_locus_tag="pYV0003"
     CDS             complement(2919..3374)
                     /locus_tag="YPTB_RS23400"
                     /old_locus_tag="pYV0003"
                     /inference="COORDINATES: protein motif:HMM:PF00665.24"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080514452.1"
                     /translation="MCVAVSQYITDHLHQPWQGEAAFVFCNKGAFAYQSSALEQTRGL
                     VVKRLLFHSDQGGQYRSKKSRQLLWRTGVMQSMSRRGNCLDNSPMERVFRSLKSEWLP
                     VGGYMDVHHAVRDIGEWGYKVITTHPHRHNGGLPPCEYEEQGKKATKVS"
     gene            complement(3411..3650)
                     /locus_tag="YPTB_RS23405"
                     /old_locus_tag="pYV0004"
     CDS             complement(3411..3650)
                     /locus_tag="YPTB_RS23405"
                     /old_locus_tag="pYV0004"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012414139.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002213291.1"
                     /translation="MSKKHYCRLHDLNIATFYYWLKHHQDDTTVAIPPAFIPARRVIP
                     DNNGTEAVTLNLPNGCSVSCLPAQLRAVMQALSLC"
     gene            3778..3996
                     /locus_tag="YPTB_RS23410"
     CDS             3778..3996
                     /locus_tag="YPTB_RS23410"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011114042.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011114042.1"
                     /translation="MRSPLAYGCSVYTVNVVTQLHNDIHKSAYKHKRLYHVLTGQASS
                     AQPVFSMPHRGMKAPADINYNSVDNWRR"
     gene            complement(4823..5689)
                     /gene="repA"
                     /locus_tag="YPTB_RS21480"
                     /old_locus_tag="pYV0005"
     CDS             complement(4823..5689)
                     /gene="repA"
                     /locus_tag="YPTB_RS21480"
                     /old_locus_tag="pYV0005"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395210.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="incFII family plasmid replication initiator
                     RepA"
                     /protein_id="WP_002225475.1"
                     /translation="MTNHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGF
                     TSRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNLAI
                     ECGLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFSA
                     LDVSDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAH
                     GLKRARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSR
                     NNNYTRLATGAT"
     gene            complement(5682..5756)
                     /locus_tag="YPTB_RS21485"
     CDS             complement(5682..5756)
                     /locus_tag="YPTB_RS21485"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395211.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepA leader peptide Tap"
                     /protein_id="WP_002233140.1"
                     /translation="MFRKVQYLLRLLLLPCNISAGRCD"
     gene            complement(5998..6252)
                     /locus_tag="YPTB_RS21490"
                     /old_locus_tag="pYV0007"
     CDS             complement(5998..6252)
                     /locus_tag="YPTB_RS21490"
                     /old_locus_tag="pYV0007"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395212.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_002229817.1"
                     /translation="MSQIENAVTSSSKRAYRKGNPLTGAEKQRMSVSRKKETHKAINV
                     FIQNDLKNELLQLCEDSGLTQTEMIERWIQREKAARTNAA"
     gene            complement(6390..6638)
                     /locus_tag="YPTB_RS21495"
     CDS             complement(6390..6638)
                     /locus_tag="YPTB_RS21495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002233137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_032466929.1"
                     /translation="MDLLVNAGIPVRTVNSFKALHDKVIIVDGKNTQMGSFNFSQAAV
                     QSNSENVLIIWGDFTVVQAYLQHWQSRWNKGTDWRSSY"
     gene            6779..7183
                     /locus_tag="YPTB_RS23420"
                     /old_locus_tag="pYV0008"
     CDS             6779..7183
                     /locus_tag="YPTB_RS23420"
                     /old_locus_tag="pYV0008"
                     /inference="COORDINATES: protein motif:HMM:PF00665.24"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011171989.1"
                     /translation="MMDIHIAPYRQPFTFQASVYSRRIVGSAISSSPDAELVCRAWRN
                     ALETRPREKRLLFHSDQGGQYRSKKYRQLLWRNGVMQSMSRRGNCLDNSPMERVKVNH
                     QCQVAPATIDFDIADISTPHTIGLRRLKLPFQ"
     gene            7238..7492
                     /locus_tag="YPTB_RS23425"
     CDS             7238..7492
                     /locus_tag="YPTB_RS23425"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017204799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_074007957.1"
                     /translation="MATRQTTFPHQPASQPATHVITRLTHQQTQCSVAGCSPALLMQF
                     TQLQTFYINPQIQRSRVNTARYFEQAAQFDHWPFCFQPCD"
     gene            complement(7489..7806)
                     /locus_tag="YPTB_RS21505"
                     /old_locus_tag="pYV0009"
     CDS             complement(7489..7806)
                     /locus_tag="YPTB_RS21505"
                     /old_locus_tag="pYV0009"
                     /inference="COORDINATES: protein motif:HMM:PF01527.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213244.1"
                     /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQL
                     RKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIK
                     SLR"
     gene            complement(<7880..7981)
                     /locus_tag="YPTB_RS23430"
                     /pseudo
     CDS             complement(<7880..7981)
                     /locus_tag="YPTB_RS23430"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_016266430.1"
                     /note="internal stop; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraI"
     gene            complement(7978..8436)
                     /locus_tag="YPTB_RS21510"
                     /old_locus_tag="pYV0010"
     CDS             complement(7978..8436)
                     /locus_tag="YPTB_RS21510"
                     /old_locus_tag="pYV0010"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002213246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002213246.1"
                     /translation="MGGMAAHWFTYQYAVPFCGRAKTLVTLSNAEGESVLISPQQNTA
                     QDISLFMPRELTVSQGDRVRFTRSDTDRGYVANSLWEVAGFTEDGAVRFRQGDQEKIV
                     DPQKATEDRHIDLAYTLTAYGVQGASERFVIALFGAEGGRKRMATLHLFT"
     gene            8505..8774
                     /locus_tag="YPTB_RS21515"
                     /old_locus_tag="pYV0011"
     CDS             8505..8774
                     /locus_tag="YPTB_RS21515"
                     /old_locus_tag="pYV0011"
                     /inference="COORDINATES: protein motif:HMM:PF01527.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_042469136.1"
                     /translation="MEAIEQVVKYQRSTIEVARALELDPSQLRKWIRQYKEEVSGVTP
                     DNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLR"
     gene            complement(<8875..9033)
                     /locus_tag="YPTB_RS23435"
                     /pseudo
     CDS             complement(<8875..9033)
                     /locus_tag="YPTB_RS23435"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001004111.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing stop; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="EamA family transporter"
     gene            complement(9103..10401)
                     /locus_tag="YPTB_RS21525"
                     /old_locus_tag="pYV0013"
     CDS             complement(9103..10401)
                     /locus_tag="YPTB_RS21525"
                     /old_locus_tag="pYV0013"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011191362.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin YadA"
                     /protein_id="WP_011191362.1"
                     /translation="MTKDFKISVSAALISALFSSPYAFAEEPEDGNDGIPRLSAVQIS
