GenomeNet

Database: RefSeq
Entry: NC_006153
LinkDB: NC_006153
Original site: NC_006153 
LOCUS       NC_006153              68525 bp    DNA     circular CON 07-FEB-2015
DEFINITION  Yersinia pseudotuberculosis IP32953 pYV plasmid, complete sequence.
ACCESSION   NC_006153
VERSION     NC_006153.2  GI:113911685
DBLINK      BioProject: PRJNA224116
            Assembly: GCF_000047365.1
KEYWORDS    RefSeq.
SOURCE      Yersinia pseudotuberculosis IP 32953
  ORGANISM  Yersinia pseudotuberculosis IP 32953
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Yersinia.
REFERENCE   1
  AUTHORS   Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O.,
            Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L.,
            Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C.,
            Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D.,
            Elliott,J.M., Derbise,A., Hauser,L.J. and Garcia,E.
  TITLE     Insights into the evolution of Yersinia pestis through whole-genome
            comparison with Yersinia pseudotuberculosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004)
   PUBMED   15358858
REFERENCE   2  (bases 1 to 68525)
  AUTHORS   Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2004) Biology and Biotechnology Research Program,
            Lawrence Livermore National Laboratory, Livermore, CA 94550 USA,
            Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15,
            France, and the Genome Analysis Group, Oak Ridge National
            Laboratory, Oak Ridge, TN 37831 USA
COMMENT     VALIDATED REFSEQ: This record has undergone validation or
            preliminary review.
            On Sep 1, 2006 this sequence version replaced gi:51593846.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider          :: NCBI
            Annotation Date              :: 11/04/2014 01:53:08
            Annotation Pipeline          :: NCBI Prokaryotic Genome Annotation
                                            Pipeline
            Annotation Method            :: Best-placed reference protein set;
                                            GeneMarkS+
            Annotation Software revision :: 2.9 (rev. 450998)
            Features Annotated           :: Gene; CDS; rRNA; tRNA; ncRNA;
                                            repeat_region
            Genes                        :: 4,409
            CDS                          :: 4,238
            Pseudo Genes                 :: 52
            CRISPR Arrays                :: 2
            rRNAs                        :: 22 ( 5S, 16S, 23S )
            tRNAs                        :: 82
            ncRNA                        :: 15
            Frameshifted Genes           :: 42
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..68525
                     /organism="Yersinia pseudotuberculosis IP 32953"
                     /mol_type="genomic DNA"
                     /strain="IP 32953"
                     /db_xref="taxon:273123"
                     /plasmid="pYV"
     gene            complement(12..2210)
                     /locus_tag="YPTB_RS21465"
                     /old_locus_tag="pYV0001"
     CDS             complement(12..2210)
                     /locus_tag="YPTB_RS21465"
                     /old_locus_tag="pYV0001"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9RI12.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein kinase YpkA"
                     /protein_id="WP_011191359.1"
                     /db_xref="GI:499504719"
                     /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRII
                     DNQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPN
                     ALSNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRL
                     VAKIERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVD
                     GWRCSDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNV
                     VFDRASGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLH
                     CIEGFEKNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVS
                     ADSRPDSNEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSD
                     LLRTHLSSAATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVI
                     EDYVKGREGDTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAH
                     KHLETLLEVLVTLSQQGQPVSSETYGFLNRLAEAKITLSQQLNTLQQQQESAKAQLSI
                     LINRSGSWADVARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDD
                     MRNFTVDSIPLLIQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
     gene            complement(2218..2667)
                     /locus_tag="YPTB_RS21470"
                     /old_locus_tag="pYV0002"
     CDS             complement(2218..2667)
                     /locus_tag="YPTB_RS21470"
                     /old_locus_tag="pYV0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002229809.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone Tir"
                     /protein_id="WP_002229809.1"
                     /db_xref="GI:488158601"
                     /translation="MINTTFTELLPKIASHFGLDKLSQDEYGLCELILNDRVVIMLRA
                     DEILNRLTLLGPILGFSGPEARSAASQLFFCYSINALNKDGPCFAWSEELGLIAFKHL
                     SLDELNVENVSKEIANFYDWLSLVSLPAETQQELPLHTQSTQSVKWG"
     gene            complement(2919..3155)
                     /locus_tag="YPTB_RS21475"
     CDS             complement(2919..3155)
                     /locus_tag="YPTB_RS21475"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012414138.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012414138.1"
                     /db_xref="GI:501382572"
                     /translation="MQSMSRRGNCLDNSPMERVFRSLKSEWLPVGGYMDVHHAVRDIG
                     EWGYKVITTHPHRHNGGLPPCEYEEQGKKATKVS"
     gene            complement(4823..5689)
                     /locus_tag="YPTB_RS21480"
                     /old_locus_tag="pYV0005"
     CDS             complement(4823..5689)
                     /locus_tag="YPTB_RS21480"
                     /old_locus_tag="pYV0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002225475.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_002225475.1"
                     /db_xref="GI:488154267"
                     /translation="MTNHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGF
                     TSRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNLAI
                     ECGLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFSA
                     LDVSDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAH
                     GLKRARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSR
                     NNNYTRLATGAT"
     gene            complement(5682..5756)
                     /locus_tag="YPTB_RS21485"
     CDS             complement(5682..5756)
                     /locus_tag="YPTB_RS21485"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002233140.1"
                     /note="acts to regulate the expression of the plasmid
                     replication protein RepA in the IncFII plasmid group;
                     Derived by automated computational analysis using gene
                     prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepA leader peptide Tap-containing protein"
                     /protein_id="WP_002233140.1"
                     /db_xref="GI:488161932"
                     /translation="MFRKVQYLLRLLLLPCNISAGRCD"
     gene            complement(5998..6252)
                     /locus_tag="YPTB_RS21490"
                     /old_locus_tag="pYV0007"
     CDS             complement(5998..6252)
                     /locus_tag="YPTB_RS21490"
                     /old_locus_tag="pYV0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002229817.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="WP_002229817.1"
                     /db_xref="GI:488158609"
                     /translation="MSQIENAVTSSSKRAYRKGNPLTGAEKQRMSVSRKKETHKAINV
                     FIQNDLKNELLQLCEDSGLTQTEMIERWIQREKAARTNAA"
     gene            complement(6390..6638)
                     /locus_tag="YPTB_RS21495"
     CDS             complement(6390..6638)
                     /locus_tag="YPTB_RS21495"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002233137.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="phospholipase"
                     /protein_id="WP_032466929.1"
                     /db_xref="GI:694126340"
                     /translation="MDLLVNAGIPVRTVNSFKALHDKVIIVDGKNTQMGSFNFSQAAV
                     QSNSENVLIIWGDFTVVQAYLQHWQSRWNKGTDWRSSY"
     gene            complement(7055..7462)
                     /locus_tag="YPTB_RS21500"
     CDS             complement(7055..7462)
