GenomeNet

Database: RefSeq
Entry: NC_006153
LinkDB: NC_006153
Original site: NC_006153 
LOCUS       NC_006153              68525 bp    DNA     circular CON 10-JUN-2013
DEFINITION  Yersinia pseudotuberculosis IP 32953 plasmid pYV, complete
            sequence.
ACCESSION   NC_006153
VERSION     NC_006153.2  GI:113911685
DBLINK      Project: 58157
KEYWORDS    RefSeq.
SOURCE      Yersinia pseudotuberculosis IP 32953
  ORGANISM  Yersinia pseudotuberculosis IP 32953
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Yersinia.
REFERENCE   1
  AUTHORS   Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O.,
            Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L.,
            Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C.,
            Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D.,
            Elliott,J.M., Derbise,A., Hauser,L.J. and Garcia,E.
  TITLE     Insights into the evolution of Yersinia pestis through whole-genome
            comparison with Yersinia pseudotuberculosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004)
   PUBMED   15358858
REFERENCE   2  (bases 1 to 68525)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 68525)
  AUTHORS   Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2004) Biology and Biotechnology Research Program,
            Lawrence Livermore National Laboratory, Livermore, CA 94550 USA,
            Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15,
            France, and the Genome Analysis Group, Oak Ridge National
            Laboratory, Oak Ridge, TN 37831 USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BX936399.
            On Sep 1, 2006 this sequence version replaced gi:51593846.
            RefSeq Category:
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..68525
                     /organism="Yersinia pseudotuberculosis IP 32953"
                     /mol_type="genomic DNA"
                     /strain="IP 32953"
                     /db_xref="taxon:273123"
                     /plasmid="pYV"
     gene            complement(12..2210)
                     /locus_tag="pYV0001"
                     /db_xref="GeneID:2952894"
     CDS             complement(12..2210)
                     /locus_tag="pYV0001"
                     /note="similar to Y. pestis YPCD1.72c"
                     /codon_start=1
                     /transl_table=11
                     /product="ypkA; targeted effector protein kinase"
                     /protein_id="YP_068414.1"
                     /db_xref="GI:51593847"
                     /db_xref="GOA:Q05608"
                     /db_xref="InterPro:IPR000719"
                     /db_xref="InterPro:IPR003547"
                     /db_xref="InterPro:IPR008271"
                     /db_xref="InterPro:IPR011009"
                     /db_xref="UniProtKB/Swiss-Prot:Q05608"
                     /db_xref="GeneID:2952894"
                     /translation="MKSVKIMGTMPPSISLAKAHERISQHWQNPVGELNIGGKRYRII
                     DNQVLRLNPHSGFSLFREGVGKIFSGKMFNFSIARNLTDTLHAAQKTTSQELRSDIPN
                     ALSNLFGAKPQTELPLGWKGEPLSGAPDLEGMRVAETDKFAEGESHISIIETKDKQRL
                     VAKIERSIAEGHLFAELEAYKHIYKTAGKHPNLANVHGMAVVPYGNRKEEALLMDEVD
                     GWRCSDTLRTLADSWKQGKINSEAYWGTIKFIAHRLLDVTNHLAKAGVVHNDIKPGNV
                     VFDRASGEPVVIDLGLHSRSGEQPKGFTESFKAPELGVGNLGASEKSDVFLVVSTLLH
                     CIEGFEKNPEIKPNQGLRFITSEPAHVMDENGYPIHRPGIAGVETAYTRFITDILGVS
                     ADSRPDSNEARLHEFLSDGTIDEESAKQILKDTLTGEMSPLSTDVRRITPKKLRELSD
                     LLRTHLSSAATKQLDMGGVLSDLDTMLVALDKAEREGGVDKDQLKSFNSLILKTYRVI
                     EDYVKGREGDTKNSSTEVSPYHRSNFMLSIVEPSLQRIQKHLDQTHSFSDIGSLVRAH
                     KHLETLLEVLVTLSQQGQPVSSETYGFLNRLAEAKITLSQQLNTLQQQQESAKAQLSI
                     LINRSGSWADVARQSLQRFDSTRPVVKFGTEQYTAIHRQMMAAHAAITLQEVSEFTDD
                     MRNFTVDSIPLLIQLGRSSLMDEHLVEQREKLRELTTIAERLNRLEREWM"
     misc_feature    complement(<1917..2117)
                     /locus_tag="pYV0001"
                     /note="effector protein; Provisional; Region: PRK14052"
                     /db_xref="CDD:184477"
     misc_feature    complement(987..1748)
                     /locus_tag="pYV0001"
                     /note="Protein kinase domain; Region: Pkinase; pfam00069"
                     /db_xref="CDD:249558"
     misc_feature    complement(1167..1748)
                     /locus_tag="pYV0001"
                     /note="Protein Kinases, catalytic domain; Region:
                     PKc_like; cl09925"
                     /db_xref="CDD:263920"
     misc_feature    complement(order(1293..1304,1335..1337,1344..1346,
                     1380..1382,1386..1391,1395..1397,1401..1403,1530..1532,
                     1536..1538,1560..1571,1629..1631,1722..1724,1728..1730))
                     /locus_tag="pYV0001"
                     /note="active site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(1344..1346,1380..1382,1386..1391,
                     1395..1397,1401..1403,1536..1538,1560..1571,1629..1631,
                     1722..1724,1728..1730))
                     /locus_tag="pYV0001"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(1293..1304,1335..1337,1389..1391,
                     1395..1397,1401..1403,1530..1532,1536..1538))
                     /locus_tag="pYV0001"
                     /note="substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:173623"
     misc_feature    complement(order(1293..1304,1335..1349))
                     /locus_tag="pYV0001"
                     /note="activation loop (A-loop); other site"
                     /db_xref="CDD:173623"
     misc_feature    complement(15..905)
                     /locus_tag="pYV0001"
                     /note="Rac1-binding domain; Region: Rac1; pfam09632"
                     /db_xref="CDD:118166"
     gene            complement(2218..2667)
                     /locus_tag="pYV0002"
                     /db_xref="GeneID:2952895"
     CDS             complement(2218..2667)
                     /locus_tag="pYV0002"
                     /note="similar to Y. pestis YPCD1.73c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068415.1"
                     /db_xref="GI:51593848"
                     /db_xref="UniProtKB/TrEMBL:Q663G5"
                     /db_xref="GeneID:2952895"
                     /translation="MINTTFTELLPKIASHFGLDKLSQDEYGLCELILNDRVVIMLRA
                     DEILNRLTLLGPILGFSGPEARSAASQLFFCYSINALNKDGPCFAWSEELGLIAFKHL
                     SLDELNVENVSKEIANFYDWLSLVSLPAETQQELPLHTQSTQSVKWG"
     misc_feature    complement(2299..2652)
                     /locus_tag="pYV0002"
                     /note="Tir chaperone protein (CesT); Region: CesT;
                     cl08444"
                     /db_xref="CDD:198934"
     gene            complement(2919..3239)
                     /locus_tag="pYV0003"
                     /db_xref="GeneID:2952896"
     CDS             complement(2919..3239)
                     /locus_tag="pYV0003"
                     /note="similar to Y. pestis YPCD1.14c"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remnant"
                     /protein_id="YP_068416.1"
                     /db_xref="GI:51593849"
                     /db_xref="GOA:Q663G4"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663G4"
                     /db_xref="GeneID:2952896"