                     PNVDPKLGVGLYPAKPILRQENPKLPPRGPQGPEKKRARLAEAIQPQVLGGLDARAKG
                     IHSIAIGATAEAAKPAAVAVGAGSIATGVNSVAIGPLSKALGDSAVTYGASSTAQKDG
                     VAIGARASASDTGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDLSKTDRENSV
                     SIGHESLNRQLTHLAAGTKDNDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKH
                     SNSVARTTLETAEEHANKKSAEALVSAKVYADSNSSHTLKTANSYTDVTVSSSTKKAI
                     SESNQYTDHKFSQLDNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRS
                     SQALAIGSGYRVNESVALKAGVAYAGSSNVMYNASFNIEW"
     gene            10995..11389
                     /locus_tag="YPTB_RS23640"
                     /pseudo
     CDS             10995..11389
                     /locus_tag="YPTB_RS23640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_449150.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(11386..13701)
                     /locus_tag="YPTB_RS21535"
                     /old_locus_tag="pYV0016"
     CDS             complement(11386..13701)
                     /locus_tag="YPTB_RS21535"
                     /old_locus_tag="pYV0016"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611787.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DDE transposase"
                     /protein_id="WP_002213256.1"
                     /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRR
                     GKHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTR
                     REHTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILL
                     PGATTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLV
                     YDAEGRIQRAGYSLCLLERLQDALRRRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVC
                     RALGHPTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEE
                     PLSLLRLNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVL
                     MAEACNIGLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRW
                     GGGEVASVDGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLR
                     DSIFVLEGLLEQQTGLNPVEIMTDTAGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRV
                     DKSANYGALDELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSG
                     LAQAIMAVGRVNKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKR
                     YREGQEDQLGALGLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHIN
                     MLGHYTFTLSDDILNGELRALNFNLNNELSP"
     gene            13865..14416
                     /locus_tag="YPTB_RS21540"
                     /old_locus_tag="pYV0017"
     CDS             13865..14416
                     /locus_tag="YPTB_RS21540"
                     /old_locus_tag="pYV0017"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395220.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_002213258.1"
                     /translation="MRLFGYARVSTSQQSLDIQIKTLKDAGVKANRIFTDKASGSSAD
                     REGLDLLRMKVEEGDVILVKKLDRLGRDTVDMIQLIKEFDAQGVSIQFIDDGISTDGE
                     MGKMVVTILSAVAQAERQRILERTNEGREEAKLKGVKFGRKRRINRKELLELHEQGMG
                     ATEIAKKMNIARSTIYKVINESQ"
     gene            14435..14899
                     /locus_tag="YPTB_RS21545"
     CDS             14435..14899
                     /locus_tag="YPTB_RS21545"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_954990.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012414143.1"
                     /translation="MNLQNNLHSILEKVESLKNIKMLDKNNGEFTYIEGNYYFSDLTT
                     DSLNIYEIKYLFTFENFDFFSNGKPNEVSVYKATNSFNSVCLGIKASLNSLDVERKEL
                     TVQFTYSMVFDASKGIPNFSNELETSMGLLRIAPKKLSNSFKDKGIEHNYVN"
     gene            15038..15367
                     /locus_tag="YPTB_RS21550"
     CDS             15038..15367
                     /locus_tag="YPTB_RS21550"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395221.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002229829.1"
                     /translation="MLTFFAKYYFDLFFNKEKNRKEKEITTRLEKRISKLEKENISLR
                     DDLIKCKLEHIDEVMRIERSLNTQLKTNYKNNNNENLWAGIDDIIKTIECVSIESKIG
                     GVKTNLK"
     gene            15467..16566
                     /locus_tag="YPTB_RS23445"
                     /old_locus_tag="pYV0019"
     CDS             join(15467..15728,15728..16566)
                     /locus_tag="YPTB_RS23445"
                     /old_locus_tag="pYV0019"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611505.1"
                     /ribosomal_slippage
                     /note="programmed frameshift; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
                     /protein_id="WP_086025330.1"
                     /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKK
                     FGGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKFLRPLQKRDAVEYLL
                     AAYRIGVRRGCRLMMQSRTVYNYRSHRDDRAITQRIREIAETRIRYGCPRIHILLRRE
                     GWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKHRHARPEVTALEQCWSMDFVADNLFN
                     GRRVRALTIVDNFSRECLALEVGQGLRGDDVVAVMDRLKHSLGRIPQRLQTDNGSEFI
                     SKSMDRWAYENRVTMDFSRPGKPTDNAFIESFNGSLRDECLNVHGFLSLEDAQEKIEQ
                     WRQEYNHFRPHSSLNNLTPAEFARSHQKGPDL"
     gene            complement(16714..17139)
                     /locus_tag="YPTB_RS21565"
                     /old_locus_tag="pYV0020"
     CDS             complement(16714..17139)
                     /locus_tag="YPTB_RS21565"
                     /old_locus_tag="pYV0020"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395224.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Tir chaperone family protein"
                     /protein_id="WP_002213267.1"
                     /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPIN
                     EKELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSG
                     TQLASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
     gene            complement(17484..17915)
                     /locus_tag="YPTB_RS21570"
                     /old_locus_tag="pYV0021"
     CDS             complement(17484..17915)
                     /locus_tag="YPTB_RS21570"
                     /old_locus_tag="pYV0021"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395225.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213269.1"
                     /translation="MHELEALLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQ
                     EWNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERCENVIL
                     LGPPGVGKTHLAVALGVKAADAGHRVLFMPLYEDITNIGVY"
     gene            complement(17915..19087)
                     /locus_tag="YPTB_RS21575"
                     /old_locus_tag="pYV0022"
     CDS             complement(17915..19087)
                     /locus_tag="YPTB_RS21575"
                     /old_locus_tag="pYV0022"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_002406038.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="IS21 family transposase"
                     /protein_id="WP_011191364.1"
                     /translation="MLSREDFYMIKQMRQQGAYIIDIATQVGCSERTVRRYLKYPEPP
                     ARKTRHKMVKLKPFMDYIDMRLAENVWNSEVILAEIKAMGYTGGRSMLRYYIQPKRKM
                     RPSKRTVRFETQPGYQLQHDWGEVELEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDA
                     EHTYESLVRAFRYFGGSVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLAEHYDFLPRAC
                     RPRRARTKGKVERMVKYLKDNVFVRYRRFDSFTHVNQQLEQWMADVADKRELRQFRQT
                     PEQRFALEQEHLQPLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRI
                     SLDDELRSYSNEQQVASHRLCSASSGWQTVPEHHAPLWQQVSMVEHRPLSAYEELL"
     gene            <19190..19834
                     /locus_tag="YPTB_RS21585"
                     /old_locus_tag="pYV0023"
                     /pseudo
     CDS             <19190..19834
                     /locus_tag="YPTB_RS21585"