                     /locus_tag="YPTB_RS21500"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_012414142.1"
                     /db_xref="GI:501382576"
                     /translation="MVELCRLLKITRSVYSASLNLRVDVKRLQLRELHQQSRGAAGNR
                     TLSLLMRQSGYNVGRWLAGRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPS
                     EPNRVWSGYISYIKVNGGWCYLALVIDLYSFHW"
     gene            complement(7489..7806)
                     /locus_tag="YPTB_RS21505"
                     /old_locus_tag="pYV0009"
     CDS             complement(7489..7806)
                     /locus_tag="YPTB_RS21505"
                     /old_locus_tag="pYV0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213008.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213244.1"
                     /db_xref="GI:488142036"
                     /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQL
                     RKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIK
                     SLR"
     gene            complement(7978..8436)
                     /locus_tag="YPTB_RS21510"
                     /old_locus_tag="pYV0010"
     CDS             complement(7978..8436)
                     /locus_tag="YPTB_RS21510"
                     /old_locus_tag="pYV0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213246.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="putative DNA helicase TraI"
                     /protein_id="WP_002213246.1"
                     /db_xref="GI:488142038"
                     /translation="MGGMAAHWFTYQYAVPFCGRAKTLVTLSNAEGESVLISPQQNTA
                     QDISLFMPRELTVSQGDRVRFTRSDTDRGYVANSLWEVAGFTEDGAVRFRQGDQEKIV
                     DPQKATEDRHIDLAYTLTAYGVQGASERFVIALFGAEGGRKRMATLHLFT"
     gene            8586..8774
                     /locus_tag="YPTB_RS21515"
                     /old_locus_tag="pYV0011"
     CDS             8586..8774
                     /locus_tag="YPTB_RS21515"
                     /old_locus_tag="pYV0011"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213248.1"
                     /db_xref="GI:488142040"
                     /translation="MRKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKE
                     ILKQAAVLMSEFPIKSLR"
     gene            complement(8771..8980)
                     /locus_tag="YPTB_RS21520"
                     /old_locus_tag="pYV0012"
     CDS             complement(8771..8980)
                     /locus_tag="YPTB_RS21520"
                     /old_locus_tag="pYV0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191361.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191361.1"
                     /db_xref="GI:499504721"
                     /translation="MGNYMVSDEINRRNNLSDICYGHPIYVGCACINPNYINPQIQRS
                     RVNTARYFEQAAQFDHWPFCFQPCD"
     gene            complement(9103..10401)
                     /locus_tag="YPTB_RS21525"
                     /old_locus_tag="pYV0013"
     CDS             complement(9103..10401)
                     /locus_tag="YPTB_RS21525"
                     /old_locus_tag="pYV0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P10858.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="adhesin YadA"
                     /protein_id="WP_011191362.1"
                     /db_xref="GI:499504722"
                     /translation="MTKDFKISVSAALISALFSSPYAFAEEPEDGNDGIPRLSAVQIS
                     PNVDPKLGVGLYPAKPILRQENPKLPPRGPQGPEKKRARLAEAIQPQVLGGLDARAKG
                     IHSIAIGATAEAAKPAAVAVGAGSIATGVNSVAIGPLSKALGDSAVTYGASSTAQKDG
                     VAIGARASASDTGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDLSKTDRENSV
                     SIGHESLNRQLTHLAAGTKDNDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKH
                     SNSVARTTLETAEEHANKKSAEALVSAKVYADSNSSHTLKTANSYTDVTVSSSTKKAI
                     SESNQYTDHKFSQLDNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRS
                     SQALAIGSGYRVNESVALKAGVAYAGSSNVMYNASFNIEW"
     gene            11219..11389
                     /locus_tag="YPTB_RS21530"
     CDS             11219..11389
                     /locus_tag="YPTB_RS21530"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005176551.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041175524.1"
                     /db_xref="GI:752489504"
                     /translation="MHDALICVDDYNREKLAIEIDLNLPTQHVIRVLDRIVVNRGYPV
                     MGFEVQWDENVR"
     gene            complement(11386..13701)
                     /locus_tag="YPTB_RS21535"
                     /old_locus_tag="pYV0016"
     CDS             complement(11386..13701)
                     /locus_tag="YPTB_RS21535"
                     /old_locus_tag="pYV0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002220934.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213256.1"
                     /db_xref="GI:488142048"
                     /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRR
                     GKHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTR
                     REHTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILL
                     PGATTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLV
                     YDAEGRIQRAGYSLCLLERLQDALRRRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVC
                     RALGHPTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEE
                     PLSLLRLNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVL
                     MAEACNIGLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRW
                     GGGEVASVDGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLR
                     DSIFVLEGLLEQQTGLNPVEIMTDTAGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRV
                     DKSANYGALDELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSG
                     LAQAIMAVGRVNKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKR
                     YREGQEDQLGALGLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHIN
                     MLGHYTFTLSDDILNGELRALNFNLNNELSP"
     gene            13865..14416
                     /locus_tag="YPTB_RS21540"
                     /old_locus_tag="pYV0017"
     CDS             13865..14416
                     /locus_tag="YPTB_RS21540"
                     /old_locus_tag="pYV0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012228742.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="recombinase"
                     /protein_id="WP_002213258.1"
                     /db_xref="GI:488142050"
                     /translation="MRLFGYARVSTSQQSLDIQIKTLKDAGVKANRIFTDKASGSSAD
                     REGLDLLRMKVEEGDVILVKKLDRLGRDTVDMIQLIKEFDAQGVSIQFIDDGISTDGE
                     MGKMVVTILSAVAQAERQRILERTNEGREEAKLKGVKFGRKRRINRKELLELHEQGMG
                     ATEIAKKMNIARSTIYKVINESQ"
     gene            14435..14899
                     /locus_tag="YPTB_RS21545"
     CDS             14435..14899
                     /locus_tag="YPTB_RS21545"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012414143.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_012414143.1"
                     /db_xref="GI:501382577"
                     /translation="MNLQNNLHSILEKVESLKNIKMLDKNNGEFTYIEGNYYFSDLTT
                     DSLNIYEIKYLFTFENFDFFSNGKPNEVSVYKATNSFNSVCLGIKASLNSLDVERKEL
                     TVQFTYSMVFDASKGIPNFSNELETSMGLLRIAPKKLSNSFKDKGIEHNYVN"
     gene            15038..15367
                     /locus_tag="YPTB_RS21550"
     CDS             15038..15367
                     /locus_tag="YPTB_RS21550"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002229829.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_002229829.1"
                     /db_xref="GI:488158621"
                     /translation="MLTFFAKYYFDLFFNKEKNRKEKEITTRLEKRISKLEKENISLR
                     DDLIKCKLEHIDEVMRIERSLNTQLKTNYKNNNNENLWAGIDDIIKTIECVSIESKIG
                     GVKTNLK"
     gene            15467..15733
                     /locus_tag="YPTB_RS21555"
                     /old_locus_tag="pYV0018"
     CDS             15467..15733
                     /locus_tag="YPTB_RS21555"
                     /old_locus_tag="pYV0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008814936.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002213260.1"
                     /db_xref="GI:488142052"
                     /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKK
                     FGGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
     gene            16090..16566
                     /locus_tag="YPTB_RS21560"
     CDS             16090..16566
                     /locus_tag="YPTB_RS21560"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019081238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_041175525.1"
                     /db_xref="GI:752489505"