                     /translation="MKRLLFHSDQGGQYRSKKSRQLLWRTGVMQSMSRRGNCLDNSPM
                     ERVFRSLKSEWLPVGGYMDVHHAVRDIGEWGYKVITTHPHRHNGGLPPCEYEEQGKKA
                     TKVS"
     misc_feature    complement(3075..>3236)
                     /locus_tag="pYV0003"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    complement(2964..3161)
                     /locus_tag="pYV0003"
                     /note="Integrase core domain; Region: rve_3; cl15866"
                     /db_xref="CDD:265813"
     gene            complement(3411..3650)
                     /locus_tag="pYV0004"
                     /db_xref="GeneID:2952897"
     CDS             complement(3411..3650)
                     /locus_tag="pYV0004"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068417.1"
                     /db_xref="GI:51593850"
                     /db_xref="UniProtKB/TrEMBL:Q663G3"
                     /db_xref="GeneID:2952897"
                     /translation="MSKKHYCRLHDLNIATFYYWLKHHQDDTTVAIPPAFIPARRVIP
                     DNNGTEAVTLNLPNGCSVSCLPAQLRAVMQALSLC"
     gene            complement(4823..5689)
                     /locus_tag="pYV0005"
                     /db_xref="GeneID:2952898"
     CDS             complement(4823..5689)
                     /locus_tag="pYV0005"
                     /note="RepA"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_068418.2"
                     /db_xref="GI:229310098"
                     /db_xref="GOA:Q663G2"
                     /db_xref="InterPro:IPR003446"
                     /db_xref="UniProtKB/TrEMBL:Q663G2"
                     /db_xref="GeneID:2952898"
                     /translation="MTNHQALFTHHYRQVKNPNPEFTPREGKKTLPFCRKLMAKAEGF
                     TSRFDFSMHVAFARSLSLRHRMPPLLRRRAIDALLQGMCFHYDPLANRIQRSITNLAI
                     ECGLATESKSGNLSITRATRALRFLSELGLITYQTEYDPQIGCNIPTDITFTPALFSA
                     LDVSDVAVAAARRSRVEWENQQREKQRLPRLEMDELIAKAWRFVRERFRSYQTERKAH
                     GLKRARARRDVDRTRRDIEAIVNRQLTREIAEGRFVGNLDAVRREKARRVKERMLMSR
                     NNNYTRLATGAT"
     misc_feature    complement(4826..5680)
                     /locus_tag="pYV0005"
                     /note="replication protein; Provisional; Region: PRK13750"
                     /db_xref="CDD:184300"
     gene            5803..5955
                     /locus_tag="pYV0006"
                     /db_xref="GeneID:2952899"
     CDS             5803..5955
                     /locus_tag="pYV0006"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068419.1"
                     /db_xref="GI:51593852"
                     /db_xref="UniProtKB/TrEMBL:Q663G1"
                     /db_xref="GeneID:2952899"
                     /translation="MGPGNLLASPKMRKFIGVFAFLVPSKHLSRTSSLPPYGVASQKF
                     FKQSVI"
     gene            complement(5998..6252)
                     /locus_tag="pYV0007"
                     /db_xref="GeneID:2952900"
     CDS             complement(5998..6252)
                     /locus_tag="pYV0007"
                     /note="similar to Y. pestis YPCD1.79c"
                     /codon_start=1
                     /transl_table=11
                     /product="replication protein"
                     /protein_id="YP_068420.1"
                     /db_xref="GI:51593853"
                     /db_xref="InterPro:IPR010985"
                     /db_xref="UniProtKB/TrEMBL:Q663G0"
                     /db_xref="GeneID:2952900"
                     /translation="MSQIENAVTSSSKRAYRKGNPLTGAEKQRMSVSRKKETHKAINV
                     FIQNDLKNELLQLCEDSGLTQTEMIERWIQREKAARTNAA"
     misc_feature    complement(6004..6252)
                     /locus_tag="pYV0007"
                     /note="replication protein; Provisional; Region: PRK13702"
                     /db_xref="CDD:184258"
     gene            6779..7183
                     /locus_tag="pYV0008"
                     /db_xref="GeneID:2952901"
     CDS             6779..7183
                     /locus_tag="pYV0008"
                     /note="identical to Y. pestis YPCD1.81"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remnant"
                     /protein_id="YP_068421.1"
                     /db_xref="GI:51593854"
                     /db_xref="GOA:Q663F9"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663F9"
                     /db_xref="GeneID:2952901"
                     /translation="MMDIHIAPYRQPFTFQASVYSRRIVGSAISSSPDAELVCRAWRN
                     ALETRPREKRLLFHSDQGGQYRSKKYRQLLWRNGVMQSMSRRGNCLDNSPMERVKVNH
                     QCQVAPATIDFDIADISTPHTIGLRRLKLPFQ"
     misc_feature    <6833..7069
                     /locus_tag="pYV0008"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(7489..7806)
                     /locus_tag="pYV0009"
                     /db_xref="GeneID:2952902"
     CDS             complement(7489..7806)
                     /locus_tag="pYV0009"
                     /note="similar to Y. pestis YPCD1.83c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068422.1"
                     /db_xref="GI:51593855"
                     /db_xref="GOA:Q663F8"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="UniProtKB/TrEMBL:Q663F8"
                     /db_xref="GeneID:2952902"
                     /translation="MTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQL
                     RKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIK
                     SLR"
     misc_feature    complement(7564..7794)
                     /locus_tag="pYV0009"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     misc_feature    complement(7498..7785)
                     /locus_tag="pYV0009"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            complement(7978..8436)
                     /locus_tag="pYV0010"
                     /db_xref="GeneID:2952903"
     CDS             complement(7978..8436)
                     /locus_tag="pYV0010"
                     /note="similar to Y. pestis YPCD1.84c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068423.1"
                     /db_xref="GI:51593856"
                     /db_xref="UniProtKB/TrEMBL:Q663F7"
                     /db_xref="GeneID:2952903"
                     /translation="MGGMAAHWFTYQYAVPFCGRAKTLVTLSNAEGESVLISPQQNTA
                     QDISLFMPRELTVSQGDRVRFTRSDTDRGYVANSLWEVAGFTEDGAVRFRQGDQEKIV
                     DPQKATEDRHIDLAYTLTAYGVQGASERFVIALFGAEGGRKRMATLHLFT"
     misc_feature    complement(7984..>8367)
                     /locus_tag="pYV0010"
                     /note="conjugal transfer nickase/helicase TraI;
                     Provisional; Region: PRK13709"
                     /db_xref="CDD:237478"
     gene            8586..8774
                     /locus_tag="pYV0011"
                     /db_xref="GeneID:2952904"
     CDS             8586..8774
                     /locus_tag="pYV0011"
                     /note="identical to C-term of Y. pestis YPCC1.85"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remname"
                     /protein_id="YP_068424.1"
                     /db_xref="GI:51593857"
                     /db_xref="GOA:Q663F6"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="UniProtKB/TrEMBL:Q663F6"
                     /db_xref="GeneID:2952904"
                     /translation="MRKWIRQYKEEVSGVTPDNPALTPEQREIQSLRAQIKRLEMEKE
                     ILKQAAVLMSEFPIKSLR"
     misc_feature    <8586..8765