                     /old_locus_tag="pYV0023"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611475.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            complement(19897..20289)
                     /locus_tag="YPTB_RS21590"
                     /old_locus_tag="pYV0024"
     CDS             complement(19897..20289)
                     /locus_tag="YPTB_RS21590"
                     /old_locus_tag="pYV0024"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395142.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YopE regulator"
                     /protein_id="WP_002213403.1"
                     /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVG
                     QILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNS
                     LYTQLEMLVQGAERLQTSSLISPPRSFS"
     gene            20483..21142
                     /locus_tag="YPTB_RS21595"
                     /old_locus_tag="pYV0025"
     CDS             20483..21142
                     /locus_tag="YPTB_RS21595"
                     /old_locus_tag="pYV0025"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane virulence protein YopE"
                     /protein_id="WP_002229754.1"
                     /translation="MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLA
                     GRTESPQGSSLASRIIERLSSVAHSVIGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSF
                     SDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGE
                     LQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSL
                     M"
     gene            complement(21282..21581)
                     /locus_tag="YPTB_RS21600"
                     /old_locus_tag="pYV0026"
     CDS             complement(21282..21581)
                     /locus_tag="YPTB_RS21600"
                     /old_locus_tag="pYV0026"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395145.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system RelE/ParE family
                     toxin"
                     /protein_id="WP_002213360.1"
                     /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAK
                     NPELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
     gene            complement(21574..21816)
                     /locus_tag="YPTB_RS21605"
                     /old_locus_tag="pYV0027"
     CDS             complement(21574..21816)
                     /locus_tag="YPTB_RS21605"
                     /old_locus_tag="pYV0027"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395146.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type II toxin-antitoxin system ParD family
                     antitoxin"
                     /protein_id="WP_012414146.1"
                     /translation="MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEARE
                     QRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKGTSV"
     gene            complement(<21982..22274)
                     /locus_tag="YPTB_RS23455"
                     /pseudo
     CDS             complement(<21982..22274)
                     /locus_tag="YPTB_RS23455"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012606398.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS6 family transposase"
     gene            22698..23012
                     /locus_tag="YPTB_RS23460"
     CDS             22698..23012
                     /locus_tag="YPTB_RS23460"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002367338.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_071880002.1"
                     /translation="MFNASVSNWDHGPTWISNANVGNWDHGPTWISNVNVGNWDHGPT
                     WISNANVSNWDHGPTWISNANVGNWDHGPTWISNANVSNWDHGPTWISNANVGDWGHS
                     SA"
     gene            complement(23123..24085)
                     /locus_tag="YPTB_RS21615"
                     /old_locus_tag="pYV0031"
     CDS             complement(23123..24085)
                     /locus_tag="YPTB_RS21615"
                     /old_locus_tag="pYV0031"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395148.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_072083437.1"
                     /translation="MKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSGM
                     KGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLTS
                     GQQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYRP
                     TSAYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPNE
                     LSARSGEALSKAYENNVDTLKRVTYKIMKQKQEGRQFTTEELIVLLMPERKQPENIHK
                     KSFGKNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
     gene            complement(24085..25251)
                     /locus_tag="YPTB_RS21620"
                     /old_locus_tag="pYV0032"
     CDS             complement(24085..25251)
                     /locus_tag="YPTB_RS21620"
                     /old_locus_tag="pYV0032"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395149.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_002220902.1"
                     /translation="MDLKSTLDRCIERGQFMTQEIAKSQFGNDSPAARTITRRWRITE
                     AAELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDMRDVFKTRLSKPK
                     GENPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQATASLYHGYVPDL
                     HIHEEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIYGLHDQGKLPV
                     APHLLLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQ
                     FFTMLRDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGMVLKEVVRV
                     TDEVGKGQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRWENA"
     gene            25867..25998
                     /locus_tag="YPTB_RS23465"
     CDS             25867..25998
                     /locus_tag="YPTB_RS23465"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002421005.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_071880000.1"
                     /translation="MRLNRISVLLLWGLFDNELHVEFEGEWTGPYYPISGPTLLNVV"
     gene            complement(26051..26347)
                     /locus_tag="YPTB_RS21625"
                     /old_locus_tag="pYV0034"
     CDS             complement(26051..26347)
                     /locus_tag="YPTB_RS21625"
                     /old_locus_tag="pYV0034"
                     /inference="COORDINATES: protein motif:HMM:PF00665.24"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_080393460.1"
                     /translation="METRPREKRLLFHSDQGGQYRSKKSRQLLWRTGVMQSMSRRGNC
                     LDNSPMERVFRSLKSEWLPVGGYMDVHHAVRDIGEWIQSYYNTPPSAQWWITAL"
     gene            26591..26845
                     /locus_tag="YPTB_RS23470"
     CDS             26591..26845
                     /locus_tag="YPTB_RS23470"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_017204799.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_074007957.1"
                     /translation="MATRQTTFPHQPASQPATHVITRLTHQQTQCSVAGCSPALLMQF
                     TQLQTFYINPQIQRSRVNTARYFEQAAQFDHWPFCFQPCD"
     gene            complement(26842..27123)
                     /locus_tag="YPTB_RS21635"
     CDS             complement(26842..27123)
                     /locus_tag="YPTB_RS21635"
                     /inference="COORDINATES: protein motif:HMM:PF01527.18"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_086025331.1"
                     /translation="MNSNWKLLSRVVKYQRSTIEVARALELDPSQLRKWIHQYKEEVS
                     GVTPDNPALIPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLR"
     gene            complement(27269..27886)
                     /locus_tag="YPTB_RS21640"
     CDS             complement(27269..27886)
                     /locus_tag="YPTB_RS21640"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002229770.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraT"
                     /protein_id="WP_071879999.1"
                     /translation="MKTQMSETIWLEPSSQKTVYLQIKNTSDKNMLGLAPKITKAVQD
                     KGYTVTSSPEDAHYWIQANVLKADKMDLREAEGFLSQGYQGAALGAGITGYNSNSAGA
                     TLGVGLAAGLVGMAANAMVEDINYTMVTDVQISEKTDTTLQTDNVAALKQGTSGYKVQ