                     /translation="MDFVADNLFNGRRVRALTIVDNFSRECLALEVGQGLRGDDVVAV
                     MDRLKHSLGRIPQRLQTDNGSEFISKSMDRWAYENRVTMDFSRPGKPTDNAFIESFNG
                     SLRDECLNVHGFLSLEDAQEKIEQWRQEYNHFRPHSSLNNLTPAEFARSHQKGPDL"
     gene            complement(16714..17139)
                     /locus_tag="YPTB_RS21565"
                     /old_locus_tag="pYV0020"
     CDS             complement(16714..17139)
                     /locus_tag="YPTB_RS21565"
                     /old_locus_tag="pYV0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010891235.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="yopH targeting protein"
                     /protein_id="WP_002213267.1"
                     /db_xref="GI:488142059"
                     /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPIN
                     EKELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSG
                     TQLASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
     gene            complement(<17517..17915)
                     /locus_tag="YPTB_RS21570"
                     /old_locus_tag="pYV0021"
     CDS             complement(<17517..17915)
                     /locus_tag="YPTB_RS21570"
                     /old_locus_tag="pYV0021"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001750026.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase AAA"
                     /protein_id="WP_029788014.1"
                     /db_xref="GI:658926167"
                     /translation="MHELEALLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQ
                     EWNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERCENVIL
                     LGPPGVGKTHLAVALGVKAADAGHRVLFMPL"
     gene            complement(17915..19087)
                     /locus_tag="YPTB_RS21575"
                     /old_locus_tag="pYV0022"
     CDS             complement(17915..19087)
                     /locus_tag="YPTB_RS21575"
                     /old_locus_tag="pYV0022"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_001750025.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_011191364.1"
                     /db_xref="GI:499504724"
                     /translation="MLSREDFYMIKQMRQQGAYIIDIATQVGCSERTVRRYLKYPEPP
                     ARKTRHKMVKLKPFMDYIDMRLAENVWNSEVILAEIKAMGYTGGRSMLRYYIQPKRKM
                     RPSKRTVRFETQPGYQLQHDWGEVELEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDA
                     EHTYESLVRAFRYFGGSVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLAEHYDFLPRAC
                     RPRRARTKGKVERMVKYLKDNVFVRYRRFDSFTHVNQQLEQWMADVADKRELRQFRQT
                     PEQRFALEQEHLQPLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRI
                     SLDDELRSYSNEQQVASHRLCSASSGWQTVPEHHAPLWQQVSMVEHRPLSAYEELL"
     gene            19128..19256
                     /locus_tag="YPTB_RS21580"
     CDS             19128..19256
                     /locus_tag="YPTB_RS21580"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_002213397.1"
                     /db_xref="GI:488142189"
                     /translation="MLGGADNTNGELPSYITGANTVKGFMLIISACTGFITSVAWA"
     gene            19337..19834
                     /locus_tag="YPTB_RS21585"
                     /old_locus_tag="pYV0023"
     CDS             19337..19834
                     /locus_tag="YPTB_RS21585"
                     /old_locus_tag="pYV0023"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002428538.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002428538.1"
                     /db_xref="GI:488359153"
                     /translation="MDFVMDALATGRRIKCLTCVDDYTKECLTVTVAFGISGVQVTRI
                     LDSIALFRGYPATIRTDQGPEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGR
                     FRDECLNEHWFSDVSHARKTISEWRQDYNECRPHSTLNYQTPSEFAAAWRKGNSDSEG
                     SDITK"
     gene            complement(19897..20289)
                     /locus_tag="YPTB_RS21590"
                     /old_locus_tag="pYV0024"
     CDS             complement(19897..20289)
                     /locus_tag="YPTB_RS21590"
                     /old_locus_tag="pYV0024"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P31490.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="YopE regulator"
                     /protein_id="WP_002213403.1"
                     /db_xref="GI:488142195"
                     /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVG
                     QILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNS
                     LYTQLEMLVQGAERLQTSSLISPPRSFS"
     gene            20558..21142
                     /locus_tag="YPTB_RS21595"
                     /old_locus_tag="pYV0025"
     CDS             20558..21142
                     /locus_tag="YPTB_RS21595"
                     /old_locus_tag="pYV0025"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002353311.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane virulence protein yopE"
                     /protein_id="WP_002353311.1"
                     /db_xref="GI:488282103"
                     /translation="MSGRSVSQQTSDQYANNLAGRTESPQGSSLASRIIERLSSVAHS
                     VIGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSFSDSIKQLAAETLPKYMQQLNSLDAE
                     MLQKNHDQFATGSGPLRGSITQCQGLMQFCGGELQAEASAILNTPVCGIPFSQWGTIG
                     GAASAYVASGVDLTQAANEIKGLAQQMQKLLSLM"
     gene            complement(21282..21581)
                     /locus_tag="YPTB_RS21600"
                     /old_locus_tag="pYV0026"
     CDS             complement(21282..21581)
                     /locus_tag="YPTB_RS21600"
                     /old_locus_tag="pYV0026"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213360.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid stabilization protein"
                     /protein_id="WP_002213360.1"
                     /db_xref="GI:488142152"
                     /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAK
                     NPELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
     gene            complement(21574..21816)
                     /locus_tag="YPTB_RS21605"
                     /old_locus_tag="pYV0027"
     CDS             complement(21574..21816)
                     /locus_tag="YPTB_RS21605"
                     /old_locus_tag="pYV0027"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012414146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin"
                     /protein_id="WP_012414146.1"
                     /db_xref="GI:501382580"
                     /translation="MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEARE
                     QRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKGTSV"
     gene            complement(<22755..22991)
                     /locus_tag="YPTB_RS21610"
     CDS             complement(<22755..22991)
                     /locus_tag="YPTB_RS21610"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_016099812.1"
                     /exception="unextendable partial coding region"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175529.1"
                     /db_xref="GI:752489509"
                     /translation="MTNVSIGYPGGTVVPITNVGIGYPGGTVVPITNVGIGYPGGTVV
                     PITNVGIGYPSGTVVPITNVDIGYPGGTVVPITNV"
     gene            complement(23123..24088)
                     /locus_tag="YPTB_RS21615"
                     /old_locus_tag="pYV0031"
     CDS             complement(23123..24088)
                     /locus_tag="YPTB_RS21615"
                     /old_locus_tag="pYV0031"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213354.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParB"
                     /protein_id="WP_011191369.1"
                     /db_xref="GI:499504729"
                     /translation="MMKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSG
                     MKGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLT
                     SGQQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYR
                     PTSAYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPN
                     ELSARSGEALSKAYENNVDTLKRVTYKIMKQKQEGRQFTTEELIVLLMPERKQPENIH
                     KKSFGKNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
     gene            complement(24085..25251)
                     /locus_tag="YPTB_RS21620"
                     /old_locus_tag="pYV0032"
     CDS             complement(24085..25251)
                     /locus_tag="YPTB_RS21620"
                     /old_locus_tag="pYV0032"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_010891239.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chromosome partitioning protein ParA"
                     /protein_id="WP_002220902.1"
                     /db_xref="GI:488149694"