                     /locus_tag="pYV0011"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     gene            complement(8771..8980)
                     /locus_tag="pYV0012"
                     /db_xref="GeneID:2952905"
     CDS             complement(8771..8980)
                     /locus_tag="pYV0012"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068425.1"
                     /db_xref="GI:51593858"
                     /db_xref="UniProtKB/TrEMBL:Q663F5"
                     /db_xref="GeneID:2952905"
                     /translation="MGNYMVSDEINRRNNLSDICYGHPIYVGCACINPNYINPQIQRS
                     RVNTARYFEQAAQFDHWPFCFQPCD"
     gene            complement(9103..10401)
                     /locus_tag="pYV0013"
                     /db_xref="GeneID:2952906"
     CDS             complement(9103..10401)
                     /locus_tag="pYV0013"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068426.1"
                     /db_xref="GI:51593859"
                     /db_xref="GOA:P10858"
                     /db_xref="InterPro:IPR005594"
                     /db_xref="InterPro:IPR008126"
                     /db_xref="InterPro:IPR008635"
                     /db_xref="InterPro:IPR008640"
                     /db_xref="InterPro:IPR011254"
                     /db_xref="UniProtKB/Swiss-Prot:P10858"
                     /db_xref="GeneID:2952906"
                     /translation="MTKDFKISVSAALISALFSSPYAFAEEPEDGNDGIPRLSAVQIS
                     PNVDPKLGVGLYPAKPILRQENPKLPPRGPQGPEKKRARLAEAIQPQVLGGLDARAKG
                     IHSIAIGATAEAAKPAAVAVGAGSIATGVNSVAIGPLSKALGDSAVTYGASSTAQKDG
                     VAIGARASASDTGVAVGFNSKVDAQNSVAIGHSSHVAADHGYSIAIGDLSKTDRENSV
                     SIGHESLNRQLTHLAAGTKDNDAVNVAQLKKEMAETLENARKETLAQSNDVLDAAKKH
                     SNSVARTTLETAEEHANKKSAEALVSAKVYADSNSSHTLKTANSYTDVTVSSSTKKAI
                     SESNQYTDHKFSQLDNRLDKLDKRVDKGLASSAALNSLFQPYGVGKVNFTAGVGGYRS
                     SQALAIGSGYRVNESVALKAGVAYAGSSNVMYNASFNIEW"
     misc_feature    complement(9685..10029)
                     /locus_tag="pYV0013"
                     /note="YadA-like, left-handed beta-roll; Region:
                     LbR_YadA-like; cd12820"
                     /db_xref="CDD:240612"
     misc_feature    complement(order(9694..9711,9718..9723,9727..9729,
                     9739..9744,9748..9750,9754..9756,9778..9786,9790..9792,
                     9796..9798,9826..9834,9838..9840,9844..9846,9868..9876,
                     9880..9882,9886..9888,9907..9915,9919..9921,9925..9927,
                     9946..9954,9958..9960,9964..9966,9988..9993,10006..10008))
                     /locus_tag="pYV0013"
                     /note="trimer interface [polypeptide binding]; other site"
                     /db_xref="CDD:240612"
     misc_feature    complement(9106..9339)
                     /locus_tag="pYV0013"
                     /note="YadA-like C-terminal region; Region: YadA_anchor;
                     pfam03895"
                     /db_xref="CDD:252233"
     gene            11010..11234
                     /locus_tag="pYV0014"
                     /pseudo
                     /db_xref="GeneID:2952907"
     misc_feature    11010..11234
                     /locus_tag="pYV0014"
                     /note="similar to N-term of Y. pestis YPCD1.89"
                     /pseudo
                     /db_xref="PSEUDO:CAF25357.1"
     gene            11219..11389
                     /locus_tag="pYV0015"
                     /pseudo
                     /db_xref="GeneID:2952908"
     misc_feature    11219..11389
                     /locus_tag="pYV0015"
                     /note="similar to C-term of Y. pestis YPCD1.89"
                     /pseudo
                     /db_xref="PSEUDO:CAF25358.1"
     gene            complement(11386..13701)
                     /locus_tag="pYV0016"
                     /db_xref="GeneID:2952909"
     CDS             complement(11386..13701)
                     /locus_tag="pYV0016"
                     /note="similar to Y. pestis YPCD1.90c"
                     /codon_start=1
                     /transl_table=11
                     /product="tnpA; transposase protein"
                     /protein_id="YP_068427.1"
                     /db_xref="GI:51593860"
                     /db_xref="GOA:Q663P8"
                     /db_xref="InterPro:IPR002513"
                     /db_xref="UniProtKB/TrEMBL:Q663P8"
                     /db_xref="GeneID:2952909"
                     /translation="MPVDFLTTEQEQNYGCYVAEPNDVQLVRYFHLDERDLAFIYQRR
                     GKHNRLGIALQLTTARFLGTFITDLTQVLPGVQHFVAVQLNIRRPEVLSRYAERDTTR
                     REHTAQIKEYYGYHEFGDFPWSFRLKRLLYTRAWLSNERPGLMFDFATAWLLQNKILL
                     PGATTLVRLVSEIRERANQRLWKKLAAIHYLTELNGTKKRLLDDAPEHIITGPWKRLV
                     YDAEGRIQRAGYSLCLLERLQDALRRRDIWLKNSDRWGDLREKLLQGEEWQAQRVLVC
                     RALGHPTDGHKGVQQLAVQLDETWRAVASRFEGNTEVHICNDGKYPSLTISSLEKLEE
                     PLSLLRLNNRVRQLLPPVDLTELLLEIDARTGFTREFTHVSESGARAQDLHISLCAVL
                     MAEACNIGLEPLIKHNIPALTRHRLSWMKQNYLQAETLVSANARLVDFQSTLELARRW
                     GGGEVASVDGMRFVTPVKTVNSGPNRKYFGSGRGITWYNFVSDQYSGFHGIVVPGTLR
                     DSIFVLEGLLEQQTGLNPVEIMTDTAGTSDIIFGLFWLLGYQFSPRLADAGEAVFWRV
                     DKSANYGALDELARGCADLSKAENQWDEMMRTAGSLKLGTIHASELIRSLLKSSRPSG
                     LAQAIMAVGRVNKTLYLLNYIDDEDYRRRILTQLNRGESRHAVARAICYGQRGEIRKR
                     YREGQEDQLGALGLVTNAVVLWNTLYMQEALSWMRSNGEETRDEDIARLSPLMHGHIN
                     MLGHYTFTLSDDILNGELRALNFNLNNELSP"
     misc_feature    complement(13180..13689)
                     /locus_tag="pYV0016"
                     /note="Domain of unknown function (DUF4158); Region:
                     DUF4158; pfam13700"
                     /db_xref="CDD:257998"
     misc_feature    complement(11467..12636)
                     /locus_tag="pYV0016"
                     /note="Tn3 transposase DDE domain; Region: DDE_Tnp_Tn3;
                     pfam01526"
                     /db_xref="CDD:250685"
     gene            13865..14416
                     /locus_tag="pYV0017"
                     /db_xref="GeneID:2952910"
     CDS             13865..14416
                     /locus_tag="pYV0017"
                     /note="identical to Y. pestis YPCD1.91"
                     /codon_start=1
                     /transl_table=11
                     /product="resolvase"
                     /protein_id="YP_068428.1"
                     /db_xref="GI:51593861"
                     /db_xref="GOA:Q663P7"
                     /db_xref="InterPro:IPR000209"
                     /db_xref="InterPro:IPR006118"
                     /db_xref="InterPro:IPR006119"
                     /db_xref="InterPro:IPR006120"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="UniProtKB/TrEMBL:Q663P7"
                     /db_xref="GeneID:2952910"
                     /translation="MRLFGYARVSTSQQSLDIQIKTLKDAGVKANRIFTDKASGSSAD
                     REGLDLLRMKVEEGDVILVKKLDRLGRDTVDMIQLIKEFDAQGVSIQFIDDGISTDGE
                     MGKMVVTILSAVAQAERQRILERTNEGREEAKLKGVKFGRKRRINRKELLELHEQGMG
                     ATEIAKKMNIARSTIYKVINESQ"
     misc_feature    13865..14410
                     /locus_tag="pYV0017"
                     /note="Site-specific recombinases, DNA invertase Pin
                     homologs [DNA replication, recombination, and repair];