                     TSTQTGNKHQYQTRVVSSANKVNLKFEEARPVLEDQLAKSIANIL"
     gene            complement(27894..28007)
                     /locus_tag="YPTB_RS23475"
                     /old_locus_tag="pYV0038"
     CDS             complement(27894..28007)
                     /locus_tag="YPTB_RS23475"
                     /old_locus_tag="pYV0038"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_002229771.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002229771.1"
                     /translation="MEDDMKKNMKLIAMTAVLSSVLVLSGCGAMSTAIKKT"
     gene            complement(28491..29039)
                     /locus_tag="YPTB_RS21645"
                     /old_locus_tag="pYV0040"
     CDS             complement(28491..29039)
                     /locus_tag="YPTB_RS21645"
                     /old_locus_tag="pYV0040"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191373.1"
                     /translation="MFIKDTYNMRALCTALEQSAPDTIINTSKEENNSYYCATAHLLR
                     TDVCSLVNRVGIEPLKSGSILSTLEELWQAVGIVYRLYEWQHVSDIDTNFKKLPNNSD
                     FGLVFSVLDCDIEYVFIGKKDSEGNIEFYDPKNSLLIENDDIKKYLYDENFHRFCIML
                     IISKSELEELSRESCDQECIMG"
     gene            29513..30481
                     /locus_tag="YPTB_RS21650"
                     /old_locus_tag="pYV0041"
     CDS             29513..30481
                     /locus_tag="YPTB_RS21650"
                     /old_locus_tag="pYV0041"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395155.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine protease"
                     /protein_id="WP_011191374.1"
                     /translation="MNSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSH
                     SNLQKKLSATIKHNQSGRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAV
                     RESVANYGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRSHAQGQSLFDQL
                     YVGGRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPV
                     DVTGTTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPN
                     FGEFHFSDKEKFRKWFTNSFWDNSMYHYPLGVGQRFRVLTFDSKEV"
     gene            30481..30873
                     /locus_tag="YPTB_RS21655"
                     /old_locus_tag="pYV0042"
     CDS             30481..30873
                     /locus_tag="YPTB_RS21655"
                     /old_locus_tag="pYV0042"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395156.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_011191375.1"
                     /translation="MQTTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYH
                     QQWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLE
                     RFIDDIEQRKEPQNTKFQPNSTSPILFI"
     gene            complement(30917..31306)
                     /locus_tag="YPTB_RS21660"
     CDS             complement(30917..31306)
                     /locus_tag="YPTB_RS21660"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395157.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_072085134.1"
                     /translation="MQHPVSFPSFSFHDNSIFCNKPIVGTMNINADHEKNLKVSIIYK
                     IQLIGGITEILNGGVINWGRFNLAGYFKSSISLIKIIIIDNTNLVMLYVKIWINNENF
                     LIYSELKTNELLYKPYLLNLIDIIVTM"
     gene            <31279..31559
                     /locus_tag="YPTB_RS23485"
                     /old_locus_tag="pYV0043"
                     /pseudo
     CDS             <31279..31559
                     /locus_tag="YPTB_RS23485"
                     /old_locus_tag="pYV0043"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011176793.1"
                     /note="frameshifted; incomplete; partial in the middle of
                     a contig; missing start; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS6 family transposase"
     gene            31576..31995
                     /locus_tag="YPTB_RS21665"
                     /old_locus_tag="pYV0044"
     CDS             31576..31995
                     /locus_tag="YPTB_RS21665"
                     /old_locus_tag="pYV0044"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395158.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191376.1"
                     /translation="MSKIPTLIICSKPAEIAVGHFITMSIKAILLYSYQEYGQHTDVF
                     IQVKFNYGMIEYKFYVNKVKFDNTPGRKLKTTIAHSSQLMGHNLTYEDYAMKKRLVIA
                     TALCAAFYAGMKVEHFLTVDACLDAGGAMQNDIFCER"
     gene            <32872..33189
                     /locus_tag="YPTB_RS21670"
                     /pseudo
     CDS             <32872..33189
                     /locus_tag="YPTB_RS21670"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001004113.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
     gene            complement(33232..34821)
                     /locus_tag="YPTB_RS21675"
                     /old_locus_tag="pYV0047"
     CDS             complement(33232..34821)
                     /locus_tag="YPTB_RS21675"
                     /old_locus_tag="pYV0047"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012414153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="effector protein"
                     /protein_id="WP_041175528.1"
                     /translation="MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWS
                     EWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNS
                     LTELPELPQSLKSLQVENNNLKALPDLPPSLKKLHVRENDLTDLPELPQSLESLRVDN
                     NNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPSLKKL
                     HVRENDLTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPF
                     LAAIYADNNLLETLPDLPPHLEILVASYNSLTELPELPQSLKSLRVDNNNLKALSDLP
                     PSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPSLKKLHVRENDLTDL
                     PELPQSLTFLDVSDNNISGLSELPPNLYYLDASSNEIRSLCDLPPSLVDLNVKSNQLS
                     ELPALPPHLERLIASFNYLAEVPELPQNLKQLHVEQNALREFPDIPESLEELEMDSER
                     VVDPYEFAHETTDKLEDDVFE"
     gene            complement(35209..35424)
                     /locus_tag="YPTB_RS21680"
                     /old_locus_tag="pYV0049"
     CDS             complement(35209..35424)
                     /locus_tag="YPTB_RS21680"
                     /old_locus_tag="pYV0049"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_011191379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191379.1"
                     /translation="MNSLSFHDNSIFCNKPKYSDAEVAQTLDTAQKHTLTVSKGVLDT
                     AKQYTNTVSSNTLDSANTYTNNKADSH"
     gene            35445..36083
                     /locus_tag="YPTB_RS23490"
                     /pseudo
     CDS             35445..36083
                     /locus_tag="YPTB_RS23490"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_012548890.1"
                     /note="frameshifted; internal stop; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS6 family transposase"
     gene            complement(36551..37471)
                     /locus_tag="YPTB_RS21685"
                     /old_locus_tag="pYV0054"
     CDS             complement(36551..37471)
                     /locus_tag="YPTB_RS21685"
                     /old_locus_tag="pYV0054"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395162.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002212987.1"
                     /translation="MTINIKTDSPIITTGSQLDAITTETVKQSGEIKKTEDTRHEAQA
                     IKSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQ
                     QRDIENKATITAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQ
                     EQILNSNIAGREQLIDTKMQQMSNIGDKAVSREDIGRIWKPEQVADQNKLALLDKEFR
                     MTDSKANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNY
                     NDNFMKDVLRLIEQYVSSHTHAMKAAFGVV"
     gene            complement(37490..38695)
                     /locus_tag="YPTB_RS21690"
                     /old_locus_tag="pYV0055"
     CDS             complement(37490..38695)
                     /locus_tag="YPTB_RS21690"