                     /translation="MDLKSTLDRCIERGQFMTQEIAKSQFGNDSPAARTITRRWRITE
                     AAELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDMRDVFKTRLSKPK
                     GENPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQATASLYHGYVPDL
                     HIHEEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIYGLHDQGKLPV
                     APHLLLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQ
                     FFTMLRDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGMVLKEVVRV
                     TDEVGKGQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRWENA"
     gene            complement(26051..26245)
                     /locus_tag="YPTB_RS21625"
                     /old_locus_tag="pYV0034"
     CDS             complement(26051..26245)
                     /locus_tag="YPTB_RS21625"
                     /old_locus_tag="pYV0034"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191370.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011191370.1"
                     /db_xref="GI:499504730"
                     /translation="MQSMSRRGNCLDNSPMERVFRSLKSEWLPVGGYMDVHHAVRDIG
                     EWIQSYYNTPPSAQWWITAL"
     gene            complement(26357..26815)
                     /locus_tag="YPTB_RS21630"
                     /old_locus_tag="pYV0035"
     CDS             complement(26357..26815)
                     /locus_tag="YPTB_RS21630"
                     /old_locus_tag="pYV0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191371.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_011191371.1"
                     /db_xref="GI:499504731"
                     /translation="MVELCRLLKITRSVYSASLNLRVDVKRLQLRELHQQSRGAAGNR
                     TLSLLMRQSGYNVGRWLAGRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPS
                     EPNRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRA"
     gene            complement(26842..27030)
                     /locus_tag="YPTB_RS21635"
     CDS             complement(26842..27030)
                     /locus_tag="YPTB_RS21635"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002213248.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_041175530.1"
                     /db_xref="GI:752489510"
                     /translation="MRKWIHQYKEEVSGVTPDNPALIPEQREIQSLRAQIKRLEMEKE
                     ILKQAAVLMSEFPIKSLR"
     gene            complement(27269..27874)
                     /locus_tag="YPTB_RS21640"
     CDS             complement(27269..27874)
                     /locus_tag="YPTB_RS21640"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012414150.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="conjugal transfer protein TraT"
                     /protein_id="WP_041175526.1"
                     /db_xref="GI:752489506"
                     /translation="MSETIWLEPSSQKTVYLQIKNTSDKNMLGLAPKITKAVQDKGYT
                     VTSSPEDAHYWIQANVLKADKMDLREAEGFLSQGYQGAALGAGITGYNSNSAGATLGV
                     GLAAGLVGMAANAMVEDINYTMVTDVQISEKTDTTLQTDNVAALKQGTSGYKVQTSTQ
                     TGNKHQYQTRVVSSANKVNLKFEEARPVLEDQLAKSIANIL"
     gene            complement(28491..29039)
                     /locus_tag="YPTB_RS21645"
                     /old_locus_tag="pYV0040"
     CDS             complement(28491..29039)
                     /locus_tag="YPTB_RS21645"
                     /old_locus_tag="pYV0040"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011171996.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191373.1"
                     /db_xref="GI:499504733"
                     /translation="MFIKDTYNMRALCTALEQSAPDTIINTSKEENNSYYCATAHLLR
                     TDVCSLVNRVGIEPLKSGSILSTLEELWQAVGIVYRLYEWQHVSDIDTNFKKLPNNSD
                     FGLVFSVLDCDIEYVFIGKKDSEGNIEFYDPKNSLLIENDDIKKYLYDENFHRFCIML
                     IISKSELEELSRESCDQECIMG"
     gene            29513..30481
                     /locus_tag="YPTB_RS21650"
                     /old_locus_tag="pYV0041"
     CDS             29513..30481
                     /locus_tag="YPTB_RS21650"
                     /old_locus_tag="pYV0041"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:O68703.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="cysteine protease YopT"
                     /protein_id="WP_011191374.1"
                     /db_xref="GI:499504734"
                     /translation="MNSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSH
                     SNLQKKLSATIKHNQSGRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAV
                     RESVANYGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRSHAQGQSLFDQL
                     YVGGRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPV
                     DVTGTTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPN
                     FGEFHFSDKEKFRKWFTNSFWDNSMYHYPLGVGQRFRVLTFDSKEV"
     gene            30481..30873
                     /locus_tag="YPTB_RS21655"
                     /old_locus_tag="pYV0042"
     CDS             30481..30873
                     /locus_tag="YPTB_RS21655"
                     /old_locus_tag="pYV0042"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:A1JU66.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_011191375.1"
                     /db_xref="GI:499504735"
                     /translation="MQTTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYH
                     QQWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLE
                     RFIDDIEQRKEPQNTKFQPNSTSPILFI"
     gene            complement(30917..31228)
                     /locus_tag="YPTB_RS21660"
     CDS             complement(30917..31228)
                     /locus_tag="YPTB_RS21660"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002233188.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175527.1"
                     /db_xref="GI:752489507"
                     /translation="MNINADHEKNLKVSIIYKIQLIGGITEILNGGVINWGRFNLAGY
                     FKSSISLIKIIIIDNTNLVMLYVKIWINNENFLIYSELKTNELLYKPYLLNLIDIIVT
                     M"
     gene            31576..31995
                     /locus_tag="YPTB_RS21665"
                     /old_locus_tag="pYV0044"
     CDS             31576..31995
                     /locus_tag="YPTB_RS21665"
                     /old_locus_tag="pYV0044"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191376.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191376.1"
                     /db_xref="GI:499504736"
                     /translation="MSKIPTLIICSKPAEIAVGHFITMSIKAILLYSYQEYGQHTDVF
                     IQVKFNYGMIEYKFYVNKVKFDNTPGRKLKTTIAHSSQLMGHNLTYEDYAMKKRLVIA
                     TALCAAFYAGMKVEHFLTVDACLDAGGAMQNDIFCER"
     gene            32974..33189
                     /locus_tag="YPTB_RS21670"
     CDS             32974..33189
                     /locus_tag="YPTB_RS21670"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609486.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="WP_002353323.1"
                     /db_xref="GI:488282115"
                     /translation="MTNAIESVHRLFRKLTKTKGIFPNENSLLKSLYLGLMNAQERWT
                     MPIQSWNLALSQLAIYFEGRLDKVITL"
     gene            complement(33232..34821)
                     /locus_tag="YPTB_RS21675"
                     /old_locus_tag="pYV0047"
     CDS             complement(33232..34821)
                     /locus_tag="YPTB_RS21675"
                     /old_locus_tag="pYV0047"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012414153.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="effector protein"
                     /protein_id="WP_041175528.1"
                     /db_xref="GI:752489508"
                     /translation="MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWS
                     EWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNS
                     LTELPELPQSLKSLQVENNNLKALPDLPPSLKKLHVRENDLTDLPELPQSLESLRVDN
                     NNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPSLKKL
                     HVRENDLTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPF
                     LAAIYADNNLLETLPDLPPHLEILVASYNSLTELPELPQSLKSLRVDNNNLKALSDLP
                     PSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPSLKKLHVRENDLTDL
                     PELPQSLTFLDVSDNNISGLSELPPNLYYLDASSNEIRSLCDLPPSLVDLNVKSNQLS
                     ELPALPPHLERLIASFNYLAEVPELPQNLKQLHVEQNALREFPDIPESLEELEMDSER
                     VVDPYEFAHETTDKLEDDVFE"
     gene            complement(35209..35424)
                     /locus_tag="YPTB_RS21680"
                     /old_locus_tag="pYV0049"
     CDS             complement(35209..35424)
                     /locus_tag="YPTB_RS21680"
                     /old_locus_tag="pYV0049"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191379.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191379.1"