                     Region: PinR; COG1961"
                     /db_xref="CDD:224872"
     misc_feature    13871..14251
                     /locus_tag="pYV0017"
                     /note="Serine Recombinase (SR) family, Resolvase and
                     Invertase subfamily, catalytic domain; members contain a
                     C-terminal DNA binding domain. Serine recombinases
                     catalyze site-specific recombination of DNA molecules by a
                     concerted, four-strand cleavage and...; Region: SR_ResInv;
                     cd03768"
                     /db_xref="CDD:239737"
     misc_feature    order(13886..13888,13892..13894,14063..14068,14075..14077)
                     /locus_tag="pYV0017"
                     /note="catalytic residues [active]"
                     /db_xref="CDD:239737"
     misc_feature    13892..13894
                     /locus_tag="pYV0017"
                     /note="catalytic nucleophile [active]"
                     /db_xref="CDD:239737"
     misc_feature    order(14060..14062,14192..14197,14201..14206,14216..14218)
                     /locus_tag="pYV0017"
                     /note="Presynaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(14078..14080,14093..14098,14180..14182,14189..14194,
                     14201..14206,14213..14215,14222..14224)
                     /locus_tag="pYV0017"
                     /note="Synaptic Antiparallel dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(14147..14155,14180..14185,14192..14197,14204..14206,
                     14216..14218,14225..14227,14237..14239)
                     /locus_tag="pYV0017"
                     /note="Synaptic Flat tetramer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(14147..14149,14195..14197,14204..14206,14216..14218,
                     14225..14227,14237..14239)
                     /locus_tag="pYV0017"
                     /note="Synaptic Site I dimer interface [polypeptide
                     binding]; other site"
                     /db_xref="CDD:239737"
     misc_feature    order(14219..14221,14237..14242)
                     /locus_tag="pYV0017"
                     /note="DNA binding site [nucleotide binding]"
                     /db_xref="CDD:239737"
     misc_feature    14285..14410
                     /locus_tag="pYV0017"
                     /note="Helix-turn-helix domain of resolvase; Region:
                     HTH_7; pfam02796"
                     /db_xref="CDD:145774"
     misc_feature    order(14288..14296,14381..14386,14390..14398)
                     /locus_tag="pYV0017"
                     /note="DNA-binding interface [nucleotide binding]; DNA
                     binding site"
                     /db_xref="CDD:259851"
     gene            15467..15733
                     /locus_tag="pYV0018"
                     /db_xref="GeneID:2952911"
     CDS             15467..15733
                     /locus_tag="pYV0018"
                     /note="identical to Y. pestis YPCD1.93"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068429.1"
                     /db_xref="GI:51593862"
                     /db_xref="GOA:Q663P6"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="UniProtKB/TrEMBL:Q663P6"
                     /db_xref="GeneID:2952911"
                     /translation="MKKTRYTEEQIAFALKQAETGTRVEEVCRKMGISEATFYNWKKK
                     FGGMGVTELRRLRQLEDENQRLKRLVADLSLDKEMLQDVIRKKF"
     misc_feature    15470..15682
                     /locus_tag="pYV0018"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     gene            15757..16566
                     /locus_tag="pYV0019"
                     /db_xref="GeneID:2952912"
     CDS             15757..16566
                     /locus_tag="pYV0019"
                     /note="similar to Y. pestis YPCD1.94"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068430.1"
                     /db_xref="GI:51593863"
                     /db_xref="GOA:Q663P5"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663P5"
                     /db_xref="GeneID:2952912"
                     /translation="MEYLLAAYRIGVRRGCRLMMQSRTVYNYRSHRDDRAITQRIREI
                     AETRIRYGCPRIHILLRREGWLVNHKKTHRIYCLEGLNLRSKRPRRHVTAKHRHARPE
                     VTALEQCWSMDFVADNLFNGRRVRALTIVDNFSRECLALEVGQGLRGDDVVAVMDRLK
                     HSLGRIPQRLQTDNGSEFISKSMDRWAYENRVTMDFSRPGKPTDNAFIESFNGSLRDE
                     CLNVHGFLSLEDAQEKIEQWRQEYNHFRPHSSLNNLTPAEFARSHQKGPDL"
     misc_feature    15781..16539
                     /locus_tag="pYV0019"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: Tra5;
                     COG2801"
                     /db_xref="CDD:225361"
     misc_feature    15850..16023
                     /locus_tag="pYV0019"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    16084..16413
                     /locus_tag="pYV0019"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    16324..16524
                     /locus_tag="pYV0019"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(16714..17139)
                     /locus_tag="pYV0020"
                     /db_xref="GeneID:2952913"
     CDS             complement(16714..17139)
                     /locus_tag="pYV0020"
                     /note="similar to Y. pestis YPCD1.95c"
                     /codon_start=1
                     /transl_table=11
                     /product="sycH; yopH targeting protein"
                     /protein_id="YP_068431.1"
                     /db_xref="GI:51593864"
                     /db_xref="GOA:Q56934"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="UniProtKB/TrEMBL:Q56934"
                     /db_xref="GeneID:2952913"
                     /translation="MRTYSSLLEEFATELGLEEIETNELGHGAVTIDKIWVVHLAPIN
                     EKELVAFMRAGILTGQSQLYDILRKNLFSPLSGVIRCALDKDDHWLLWSQLNINDTSG
                     TQLASVLTSLVDKAVTLSCEPTMKKEEDDHRPSSSHLLV"
     misc_feature    complement(16783..17124)
                     /locus_tag="pYV0020"
                     /note="Tir chaperone protein (CesT) family; Region: CesT;
                     pfam05932"
                     /db_xref="CDD:253463"
     gene            complement(17484..17915)
                     /locus_tag="pYV0021"
                     /db_xref="GeneID:2952914"
     CDS             complement(17484..17915)
                     /locus_tag="pYV0021"
                     /note="similar to Y. pestis YPCD1.96c"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068432.1"
                     /db_xref="GI:51593865"
                     /db_xref="GOA:Q663P3"
                     /db_xref="InterPro:IPR002611"
                     /db_xref="UniProtKB/TrEMBL:Q663P3"
                     /db_xref="GeneID:2952914"
                     /translation="MHELEALLSRLKMEHLSYHVESLLEQAAKKELNYREFLCMALQQ
                     EWNGRHQRGMESRLKQARLPWVKTLEQFDFTFQPGIDRKVVRELAGLAFVERCENVIL
                     LGPPGVGKTHLAVALGVKAADAGHRVLFMPLYEDITNIGVY"
     misc_feature    complement(<17523..17681)
                     /locus_tag="pYV0021"
                     /note="The AAA+ (ATPases Associated with a wide variety of
                     cellular Activities) superfamily represents an ancient
                     group of ATPases belonging to the ASCE (for additional
                     strand, catalytic E) division of the P-loop NTPase fold.