                     /old_locus_tag="pYV0055"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191382.1"
                     /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGG
                     VSSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLAS
                     PDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKS
                     GIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLIS
                     QEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSA
                     KVAQISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKK
                     QADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLH
                     NLAGRPHTV"
     gene            complement(38673..39179)
                     /locus_tag="YPTB_RS21695"
                     /old_locus_tag="pYV0056"
     CDS             complement(38673..39179)
                     /locus_tag="YPTB_RS21695"
                     /old_locus_tag="pYV0056"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001004068.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="CesD/SycD/LcrH family type III secretion system
                     chaperone"
                     /protein_id="WP_011117633.1"
                     /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAF
                     NQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIK
                     EPRFPFHAAECLLQKGELAEAESGLFLAQELIADKPEFKELSTRVSSMLEAIKLKKEM
                     EHECVDNP"
     gene            complement(39192..40172)
                     /locus_tag="YPTB_RS21700"
                     /old_locus_tag="pYV0057"
     CDS             complement(39192..40172)
                     /locus_tag="YPTB_RS21700"
                     /old_locus_tag="pYV0057"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395165.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Virulence-associated V antigen"
                     /protein_id="WP_011191383.1"
                     /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNI
                     DISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVK
                     EFLESSPNTQWELRAFMAVIHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAEL
                     TAELKIYSVIQAEINKHLSSGGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEK
                     MPQTTIQEGETEKKIVSIKNFLESEKKRTGALGNLKDSYSYNKDNNELSHFATTCSDK
                     SRPLNDLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK"
     gene            complement(40174..40461)
                     /locus_tag="YPTB_RS21705"
                     /old_locus_tag="pYV0058"
     CDS             complement(40174..40461)
                     /locus_tag="YPTB_RS21705"
                     /old_locus_tag="pYV0058"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395166.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein G"
                     /protein_id="WP_002212973.1"
                     /translation="MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAV
                     MKIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII"
     gene            complement(40503..40943)
                     /locus_tag="YPTB_RS21710"
                     /old_locus_tag="pYV0059"
     CDS             complement(40503..40943)
                     /locus_tag="YPTB_RS21710"
                     /old_locus_tag="pYV0059"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395167.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein R"
                     /protein_id="WP_002220918.1"
                     /translation="MMADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRV
                     EIEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLS
                     TQRLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
     gene            complement(40940..43054)
                     /locus_tag="YPTB_RS21715"
                     /old_locus_tag="pYV0060"
     CDS             complement(40940..43054)
                     /locus_tag="YPTB_RS21715"
                     /old_locus_tag="pYV0060"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395168.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscV/YscV/HrcV family type III secretion system
                     export apparatus protein"
                     /protein_id="WP_002212971.1"
                     /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILI
                     AVNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIV
                     YTFGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDG
                     DMRAGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIG
                     VTQKGLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGK
                     QVVAQPKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDL
                     QSILTSGSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALND
                     ELVRVRRALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESV
                     SQLELLGIPYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREY
                     AEDFIGIQETRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSIL
                     EAMVEWGQKEKDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQ
                     TSAGSYLALEPAVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGL
                     PVLSYQELTQQINIQPLGRICL"
     gene            complement(43041..43385)
                     /locus_tag="YPTB_RS21720"
                     /old_locus_tag="pYV0061"
     CDS             complement(43041..43385)
                     /locus_tag="YPTB_RS21720"
                     /old_locus_tag="pYV0061"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395169.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein YscY"
                     /protein_id="WP_002229791.1"
                     /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHL
                     AGRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQ
                     HYLELKDHNESP"
     gene            complement(43382..43750)
                     /locus_tag="YPTB_RS21725"
                     /old_locus_tag="pYV0062"
     CDS             complement(43382..43750)
                     /locus_tag="YPTB_RS21725"
                     /old_locus_tag="pYV0062"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395170.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation protein YopX"
                     /protein_id="WP_002212969.1"
                     /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHL
                     ERLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALL
                     KCQQDDDRLLQIILNLLHKV"
     gene            complement(43747..44118)
                     /gene="sycN"
                     /locus_tag="YPTB_RS21730"
                     /old_locus_tag="pYV0063"
     CDS             complement(43747..44118)
                     /gene="sycN"
                     /locus_tag="YPTB_RS21730"
                     /old_locus_tag="pYV0063"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395171.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein SycN"
                     /protein_id="WP_002229794.1"
                     /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGA
                     TLTLWLARSLAWHRCEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLT
                     LPLLHQAFEQLLRLQQEVLAP"
     gene            complement(44105..44383)
                     /locus_tag="YPTB_RS21735"
                     /old_locus_tag="pYV0064"
     CDS             complement(44105..44383)
                     /locus_tag="YPTB_RS21735"
                     /old_locus_tag="pYV0064"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395172.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TyeA family type III secretion system gatekeeper
                     subunit"
                     /protein_id="WP_002212965.1"
                     /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRF
                     YQDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