                     /db_xref="GI:499504739"
                     /translation="MNSLSFHDNSIFCNKPKYSDAEVAQTLDTAQKHTLTVSKGVLDT
                     AKQYTNTVSSNTLDSANTYTNNKADSH"
     gene            complement(36551..37471)
                     /locus_tag="YPTB_RS21685"
                     /old_locus_tag="pYV0054"
     CDS             complement(36551..37471)
                     /locus_tag="YPTB_RS21685"
                     /old_locus_tag="pYV0054"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011117631.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein YopD"
                     /protein_id="WP_002212987.1"
                     /db_xref="GI:488141779"
                     /translation="MTINIKTDSPIITTGSQLDAITTETVKQSGEIKKTEDTRHEAQA
                     IKSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQ
                     QRDIENKATITAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQ
                     EQILNSNIAGREQLIDTKMQQMSNIGDKAVSREDIGRIWKPEQVADQNKLALLDKEFR
                     MTDSKANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNY
                     NDNFMKDVLRLIEQYVSSHTHAMKAAFGVV"
     gene            complement(37490..38695)
                     /locus_tag="YPTB_RS21690"
                     /old_locus_tag="pYV0055"
     CDS             complement(37490..38695)
                     /locus_tag="YPTB_RS21690"
                     /old_locus_tag="pYV0055"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q06114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="protein YopB"
                     /protein_id="WP_011191382.1"
                     /db_xref="GI:499504742"
                     /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGG
                     VSSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLAS
                     PDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKS
                     GIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLIS
                     QEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSA
                     KVAQISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKK
                     QADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLH
                     NLAGRPHTV"
     gene            complement(38673..39179)
                     /locus_tag="YPTB_RS21695"
                     /old_locus_tag="pYV0056"
     CDS             complement(38673..39179)
                     /locus_tag="YPTB_RS21695"
                     /old_locus_tag="pYV0056"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P23995.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein H"
                     /protein_id="WP_011117633.1"
                     /db_xref="GI:499430169"
                     /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAF
                     NQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIK
                     EPRFPFHAAECLLQKGELAEAESGLFLAQELIADKPEFKELSTRVSSMLEAIKLKKEM
                     EHECVDNP"
     gene            complement(39192..40172)
                     /locus_tag="YPTB_RS21700"
                     /old_locus_tag="pYV0057"
     CDS             complement(39192..40172)
                     /locus_tag="YPTB_RS21700"
                     /old_locus_tag="pYV0057"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609483.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Virulence-associated V antigen"
                     /protein_id="WP_011191383.1"
                     /db_xref="GI:499504743"
                     /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNI
                     DISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVK
                     EFLESSPNTQWELRAFMAVIHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAEL
                     TAELKIYSVIQAEINKHLSSGGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEK
                     MPQTTIQEGETEKKIVSIKNFLESEKKRTGALGNLKDSYSYNKDNNELSHFATTCSDK
                     SRPLNDLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK"
     gene            complement(40174..40461)
                     /locus_tag="YPTB_RS21705"
                     /old_locus_tag="pYV0058"
     CDS             complement(40174..40461)
                     /locus_tag="YPTB_RS21705"
                     /old_locus_tag="pYV0058"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005176739.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein G"
                     /protein_id="WP_002212973.1"
                     /db_xref="GI:488141765"
                     /translation="MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAV
                     MKIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII"
     gene            complement(40503..40943)
                     /locus_tag="YPTB_RS21710"
                     /old_locus_tag="pYV0059"
     CDS             complement(40503..40943)
                     /locus_tag="YPTB_RS21710"
                     /old_locus_tag="pYV0059"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69959.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein R"
                     /protein_id="WP_002220918.1"
                     /db_xref="GI:488149710"
                     /translation="MMADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRV
                     EIEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLS
                     TQRLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
     gene            complement(40940..43054)
                     /locus_tag="YPTB_RS21715"
                     /old_locus_tag="pYV0060"
     CDS             complement(40940..43054)
                     /locus_tag="YPTB_RS21715"
                     /old_locus_tag="pYV0060"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69955.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein D"
                     /protein_id="WP_002212971.1"
                     /db_xref="GI:488141763"
                     /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILI
                     AVNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIV
                     YTFGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDG
                     DMRAGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIG
                     VTQKGLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGK
                     QVVAQPKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDL
                     QSILTSGSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALND
                     ELVRVRRALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESV
                     SQLELLGIPYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREY
                     AEDFIGIQETRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSIL
                     EAMVEWGQKEKDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQ
                     TSAGSYLALEPAVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGL
                     PVLSYQELTQQINIQPLGRICL"
     gene            complement(43041..43379)
                     /locus_tag="YPTB_RS21720"
                     /old_locus_tag="pYV0061"
     CDS             complement(43041..43379)
                     /locus_tag="YPTB_RS21720"
                     /old_locus_tag="pYV0061"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P61417.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molecular chaperone"
                     /protein_id="WP_032465674.1"
                     /db_xref="GI:694125073"
                     /translation="MTLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHLAG
                     RRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQHY
                     LELKDHNESP"
     gene            complement(43382..43750)
                     /locus_tag="YPTB_RS21725"
                     /old_locus_tag="pYV0062"
     CDS             complement(43382..43750)
                     /locus_tag="YPTB_RS21725"
                     /old_locus_tag="pYV0062"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0C2N4.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein X"
                     /protein_id="WP_002212969.1"
                     /db_xref="GI:488141761"
                     /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHL
                     ERLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALL
                     KCQQDDDRLLQIILNLLHKV"
     gene            complement(43747..44118)
                     /locus_tag="YPTB_RS21730"
                     /old_locus_tag="pYV0063"
     CDS             complement(43747..44118)
                     /locus_tag="YPTB_RS21730"