                     The ASCE division also includes ABC; Region: AAA; cd00009"
                     /db_xref="CDD:99707"
     misc_feature    complement(17583..17606)
                     /locus_tag="pYV0021"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:99707"
     misc_feature    complement(17580..17603)
                     /locus_tag="pYV0021"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:99707"
     gene            complement(17915..19087)
                     /locus_tag="pYV0022"
                     /db_xref="GeneID:2952915"
     CDS             complement(17915..19087)
                     /locus_tag="pYV0022"
                     /note="similar to fusion of Y.pestis YPCD1.03c and
                     YPCD1.97c"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068433.1"
                     /db_xref="GI:51593866"
                     /db_xref="GOA:Q663P2"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR007101"
                     /db_xref="InterPro:IPR010982"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663P2"
                     /db_xref="GeneID:2952915"
                     /translation="MLSREDFYMIKQMRQQGAYIIDIATQVGCSERTVRRYLKYPEPP
                     ARKTRHKMVKLKPFMDYIDMRLAENVWNSEVILAEIKAMGYTGGRSMLRYYIQPKRKM
                     RPSKRTVRFETQPGYQLQHDWGEVELEVAGQRCKVNFAVNTLGFSRRFHVFAAPKQDA
                     EHTYESLVRAFRYFGGSVKTVLVDNQKAAVLKNNNGKVVFNSGFLLLAEHYDFLPRAC
                     RPRRARTKGKVERMVKYLKDNVFVRYRRFDSFTHVNQQLEQWMADVADKRELRQFRQT
                     PEQRFALEQEHLQPLPDTDFDTSYFDIRHVSWDSYIEVGGNRYSVPEALCGQPVSIRI
                     SLDDELRSYSNEQQVASHRLCSASSGWQTVPEHHAPLWQQVSMVEHRPLSAYEELL"
     misc_feature    complement(18248..19087)
                     /locus_tag="pYV0022"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG4584"
                     /db_xref="CDD:226950"
     misc_feature    complement(18971..19084)
                     /locus_tag="pYV0022"
                     /note="Helix-turn-helix domain; Region: HTH_38; pfam13936"
                     /db_xref="CDD:258198"
     misc_feature    complement(18368..18751)
                     /locus_tag="pYV0022"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            19220..19834
                     /locus_tag="pYV0023"
                     /db_xref="GeneID:2952916"
     CDS             19220..19834
                     /locus_tag="pYV0023"
                     /note="similar to Y. pestis YPCD1.04"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remnant"
                     /protein_id="YP_068434.1"
                     /db_xref="GI:51593867"
                     /db_xref="GOA:Q663P1"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663P1"
                     /db_xref="GeneID:2952916"
                     /translation="MYRLYHLSSLGVKRRRRRKGLATERLPLLRPAAPNLTWSMDFVM
                     DALATGRRIKCLTCVDDYTKECLTVTVAFGISGVQVTRILDSIALFRGYPATIRTDQG
                     PEFTCRALDQWAFEHGVELRLIQPGKPTQNGFIESFNGRFRDECLNEHWFSDVSHARK
                     TISEWRQDYNECRPHSTLNYQTPSEFAAAWRKGNSDSEGSDITK"
     misc_feature    19307..19657
                     /locus_tag="pYV0023"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    <19316..19795
                     /locus_tag="pYV0023"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: Tra5;
                     COG2801"
                     /db_xref="CDD:225361"
     misc_feature    19568..19768
                     /locus_tag="pYV0023"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(19897..20289)
                     /locus_tag="pYV0024"
                     /db_xref="GeneID:2952917"
     CDS             complement(19897..20289)
                     /locus_tag="pYV0024"
                     /note="similar to Y. pestis YPCD1.05c"
                     /codon_start=1
                     /transl_table=11
                     /product="sycE, yerA; yopE chaperone"
                     /protein_id="YP_068435.1"
                     /db_xref="GI:51593868"
                     /db_xref="GOA:Q663P0"
                     /db_xref="InterPro:IPR005416"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="UniProtKB/TrEMBL:Q663P0"
                     /db_xref="GeneID:2952917"
                     /translation="MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVG
                     QILMFTLPSLDNNDEKETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNS
                     LYTQLEMLVQGAERLQTSSLISPPRSFS"
     misc_feature    complement(19936..20274)
                     /locus_tag="pYV0024"
                     /note="Tir chaperone protein (CesT) family; Region: CesT;
                     pfam05932"
                     /db_xref="CDD:253463"
     gene            20483..21142
                     /locus_tag="pYV0025"
                     /db_xref="GeneID:2952918"
     CDS             20483..21142
                     /locus_tag="pYV0025"
                     /note="identical to Y. pestis YPCD1.06"
                     /codon_start=1
                     /transl_table=11
                     /product="outer membrane virulence protein"
                     /protein_id="YP_068436.1"
                     /db_xref="GI:51593869"
                     /db_xref="GOA:P08008"
                     /db_xref="InterPro:IPR003537"
                     /db_xref="PDB:1L2W"
                     /db_xref="UniProtKB/Swiss-Prot:P08008"
                     /db_xref="GeneID:2952918"
                     /translation="MKISSFISTSLPLPTSVSGSSSVGEMSGRSVSQQTSDQYANNLA
                     GRTESPQGSSLASRIIERLSSVAHSVIGFIQRMFSEGSHKPVVTPAPTPAQMPSPTSF
                     SDSIKQLAAETLPKYMQQLNSLDAEMLQKNHDQFATGSGPLRGSITQCQGLMQFCGGE
                     LQAEASAILNTPVCGIPFSQWGTIGGAASAYVASGVDLTQAANEIKGLAQQMQKLLSL
                     M"
     misc_feature    20483..20860
                     /locus_tag="pYV0025"
                     /note="YopE, N terminal; Region: YopE_N; pfam09020"
                     /db_xref="CDD:117586"
     misc_feature    20786..21136
                     /locus_tag="pYV0025"
                     /note="GTPase-activating protein (GAP) domain found in
                     bacterial cytotoxins, ExoS, SptP, and YopE. Part of
                     protein secretion system; stimulates Rac1- dependent
                     cytoskeletal changes that promote bacterial
                     internalization; Region: ToxGAP; cd00219"
                     /db_xref="CDD:119405"
     misc_feature    order(20828..20830,20894..20902,20915..20917,20924..20926)
                     /locus_tag="pYV0025"
                     /note="switch II binding region; other site"