     gene            complement(44364..45245)
                     /locus_tag="YPTB_RS21740"
                     /old_locus_tag="pYV0065"
     CDS             complement(44364..45245)
                     /locus_tag="YPTB_RS21740"
                     /old_locus_tag="pYV0065"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395173.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YopN family type III secretion system gatekeeper
                     subunit"
                     /protein_id="WP_011191384.1"
                     /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSG
                     TLQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQN
                     VSELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVE
                     QALVSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSD
                     LQKRFPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVINDLQKLKEFGSVSDQVK
                     GFWQFFSEGKTNGVRPF"
     gene            45443..46762
                     /locus_tag="YPTB_RS21745"
                     /old_locus_tag="pYV0067"
     CDS             45443..46762
                     /locus_tag="YPTB_RS21745"
                     /old_locus_tag="pYV0067"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395174.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscN/YscN/HrcN family type III secretion system
                     ATPase"
                     /protein_id="WP_002212955.1"
                     /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRI
                     GELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEH
                     LLGQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCG
                     EGQRMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRK
                     AVLVVATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAG
                     EPPTRRGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDG
                     HIILSRKLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQI
                     GEYQKGQDKEADQAIERMGAIRGWLCQGTHELSHFNETLNLLETLTQ"
     gene            46759..47223
                     /locus_tag="YPTB_RS21750"
                     /old_locus_tag="pYV0068"
     CDS             46759..47223
                     /locus_tag="YPTB_RS21750"
                     /old_locus_tag="pYV0068"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395175.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation protein YopO"
                     /protein_id="WP_002212952.1"
                     /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDY
                     HLWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERE
                     RLTLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
     gene            47223..48590
                     /locus_tag="YPTB_RS21755"
                     /old_locus_tag="pYV0069"
     CDS             47223..48590
                     /locus_tag="YPTB_RS21755"
                     /old_locus_tag="pYV0069"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395176.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation protein YopP"
                     /protein_id="WP_011191386.1"
                     /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHP
                     KEESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLS
                     PLAEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHD
                     ELFVQQSPIDSAQPVQLNTKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQK
                     RLAEEPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSE
                     QLDMTELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVVTPGD
                     HLLATMRATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEI
                     PGKLHVELIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEE
                     WEAEE"
     gene            48587..49510
                     /locus_tag="YPTB_RS21760"
                     /old_locus_tag="pYV0070"
     CDS             48587..49510
                     /locus_tag="YPTB_RS21760"
                     /old_locus_tag="pYV0070"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395177.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YscQ/HrcQ family type III secretion apparatus
                     protein"
                     /protein_id="WP_002212948.1"
                     /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSS
                     LNCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKL
                     VCNDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILIS
                     LRWHKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGM
                     SHESDELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLL
                     ANGRLLGHGRLVEIQGRLGVRIERLTEVTIS"
     gene            49507..50160
                     /locus_tag="YPTB_RS21765"
                     /old_locus_tag="pYV0071"
     CDS             49507..50160
                     /locus_tag="YPTB_RS21765"
                     /old_locus_tag="pYV0071"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395178.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscR/YscR/HrcR family type III secretion system
                     export apparatus protein"
                     /protein_id="WP_002212947.1"
                     /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNAL
                     GVQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPY
                     RMFLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFL
                     IYLPFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
     gene            50162..50428
                     /locus_tag="YPTB_RS21770"
                     /old_locus_tag="pYV0072"
     CDS             50162..50428
                     /locus_tag="YPTB_RS21770"
                     /old_locus_tag="pYV0072"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395179.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscS/YscS/HrcS family type III secretion system
                     export apparatus protein"
                     /protein_id="WP_002212945.1"
                     /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQI
                     QEQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
     gene            50425..51210
                     /locus_tag="YPTB_RS21775"
                     /old_locus_tag="pYV0073"
     CDS             50425..51210
                     /locus_tag="YPTB_RS21775"
                     /old_locus_tag="pYV0073"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395180.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscT/YscT/HrcT family type III secretion system
                     export apparatus protein"
                     /protein_id="WP_002212938.1"
                     /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGI
                     VCSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVD
                     NQRGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVAS
                     FFPAVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLA
                     MPIKSAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
     gene            51210..52274
                     /locus_tag="YPTB_RS21780"
                     /old_locus_tag="pYV0074"
     CDS             51210..52274
                     /locus_tag="YPTB_RS21780"
                     /old_locus_tag="pYV0074"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395181.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscU/YscU/HrcU family type III secretion system
                     export apparatus switch protein"
                     /protein_id="WP_002212936.1"
                     /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMG
                     LSDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASH
                     VVQYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKG
                     NLVTLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSK
                     DEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRG
                     ETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEAT
                     AEVLRWLERQNIEKQHSEML"
     gene            52850..53245
                     /locus_tag="YPTB_RS21785"
                     /old_locus_tag="pYV0075"
     CDS             52850..53245
                     /locus_tag="YPTB_RS21785"
                     /old_locus_tag="pYV0075"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395182.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system chaperone YscW"
                     /protein_id="WP_002222527.1"
                     /translation="MSRIIALIISFLLVGCATPPMPAQRIVGEVRMSRPLSRIAHIDV
                     SMFGLYEGKVREVQRTHFETGNLPLFFSIKLNPAQRGEGELYLRSTLSFPERGVQAVA
                     QQKLTGKNKVVLQMIPKTCYPNCQLPNTR"
     gene            53369..54184
                     /locus_tag="YPTB_RS21790"
                     /old_locus_tag="pYV0076"
     CDS             53369..54184
                     /locus_tag="YPTB_RS21790"
                     /old_locus_tag="pYV0076"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395183.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermoregulatory protein LcrF"
                     /protein_id="WP_002212931.1"
                     /translation="MASLEIIKLEWVTPIFKVVEHSQDGLYILLQGQISWQSSGQTYD
                     LDEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIGRDNSTPK
                     PLLIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRH
                     LGNRPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRI
                     LYAHQLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
     gene            54263..54361
                     /locus_tag="YPTB_RS21795"
                     /old_locus_tag="pYV0077"
     CDS             54263..54361
                     /locus_tag="YPTB_RS21795"
                     /old_locus_tag="pYV0077"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395184.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation protein YopA"
                     /protein_id="WP_011191387.1"
                     /translation="MSQISTKHRTVLFRRWMAIICCLIINMAYLVY"
     gene            54587..55000
                     /locus_tag="YPTB_RS21800"
                     /old_locus_tag="pYV0078"
     CDS             54587..55000
                     /locus_tag="YPTB_RS21800"
                     /old_locus_tag="pYV0078"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395185.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein YscB"
                     /protein_id="WP_002212925.1"
                     /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELV
                     LRTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQEL
                     DTHGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
     gene            55006..56829
                     /locus_tag="YPTB_RS21805"
                     /old_locus_tag="pYV0079"
     CDS             55006..56829
                     /locus_tag="YPTB_RS21805"
                     /old_locus_tag="pYV0079"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395186.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscC/YscC/HrcC family type III secretion system
                     outer membrane ring protein"
                     /protein_id="WP_011191388.1"
                     /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGES
                     LRDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLY
                     IFKNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLEL
                     VEQTAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRV
                     LSDATIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALD
                     KPSARIEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGS
                     LIDARGLDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAE
                     LKGITYGTMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVA
                     RVGHGQSLIIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRI
                     IDEGIAHHLALGNGRDLRTGILAVDEISNQSTTLNKLLGVSQCQPLNKAQEVQKWLSQ
                     NNKSSYLTQCKMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
     gene            56826..58085
                     /locus_tag="YPTB_RS21810"
                     /old_locus_tag="pYV0080"
     CDS             56826..58085
                     /locus_tag="YPTB_RS21810"
                     /old_locus_tag="pYV0080"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395187.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscD/YscD/HrpQ family type III secretion system
                     inner membrane ring protein"
                     /protein_id="WP_002212919.1"
                     /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAP
                     VHLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPE
                     TLQVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEV
                     RRLLATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSME
                     ELRQGAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGV
                     ESKVRIAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFR
                     QEFGNRPKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRI
                     LAIRRDAVIVSKGKREFVIQLNGGKPR"
     gene            58082..58282
                     /locus_tag="YPTB_RS21815"
                     /old_locus_tag="pYV0081"
     CDS             58082..58282
                     /locus_tag="YPTB_RS21815"
                     /old_locus_tag="pYV0081"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscE/YscE/SsaE family type III secretion system
                     needle protein co-chaperone"
                     /protein_id="WP_002212917.1"
                     /translation="MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVW
                     QRESKALESAIAIIHYVAGDLK"
     gene            58283..58546
                     /locus_tag="YPTB_RS21820"
                     /old_locus_tag="pYV0082"
     CDS             58283..58546
                     /locus_tag="YPTB_RS21820"
                     /old_locus_tag="pYV0082"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395189.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscF/YscF/HrpA family type III secretion system
                     needle major subunit"
                     /protein_id="WP_002212916.1"
                     /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDK
                     PDNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
     gene            58548..58895
                     /locus_tag="YPTB_RS21825"
                     /old_locus_tag="pYV0083"
     CDS             58548..58895
                     /locus_tag="YPTB_RS21825"
                     /old_locus_tag="pYV0083"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395190.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion protein, YscG family"
                     /protein_id="WP_011191389.1"
                     /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLI
                     RLSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRI
                     QTFVNGMREQLKT"
     gene            58892..59389
                     /locus_tag="YPTB_RS21830"
                     /old_locus_tag="pYV0084"
     CDS             58892..59389
                     /locus_tag="YPTB_RS21830"
                     /old_locus_tag="pYV0084"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395191.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation protein YopH"
                     /protein_id="WP_011191390.1"
                     /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAE
                     KTREVLWQQYYASNPPDHAVLEVLAMPVREALLARFGQHQGSVVPAIDLPELRSVLQQ