                     /old_locus_tag="pYV0063"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P61380.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein SycN"
                     /protein_id="WP_002229794.1"
                     /db_xref="GI:488158586"
                     /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGA
                     TLTLWLARSLAWHRCEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLT
                     LPLLHQAFEQLLRLQQEVLAP"
     gene            complement(44105..44383)
                     /locus_tag="YPTB_RS21735"
                     /old_locus_tag="pYV0064"
     CDS             complement(44105..44383)
                     /locus_tag="YPTB_RS21735"
                     /old_locus_tag="pYV0064"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005176813.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Protein TyeA"
                     /protein_id="WP_002212965.1"
                     /db_xref="GI:488141757"
                     /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRF
                     YQDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
     gene            complement(44364..45245)
                     /locus_tag="YPTB_RS21740"
                     /old_locus_tag="pYV0065"
     CDS             complement(44364..45245)
                     /locus_tag="YPTB_RS21740"
                     /old_locus_tag="pYV0065"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P68640.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane protein YopN"
                     /protein_id="WP_011191384.1"
                     /db_xref="GI:499504744"
                     /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSG
                     TLQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQN
                     VSELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVE
                     QALVSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSD
                     LQKRFPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVINDLQKLKEFGSVSDQVK
                     GFWQFFSEGKTNGVRPF"
     gene            45443..46762
                     /gene="fliI"
                     /locus_tag="YPTB_RS21745"
                     /old_locus_tag="pYV0067"
     CDS             45443..46762
                     /gene="fliI"
                     /locus_tag="YPTB_RS21745"
                     /old_locus_tag="pYV0067"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005176817.1"
                     /note="involved in type III protein export during
                     flagellum assembly; Derived by automated computational
                     analysis using gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATP synthase"
                     /protein_id="WP_002212955.1"
                     /db_xref="GI:488141747"
                     /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRI
                     GELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEH
                     LLGQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCG
                     EGQRMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRK
                     AVLVVATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAG
                     EPPTRRGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDG
                     HIILSRKLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQI
                     GEYQKGQDKEADQAIERMGAIRGWLCQGTHELSHFNETLNLLETLTQ"
     gene            46759..47223
                     /locus_tag="YPTB_RS21750"
                     /old_locus_tag="pYV0068"
     CDS             46759..47223
                     /locus_tag="YPTB_RS21750"
                     /old_locus_tag="pYV0068"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012414154.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein O"
                     /protein_id="WP_002212952.1"
                     /db_xref="GI:488141744"
                     /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDY
                     HLWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERE
                     RLTLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
     gene            47223..48590
                     /locus_tag="YPTB_RS21755"
                     /old_locus_tag="pYV0069"
     CDS             47223..48590
                     /locus_tag="YPTB_RS21755"
                     /old_locus_tag="pYV0069"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P68587.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein P"
                     /protein_id="WP_011191386.1"
                     /db_xref="GI:499504746"
                     /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHP
                     KEESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLS
                     PLAEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHD
                     ELFVQQSPIDSAQPVQLNTKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQK
                     RLAEEPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSE
                     QLDMTELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVVTPGD
                     HLLATMRATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEI
                     PGKLHVELIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEE
                     WEAEE"
     gene            48587..49510
                     /locus_tag="YPTB_RS21760"
                     /old_locus_tag="pYV0070"
     CDS             48587..49510
                     /locus_tag="YPTB_RS21760"
                     /old_locus_tag="pYV0070"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002381687.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein Q"
                     /protein_id="WP_002212948.1"
                     /db_xref="GI:488141740"
                     /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSS
                     LNCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKL
                     VCNDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILIS
                     LRWHKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGM
                     SHESDELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLL
                     ANGRLLGHGRLVEIQGRLGVRIERLTEVTIS"
     gene            49507..50160
                     /gene="ssaR"
                     /locus_tag="YPTB_RS21765"
                     /old_locus_tag="pYV0071"
                     /gene_synonym="yscR"
     CDS             49507..50160
                     /gene="ssaR"
                     /locus_tag="YPTB_RS21765"
                     /old_locus_tag="pYV0071"
                     /gene_synonym="yscR"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005176829.1"
                     /note="part of a set of proteins involved in the infection
                     of eukaryotic cells; in plant pathogens involved in the
                     hypersensitivity response; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein R"
                     /protein_id="WP_002212947.1"
                     /db_xref="GI:488141739"
                     /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNAL
                     GVQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPY
                     RMFLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFL
                     IYLPFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
     gene            50162..50428
                     /locus_tag="YPTB_RS21770"
                     /old_locus_tag="pYV0072"
     CDS             50162..50428
                     /locus_tag="YPTB_RS21770"
                     /old_locus_tag="pYV0072"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69982.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein S"
                     /protein_id="WP_002212945.1"
                     /db_xref="GI:488141737"
                     /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQI
                     QEQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
     gene            50425..51210
                     /locus_tag="YPTB_RS21775"
                     /old_locus_tag="pYV0073"
     CDS             50425..51210
                     /locus_tag="YPTB_RS21775"
                     /old_locus_tag="pYV0073"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69984.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein T"
                     /protein_id="WP_002212938.1"
                     /db_xref="GI:488141730"
                     /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGI
                     VCSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVD
                     NQRGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVAS
                     FFPAVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLA
                     MPIKSAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
     gene            51210..52274
                     /locus_tag="YPTB_RS21780"
                     /old_locus_tag="pYV0074"
     CDS             51210..52274
                     /locus_tag="YPTB_RS21780"
                     /old_locus_tag="pYV0074"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005176440.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein U"
                     /protein_id="WP_002212936.1"
                     /db_xref="GI:488141728"
                     /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMG
                     LSDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASH
                     VVQYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKG
                     NLVTLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSK
                     DEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRG
                     ETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEAT
                     AEVLRWLERQNIEKQHSEML"
     gene            52850..53245
                     /locus_tag="YPTB_RS21785"
                     /old_locus_tag="pYV0075"
     CDS             52850..53245
                     /locus_tag="YPTB_RS21785"
                     /old_locus_tag="pYV0075"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002222527.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system chaperone VirG"
                     /protein_id="WP_002222527.1"
                     /db_xref="GI:488151319"
                     /translation="MSRIIALIISFLLVGCATPPMPAQRIVGEVRMSRPLSRIAHIDV
                     SMFGLYEGKVREVQRTHFETGNLPLFFSIKLNPAQRGEGELYLRSTLSFPERGVQAVA
                     QQKLTGKNKVVLQMIPKTCYPNCQLPNTR"
     gene            53369..54184
                     /locus_tag="YPTB_RS21790"
                     /old_locus_tag="pYV0076"
     CDS             53369..54184
                     /locus_tag="YPTB_RS21790"
                     /old_locus_tag="pYV0076"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_013749464.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="thermoregulatory protein LcrF"
                     /protein_id="WP_002212931.1"
                     /db_xref="GI:488141723"
                     /translation="MASLEIIKLEWVTPIFKVVEHSQDGLYILLQGQISWQSSGQTYD
                     LDEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIGRDNSTPK
                     PLLIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRH
                     LGNRPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRI
                     LYAHQLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
     gene            54263..54361
                     /locus_tag="YPTB_RS21795"
                     /old_locus_tag="pYV0077"
     CDS             54263..54361
                     /locus_tag="YPTB_RS21795"
                     /old_locus_tag="pYV0077"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191387.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein A"
                     /protein_id="WP_011191387.1"
                     /db_xref="GI:499504747"
                     /translation="MSQISTKHRTVLFRRWMAIICCLIINMAYLVY"
     gene            54587..55000
                     /locus_tag="YPTB_RS21800"
                     /old_locus_tag="pYV0078"
     CDS             54587..55000
                     /locus_tag="YPTB_RS21800"
                     /old_locus_tag="pYV0078"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P0C2M8.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="chaperone protein YscB"
                     /protein_id="WP_002212925.1"
                     /db_xref="GI:488141717"
                     /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELV
                     LRTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQEL
                     DTHGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
     gene            55006..56829
                     /locus_tag="YPTB_RS21805"
                     /old_locus_tag="pYV0079"
     CDS             55006..56829
                     /locus_tag="YPTB_RS21805"
                     /old_locus_tag="pYV0079"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012228712.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="secretin"
                     /protein_id="WP_011191388.1"
                     /db_xref="GI:499504748"
                     /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGES
                     LRDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLY
                     IFKNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLEL
                     VEQTAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRV
                     LSDATIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALD
                     KPSARIEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGS
                     LIDARGLDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAE
                     LKGITYGTMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVA
                     RVGHGQSLIIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRI
                     IDEGIAHHLALGNGRDLRTGILAVDEISNQSTTLNKLLGVSQCQPLNKAQEVQKWLSQ
                     NNKSSYLTQCKMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
     gene            56826..58085
                     /locus_tag="YPTB_RS21810"
                     /old_locus_tag="pYV0080"
     CDS             56826..58085
                     /locus_tag="YPTB_RS21810"
                     /old_locus_tag="pYV0080"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212919.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase D"
                     /protein_id="WP_002212919.1"
                     /db_xref="GI:488141711"
                     /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAP
                     VHLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPE
                     TLQVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEV
                     RRLLATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSME
                     ELRQGAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGV
                     ESKVRIAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFR
                     QEFGNRPKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRI
                     LAIRRDAVIVSKGKREFVIQLNGGKPR"
     gene            58082..58282
                     /locus_tag="YPTB_RS21815"
                     /old_locus_tag="pYV0081"
     CDS             58082..58282
                     /locus_tag="YPTB_RS21815"
                     /old_locus_tag="pYV0081"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212917.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase SecE"
                     /protein_id="WP_002212917.1"
                     /db_xref="GI:488141709"
                     /translation="MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVW
                     QRESKALESAIAIIHYVAGDLK"
     gene            58283..58546
                     /locus_tag="YPTB_RS21820"
                     /old_locus_tag="pYV0082"
     CDS             58283..58546
                     /locus_tag="YPTB_RS21820"
                     /old_locus_tag="pYV0082"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005176466.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III export protein pscF"
                     /protein_id="WP_002212916.1"
                     /db_xref="GI:488141708"
                     /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDK
                     PDNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
     gene            58548..58895
                     /locus_tag="YPTB_RS21825"
                     /old_locus_tag="pYV0083"
     CDS             58548..58895
                     /locus_tag="YPTB_RS21825"
                     /old_locus_tag="pYV0083"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191389.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase G"
                     /protein_id="WP_011191389.1"
                     /db_xref="GI:499504749"
                     /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLI
                     RLSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRI
                     QTFVNGMREQLKT"
     gene            58892..59389
                     /locus_tag="YPTB_RS21830"
                     /old_locus_tag="pYV0084"
     CDS             58892..59389
                     /locus_tag="YPTB_RS21830"
                     /old_locus_tag="pYV0084"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q663I2.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein H"
                     /protein_id="WP_011191390.1"
                     /db_xref="GI:499504750"