                     /db_xref="CDD:119405"
     misc_feature    order(20897..20899,20912..20914)
                     /locus_tag="pYV0025"
                     /note="Rac1 P-loop interaction site [polypeptide binding];
                     other site"
                     /db_xref="CDD:119405"
     misc_feature    order(20912..20914,21029..21037)
                     /locus_tag="pYV0025"
                     /note="GTP binding residues [chemical binding]; other
                     site"
                     /db_xref="CDD:119405"
     misc_feature    order(20912..20914,20924..20926,21020..21022)
                     /locus_tag="pYV0025"
                     /note="switch I binding region; other site"
                     /db_xref="CDD:119405"
     gene            complement(21282..21581)
                     /locus_tag="pYV0026"
                     /db_xref="GeneID:2952919"
     CDS             complement(21282..21581)
                     /locus_tag="pYV0026"
                     /note="similar to Y. pestis YPCD1.08c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068437.1"
                     /db_xref="GI:51593870"
                     /db_xref="InterPro:IPR007712"
                     /db_xref="UniProtKB/TrEMBL:Q663N8"
                     /db_xref="GeneID:2952919"
                     /translation="MYKLSELADEDIYNIASYTIRHFGVTQAKLYHENLAKVFELLAK
                     NPELGAECNWICSDIRRFQYKKHGIYYITLSNDILISRVLHQSIDIDVQDFPEHE"
     misc_feature    complement(21294..21581)
                     /locus_tag="pYV0026"
                     /note="Plasmid stabilization system protein [General
                     function prediction only]; Region: ParE; COG3668"
                     /db_xref="CDD:226194"
     gene            complement(21574..21849)
                     /locus_tag="pYV0027"
                     /db_xref="GeneID:2952920"
     CDS             complement(21574..21849)
                     /locus_tag="pYV0027"
                     /note="similar to Y. pestis YPCD1.09c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068438.1"
                     /db_xref="GI:51593871"
                     /db_xref="GOA:Q663N7"
                     /db_xref="InterPro:IPR005360"
                     /db_xref="InterPro:IPR011570"
                     /db_xref="UniProtKB/TrEMBL:Q663N7"
                     /db_xref="GeneID:2952920"
                     /translation="MYYSVIHNGGDMAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVL
                     RDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKGTSV"
     misc_feature    complement(21601..21804)
                     /locus_tag="pYV0027"
                     /note="putative addiction module antidote protein, CC2985
                     family; Region: antidote_CC2985; TIGR02606"
                     /db_xref="CDD:233948"
     gene            complement(21960..22163)
                     /locus_tag="pYV0028"
                     /db_xref="GeneID:2952921"
     CDS             complement(21960..22163)
                     /locus_tag="pYV0028"
                     /note="similar to Y. pestis YPCD1.10c"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remnant"
                     /protein_id="YP_068439.1"
                     /db_xref="GI:51593872"
                     /db_xref="UniProtKB/TrEMBL:Q663N6"
                     /db_xref="GeneID:2952921"
                     /translation="MMTKHGISVEHSTLHSWVIRVVPLLHKAFCRYKCTVGRRWRMDE
                     ASKVSGNTCTGRLILAVRLSIFC"
     misc_feature    complement(<22014..22163)
                     /locus_tag="pYV0028"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3316"
                     /db_xref="CDD:225853"
     gene            22359..22532
                     /locus_tag="pYV0029"
                     /db_xref="GeneID:2952922"
     CDS             22359..22532
                     /locus_tag="pYV0029"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068440.1"
                     /db_xref="GI:51593873"
                     /db_xref="UniProtKB/TrEMBL:Q663N5"
                     /db_xref="GeneID:2952922"
                     /translation="MKSPYPTWRDGYRYQKADIMLNDVGSRPGQIDMFDETPPHANSK
                     HLMQVVDASIALG"
     misc_feature    <22380..22511
                     /locus_tag="pYV0029"
                     /note="DNA polymerase V subunit UmuC; Reviewed; Region:
                     umuC; PRK03609"
                     /db_xref="CDD:179607"
     gene            complement(22682..22975)
                     /locus_tag="pYV0030"
                     /db_xref="GeneID:2952923"
     CDS             complement(22682..22975)
                     /locus_tag="pYV0030"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068441.1"
                     /db_xref="GI:51593874"
                     /db_xref="UniProtKB/TrEMBL:Q663N4"
                     /db_xref="GeneID:2952923"
                     /translation="MDIQVGPWSQLLTLALDIQVGPWSQLPTLALDIQVGPWSQLLTL
                     ALDIQVGPWSQLPTLTLDIQVGPWSQLPTLALDIQVGPWSQLLTLALNILVEM"
     gene            complement(23123..24088)
                     /locus_tag="pYV0031"
                     /db_xref="GeneID:2952924"
     CDS             complement(23123..24088)
                     /locus_tag="pYV0031"
                     /note="SopB"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-partitioning protein"
                     /protein_id="YP_068442.1"
                     /db_xref="GI:51593875"
                     /db_xref="GOA:Q663N3"
                     /db_xref="InterPro:IPR003115"
                     /db_xref="InterPro:IPR004437"
                     /db_xref="UniProtKB/TrEMBL:Q663N3"
                     /db_xref="GeneID:2952924"
                     /translation="MMKRSPVLRNAPSINFDDAKPAISNAEPSVSAPAVSQLASRVSG
                     MKGNTIVLPVCGRNVAFTLKVIAAPDVESKTIVFSGNERNQALLSETSLDDLIPSFLT
                     SGQQIPAFAREHNGNIEVADGSRRRKAAILTGSDYKVLVGNLNDEQMLWLSQIANEYR
                     PTSAYERGLRYAQRLISEFEGNISKLAEAEHLSRKIIQRCIKTAGLPLKTIQLFANPN
                     ELSARSGEALSKAYENNVDTLKRVTYKIMKQKQEGRQFTTEELIVLLMPERKQPENIH
                     KKSFGKNIEAKYSKDNVSFYLKSVPESLVKQIEELLNTYAKEHSL"
     misc_feature    complement(23129..24085)
                     /locus_tag="pYV0031"
                     /note="plasmid-partitioning protein; Provisional; Region:
                     PRK13698"
                     /db_xref="CDD:184254"
     misc_feature    complement(23618..23851)
                     /locus_tag="pYV0031"
                     /note="ParB-like nuclease domain; Region: ParB;
                     smart00470"