                     FDSFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQ
                     IDMDT"
     gene            59390..59737
                     /locus_tag="YPTB_RS21835"
                     /old_locus_tag="pYV0085"
     CDS             59390..59737
                     /locus_tag="YPTB_RS21835"
                     /old_locus_tag="pYV0085"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395192.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscI/YscI/HrpB family type III secretion system
                     inner rod protein"
                     /protein_id="WP_002212914.1"
                     /translation="MPNIEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGL
                     GHSLLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAG
                     RMSQNVETLSKGG"
     gene            59744..60478
                     /locus_tag="YPTB_RS21840"
                     /old_locus_tag="pYV0086"
     CDS             59744..60478
                     /locus_tag="YPTB_RS21840"
                     /old_locus_tag="pYV0086"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395193.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="EscJ/YscJ/HrcJ family type III secretion inner
                     membrane ring protein"
                     /protein_id="WP_002212912.1"
                     /translation="MKVKTSLSTLILILFLTGCKVDLYTGISQKEGNEMLALLRQEGL
                     SADKEPDKDGKIKLLVEESDVAQAIDILKRKGYPHESFSTLQDVFPKDGLISSPIEEL
                     ARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNNKGKKGVAASASVFIKHAADIQF
                     DTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSHLPRNTSILSIQVSEESKGHL
                     IGLLSLLILLLPVTNLAQYFWLQRKK"
     gene            60478..61107
                     /locus_tag="YPTB_RS21845"
                     /old_locus_tag="pYV0087"
     CDS             60478..61107
                     /locus_tag="YPTB_RS21845"
                     /old_locus_tag="pYV0087"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395194.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation protein YopK"
                     /protein_id="WP_002361471.1"
                     /translation="MMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHL
                     NAALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQ
                     LLTLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQ
                     AWCKRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVTPTCSHLFK"
     gene            61053..61718
                     /locus_tag="YPTB_RS21850"
                     /old_locus_tag="pYV0088"
     CDS             61053..61718
                     /locus_tag="YPTB_RS21850"
                     /old_locus_tag="pYV0088"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395195.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="HrpE/YscL family type III secretion apparatus
                     protein"
                     /protein_id="WP_010981371.1"
                     /translation="MSQTCQTGYAYMQPFVQIIPSNLSLACGLRILRAEDYQSSLTTE
                     ELISAAKQDAEKILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHV
                     EQQMSEVVLLAVRKILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQI
                     AKVHKDFPEISYLEVTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMK
                     VTE"
     gene            61943..62290
                     /locus_tag="YPTB_RS21855"
                     /old_locus_tag="pYV0089"
     CDS             61943..62290
                     /locus_tag="YPTB_RS21855"
                     /old_locus_tag="pYV0089"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395196.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="translocation protein YopM"
                     /protein_id="WP_002212907.1"
                     /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEK
                     AFANEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLL
                     LEAAMRQDTAADG"
     gene            62517..62690
                     /locus_tag="YPTB_RS23645"
                     /pseudo
     CDS             62517..62690
                     /locus_tag="YPTB_RS23645"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:YP_001004101.1"
                     /note="internal stop; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
     gene            62838..63854
                     /locus_tag="YPTB_RS23495"
                     /pseudo
     CDS             62838..63854
                     /locus_tag="YPTB_RS23495"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611456.1"
                     /note="frameshifted; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            <63873..64145
                     /locus_tag="YPTB_RS23500"
                     /old_locus_tag="pYV0093"
                     /pseudo
     CDS             <63873..64145
                     /locus_tag="YPTB_RS23500"
                     /old_locus_tag="pYV0093"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395426.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS256 family transposase"
     gene            complement(64366..65772)
                     /locus_tag="YPTB_RS21875"
                     /old_locus_tag="pYV0094"
     CDS             complement(64366..65772)
                     /locus_tag="YPTB_RS21875"
                     /old_locus_tag="pYV0094"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395201.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein phosphatase YopH"
                     /protein_id="WP_002213278.1"
                     /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTI
                     ASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVS
                     LRSDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPP
                     LPPRERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYL
                     QACGGEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAE
                     NRTPVLAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTL
                     TIREAGQKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVG
                     DDSKLRPVIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQ
                     LDVLIKLAEGQGRPLLNS"
     gene            <66111..66689
                     /locus_tag="YPTB_RS21880"
                     /old_locus_tag="pYV0095"
                     /pseudo
     CDS             <66111..66689
                     /locus_tag="YPTB_RS21880"
                     /old_locus_tag="pYV0095"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:WP_076611505.1"
                     /note="incomplete; partial in the middle of a contig;
                     missing start; Derived by automated computational analysis
                     using gene prediction method: Protein Homology."
                     /pseudo
                     /codon_start=1
                     /transl_table=11
                     /product="IS3 family transposase"
     gene            complement(67275..68141)
                     /locus_tag="YPTB_RS21885"
                     /old_locus_tag="pYV0098"
     CDS             complement(67275..68141)
                     /locus_tag="YPTB_RS21885"
                     /old_locus_tag="pYV0098"
                     /inference="COORDINATES: similar to AA
                     sequence:RefSeq:NP_395205.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="effector protein YopJ"
                     /protein_id="WP_002225474.1"
                     /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSW
                     FHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIIN
                     MGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSM
                     VEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLPHDKLDPYL
                     PVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHK
                     KRIAEYKTLLKV"
CONTIG      join(BX936399.2:1..68525)
//
DBGET integrated database retrieval system