                     /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAE
                     KTREVLWQQYYASNPPDHAVLEVLAMPVREALLARFGQHQGSVVPAIDLPELRSVLQQ
                     FDSFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQ
                     IDMDT"
     gene            59399..59737
                     /locus_tag="YPTB_RS21835"
                     /old_locus_tag="pYV0085"
     CDS             59399..59737
                     /locus_tag="YPTB_RS21835"
                     /old_locus_tag="pYV0085"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002233163.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase I"
                     /protein_id="WP_032465675.1"
                     /db_xref="GI:694125074"
                     /translation="MEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGLGHS
                     LLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAGRMS
                     QNVETLSKGG"
     gene            59762..60478
                     /locus_tag="YPTB_RS21840"
                     /old_locus_tag="pYV0086"
     CDS             59762..60478
                     /locus_tag="YPTB_RS21840"
                     /old_locus_tag="pYV0086"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69972.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase J"
                     /protein_id="WP_032465676.1"
                     /db_xref="GI:694125075"
                     /translation="MSTLILILFLTGCKVDLYTGISQKEGNEMLALLRQEGLSADKEP
                     DKDGKIKLLVEESDVAQAIDILKRKGYPHESFSTLQDVFPKDGLISSPIEELARLNYA
                     KAQEISRTLSEIDGVLVARVHVVLPEEQNNKGKKGVAASASVFIKHAADIQFDTYIPQ
                     IKQLVNNSIEGLAYDRISVILVPSVDVRQSSHLPRNTSILSIQVSEESKGHLIGLLSL
                     LILLLPVTNLAQYFWLQRKK"
     gene            60481..61107
                     /locus_tag="YPTB_RS21845"
                     /old_locus_tag="pYV0087"
     CDS             60481..61107
                     /locus_tag="YPTB_RS21845"
                     /old_locus_tag="pYV0087"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69974.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="preprotein translocase K"
                     /protein_id="WP_002212911.1"
                     /db_xref="GI:488141703"
                     /translation="MENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQWRDSAHLN
                     AALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCVLASPLQQL
                     LTLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLAAMEPQPQA
                     WCKRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVTPTCSHLFK"
     gene            61086..61718
                     /locus_tag="YPTB_RS21850"
                     /old_locus_tag="pYV0088"
     CDS             61086..61718
                     /locus_tag="YPTB_RS21850"
                     /old_locus_tag="pYV0088"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002212909.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein"
                     /protein_id="WP_002212909.1"
                     /db_xref="GI:488141701"
                     /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAE
                     KILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLA
                     VRKILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKVHKDFPEIS
                     YLEVTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTE"
     gene            61943..62290
                     /locus_tag="YPTB_RS21855"
                     /old_locus_tag="pYV0089"
     CDS             61943..62290
                     /locus_tag="YPTB_RS21855"
                     /old_locus_tag="pYV0089"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69978.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="Yop proteins translocation protein M"
                     /protein_id="WP_002212907.1"
                     /db_xref="GI:488141699"
                     /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEK
                     AFANEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLL
                     LEAAMRQDTAADG"
     gene            62838..63104
                     /locus_tag="YPTB_RS21860"
                     /old_locus_tag="pYV0090"
     CDS             62838..63104
                     /locus_tag="YPTB_RS21860"
                     /old_locus_tag="pYV0090"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:P69961.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein S"
                     /protein_id="WP_002212900.1"
                     /db_xref="GI:488141692"
                     /translation="MKKARFTETQILRVLKEVEGGRHVKDVCRENGGSEASYYNWKSK
                     YGGMESSDIKRMKEREEENRRLKQMYASLSLDHEILKDVVAKKL"
     gene            63140..63562
                     /locus_tag="YPTB_RS21865"
                     /old_locus_tag="pYV0091"
     CDS             63140..63562
                     /locus_tag="YPTB_RS21865"
                     /old_locus_tag="pYV0091"
                     /inference="EXISTENCE: similar to AA
                     sequence:SwissProt:Q9RI18.2"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="low calcium response locus protein T"
                     /protein_id="WP_011191391.1"
                     /db_xref="GI:499504751"
                     /translation="MTEYQASERRGCRIMGISRSLLHYCPNTARDIPVVEVLQKLAHQ
                     YPAYGFGLMFNKLRQSGLPWNVKRVYRVYRLLKLNFRRKGKKRLPNRHPQPLAIPLKM
                     NHCWSVDFMSDALPDGRRFRLFNVVEILTGKHWQLKLT"
     gene            63580..63854
                     /locus_tag="YPTB_RS21870"
                     /note="integrase; disrupted; Derived by automated
                     computational analysis using gene prediction method:
                     Protein Homology."
                     /pseudo
     gene            complement(64366..65772)
                     /locus_tag="YPTB_RS21875"
                     /old_locus_tag="pYV0094"
     CDS             complement(64366..65772)
                     /locus_tag="YPTB_RS21875"
                     /old_locus_tag="pYV0094"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_014609473.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="tyrosine-protein phosphatase YopH"
                     /protein_id="WP_002213278.1"
                     /db_xref="GI:488142070"
                     /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTI
                     ASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVS
                     LRSDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPP
                     LPPRERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYL
                     QACGGEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAE
                     NRTPVLAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTL
                     TIREAGQKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVG
                     DDSKLRPVIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQ
                     LDVLIKLAEGQGRPLLNS"
     gene            66213..66689
                     /locus_tag="YPTB_RS21880"
                     /old_locus_tag="pYV0095"
     CDS             66213..66689
                     /locus_tag="YPTB_RS21880"
                     /old_locus_tag="pYV0095"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_019081238.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="integrase"
                     /protein_id="WP_012414137.1"
                     /db_xref="GI:501382571"
                     /translation="MDFVADNLFNGHRVRALTIVDNFSRECLALEVGQGLRGDDVVAV
                     MDRLKHSLGRIPQRLQTDNGSEFISKSMDRWAYENRVTMDFSRPGKPTDNAFIESFNG
                     SLRDECLNVHGFLSLEDAQEKIEQWRQEYNHFRPHSSLNNLTPAEFARSHQKGPDL"
     gene            complement(67275..68141)
                     /locus_tag="YPTB_RS21885"
                     /old_locus_tag="pYV0098"
     CDS             complement(67275..68141)
                     /locus_tag="YPTB_RS21885"
                     /old_locus_tag="pYV0098"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_002231152.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="effector protein YopJ"
                     /protein_id="WP_002225474.1"
                     /db_xref="GI:488154266"
                     /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSW
                     FHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIIN
                     MGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSM
                     VEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLPHDKLDPYL
                     PVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHK
                     KRIAEYKTLLKV"
CONTIG      join(BX936399.2:1..68525)
//
DBGET integrated database retrieval system