                     /db_xref="CDD:214678"
     gene            complement(24085..25251)
                     /locus_tag="pYV0032"
                     /db_xref="GeneID:2952925"
     CDS             complement(24085..25251)
                     /locus_tag="pYV0032"
                     /note="similar to Y. pestis YPCD1.13c"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid-partitioning protein SopA"
                     /protein_id="YP_068443.2"
                     /db_xref="GI:229310099"
                     /db_xref="GOA:Q663N2"
                     /db_xref="InterPro:IPR000551"
                     /db_xref="InterPro:IPR002586"
                     /db_xref="InterPro:IPR009061"
                     /db_xref="UniProtKB/TrEMBL:Q663N2"
                     /db_xref="GeneID:2952925"
                     /translation="MDLKSTLDRCIERGQFMTQEIAKSQFGNDSPAARTITRRWRITE
                     AAELVGVTPQTIRNYEDSGKLPPPDTAMIGRVEQRTGYSIQQINDMRDVFKTRLSKPK
                     GENPVVLAIAAHKGGAYKTSTSVHIAQWMALQGLRVLLIDATDPQATASLYHGYVPDL
                     HIHEEDTLLPYYLGQRDDAAYAIKPTCWPNLEVIPSCLAVHRIESEIYGLHDQGKLPV
                     APHLLLRAAIESVWDSYDVVVLDSAPNLGIGTINVVCAADVIVVPTPAELYDYVSTLQ
                     FFTMLRDLMSNIDLNGFEPDVRVLITKFSNAIGSQSQWMDDQIRNAWGGMVLKEVVRV
                     TDEVGKGQVRMRTVFEQAANQRSTPAAWRNAVSIWEPVCAEIFNRLVKPRWENA"
     misc_feature    complement(24088..25251)
                     /locus_tag="pYV0032"
                     /note="plasmid-partitioning protein SopA; Provisional;
                     Region: PRK13705"
                     /db_xref="CDD:184261"
     misc_feature    complement(order(25012..25020,25081..25083,25123..25131))
                     /locus_tag="pYV0032"
                     /note="DNA binding residues [nucleotide binding]"
                     /db_xref="CDD:133389"
     misc_feature    complement(25027..25131)
                     /locus_tag="pYV0032"
                     /note="MerR family regulatory protein; Region: MerR;
                     pfam00376"
                     /db_xref="CDD:249811"
     misc_feature    complement(24346..24930)
                     /locus_tag="pYV0032"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    complement(<24520..24909)
                     /locus_tag="pYV0032"
                     /note="The Fer4_NifH superfamily contains a variety of
                     proteins which share a common ATP-binding domain.
                     Functionally, proteins in this superfamily use the energy
                     from hydrolysis of NTP to transfer electron or ion;
                     Region: Fer4_NifH; cl17203"
                     /db_xref="CDD:266552"
     misc_feature    complement(24889..24909)
                     /locus_tag="pYV0032"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    complement(order(24529..24531,24889..24891))
                     /locus_tag="pYV0032"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            25800..25913
                     /locus_tag="pYV0033"
                     /db_xref="GeneID:2952926"
     CDS             25800..25913
                     /locus_tag="pYV0033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068444.1"
                     /db_xref="GI:51593877"
                     /db_xref="UniProtKB/TrEMBL:Q663N1"
                     /db_xref="GeneID:2952926"
                     /translation="MPKSLNAAKWVSIARIMAEGTAYEVEPDLCFTALGTV"
     gene            complement(26051..26245)
                     /locus_tag="pYV0034"
                     /db_xref="GeneID:2952927"
     CDS             complement(26051..26245)
                     /locus_tag="pYV0034"
                     /note="similar to Y. pestis YPCD1.14c"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remnant"
                     /protein_id="YP_068445.1"
                     /db_xref="GI:51593878"
                     /db_xref="GOA:Q663N0"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663N0"
                     /db_xref="GeneID:2952927"
                     /translation="MQSMSRRGNCLDNSPMERVFRSLKSEWLPVGGYMDVHHAVRDIG
                     EWIQSYYNTPPSAQWWITAL"
     misc_feature    complement(26087..26242)
                     /locus_tag="pYV0034"
                     /note="Integrase core domain; Region: rve_3; cl15866"
                     /db_xref="CDD:265813"
     gene            complement(26357..26815)
                     /locus_tag="pYV0035"
                     /db_xref="GeneID:2952928"
     CDS             complement(26357..26815)
                     /locus_tag="pYV0035"
                     /note="similar to Y. pestis YPCD1.15c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068446.1"
                     /db_xref="GI:51593879"
                     /db_xref="GOA:Q663M9"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663M9"
                     /db_xref="GeneID:2952928"
                     /translation="MVELCRLLKITRSVYSASLNLRVDVKRLQLRELHQQSRGAAGNR
                     TLSLLMRQSGYNVGRWLAGRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPS
                     EPNRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRA"
     misc_feature    complement(26579..26731)
                     /locus_tag="pYV0035"
                     /note="HTH-like domain; Region: HTH_21; pfam13276"
                     /db_xref="CDD:257619"
     misc_feature    complement(<26360..26518)
                     /locus_tag="pYV0035"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            complement(26842..27102)
                     /locus_tag="pYV0036"
                     /db_xref="GeneID:2952929"
     CDS             complement(26842..27102)
                     /locus_tag="pYV0036"
                     /note="similar to Y. pestis YPCD1.85"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068447.1"
                     /db_xref="GI:51593880"
                     /db_xref="GOA:Q663M8"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="UniProtKB/TrEMBL:Q663M8"
                     /db_xref="GeneID:2952929"
                     /translation="MSRVVKYQRSTIEVARALELDPSQLRKWIHQYKEEVSGVTPDNP
                     ALIPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLR"
     misc_feature    complement(26851..27093)
                     /locus_tag="pYV0036"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG2963"
                     /db_xref="CDD:225511"
     misc_feature    complement(26917..>27093)
                     /locus_tag="pYV0036"
                     /note="Transposase; Region: HTH_Tnp_1; cl17663"
                     /db_xref="CDD:266764"
     gene            complement(27269..27874)
                     /locus_tag="pYV0037"
                     /pseudo
                     /db_xref="GeneID:2952930"
     misc_feature    complement(27269..27874)
                     /locus_tag="pYV0037"
                     /pseudo
                     /db_xref="PSEUDO:CAF25380.1"
     gene            complement(27894..28007)
                     /locus_tag="pYV0038"
                     /pseudo
                     /db_xref="GeneID:2952931"
     misc_feature    complement(27894..28007)
                     /locus_tag="pYV0038"
                     /pseudo
                     /db_xref="PSEUDO:CAF25381.1"
     gene            complement(28171..28353)
                     /locus_tag="pYV0039"
                     /db_xref="GeneID:2952932"
     CDS             complement(28171..28353)
                     /locus_tag="pYV0039"
                     /note="similar to Y. pestis YPCD1.18c"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068448.1"
                     /db_xref="GI:51593881"
                     /db_xref="UniProtKB/TrEMBL:Q663M7"
                     /db_xref="GeneID:2952932"
                     /translation="MPMKEIAKRVHRIYCLLKLNIRRKGKQRLPACNPSPLAVPERLN
                     LSGSVDFMHNAQCTMH"
     misc_feature    complement(<28267..>28347)
                     /locus_tag="pYV0039"
                     /note="glycine dehydrogenase; Provisional; Region:
                     PRK12566"
                     /db_xref="CDD:171585"
     gene            complement(28491..29039)
                     /locus_tag="pYV0040"
                     /db_xref="GeneID:2952933"
     CDS             complement(28491..29039)
                     /locus_tag="pYV0040"
                     /note="similar to Y. pestis YPCD1.19c, yopK, yopQ,
                     probable virulence determinant protein"
                     /codon_start=1
                     /transl_table=11
                     /product="yop targeting protein yopK, yopQ"
                     /protein_id="YP_068449.1"
                     /db_xref="GI:51593882"
                     /db_xref="UniProtKB/TrEMBL:Q56935"
                     /db_xref="GeneID:2952933"
                     /translation="MFIKDTYNMRALCTALEQSAPDTIINTSKEENNSYYCATAHLLR
                     TDVCSLVNRVGIEPLKSGSILSTLEELWQAVGIVYRLYEWQHVSDIDTNFKKLPNNSD
                     FGLVFSVLDCDIEYVFIGKKDSEGNIEFYDPKNSLLIENDDIKKYLYDENFHRFCIML
                     IISKSELEELSRESCDQECIMG"
     gene            29513..30481
                     /locus_tag="pYV0041"
                     /db_xref="GeneID:2952934"
     CDS             29513..30481
                     /locus_tag="pYV0041"
                     /note="similar to Y. pestis YPCD1.20"
                     /codon_start=1
                     /transl_table=11
                     /product="yop targeted effector yopT"
                     /protein_id="YP_068450.1"
                     /db_xref="GI:51593883"
                     /db_xref="GOA:Q93RN4"
                     /db_xref="InterPro:IPR003951"
                     /db_xref="InterPro:IPR006473"
                     /db_xref="UniProtKB/Swiss-Prot:Q93RN4"
                     /db_xref="GeneID:2952934"
                     /translation="MNSIHGHYHIQLSNYSAGENLQSATLTEGVIGAHRVKVETALSH
                     SNLQKKLSATIKHNQSGRSMLDRKLTSDGKANQRSSFTFSMIMYRMIHFVLSTRVPAV
                     RESVANYGGNINFKFAQTKGAFLHKIIKHSDTASGVCEALCAHWIRSHAQGQSLFDQL
                     YVGGRKGKFQIDTLYSIKQLQIDGCKADVDQDEVTLDWFKKNGISERMIERHCLLRPV
                     DVTGTTESEGLDQLLNAILDTHGIGYGYKKIHLSGQMSAHAIAAYVNEKSGVTFFDPN
                     FGEFHFSDKEKFRKWFTNSFWDNSMYHYPLGVGQRFRVLTFDSKEV"
     misc_feature    29825..30472
                     /locus_tag="pYV0041"
                     /note="Yersinia/Haemophilus virulence surface antigen;
                     Region: Peptidase_C58; pfam03543"
                     /db_xref="CDD:252019"
     gene            30481..30873
                     /locus_tag="pYV0042"
                     /db_xref="GeneID:2952935"
     CDS             30481..30873
                     /locus_tag="pYV0042"
                     /note="similar to Y. pestis YPCD1.21"
                     /codon_start=1
                     /transl_table=11
                     /product="yopT chaperone"
                     /protein_id="YP_068451.1"
                     /db_xref="GI:51593884"
                     /db_xref="GOA:Q663M4"
                     /db_xref="InterPro:IPR005416"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="UniProtKB/TrEMBL:Q663M4"
                     /db_xref="GeneID:2952935"
                     /translation="MQTTFTELMQQLFLKLGLNHQVNENDVYTFEVDGHIQVLIACYH
                     QQWVQLFSELGADLPTNDNLFGEHWPAHVQGRLDGKPILWSQQSLVGLDIDEMQAWLE
                     RFIDDIEQRKEPQNTKFQPNSTSPILFI"
     misc_feature    30499..30816
                     /locus_tag="pYV0042"
                     /note="Tir chaperone protein (CesT) family; Region: CesT;
                     pfam05932"
                     /db_xref="CDD:253463"
     gene            31368..31559
                     /locus_tag="pYV0043"
                     /db_xref="GeneID:2952936"
     CDS             31368..31559
                     /locus_tag="pYV0043"
                     /note="similar to Y. pestis YPCD1.24c"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remnant"
                     /protein_id="YP_068452.1"
                     /db_xref="GI:51593885"
                     /db_xref="UniProtKB/TrEMBL:Q663M1"
                     /db_xref="GeneID:2952936"
                     /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRDEPEYR
                     VREGSTFMNRLFNIEVVLA"
     misc_feature    <31389..31463
                     /locus_tag="pYV0043"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     gene            31576..31995
                     /locus_tag="pYV0044"
                     /db_xref="GeneID:2952937"
     CDS             31576..31995
                     /locus_tag="pYV0044"
                     /note="similar to Y. pestis YPCD1.23"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068453.1"
                     /db_xref="GI:51593886"
                     /db_xref="UniProtKB/TrEMBL:Q663M2"
                     /db_xref="GeneID:2952937"
                     /translation="MSKIPTLIICSKPAEIAVGHFITMSIKAILLYSYQEYGQHTDVF
                     IQVKFNYGMIEYKFYVNKVKFDNTPGRKLKTTIAHSSQLMGHNLTYEDYAMKKRLVIA
                     TALCAAFYAGMKVEHFLTVDACLDAGGAMQNDIFCER"
     gene            complement(32524..32715)
                     /locus_tag="pYV0045"
                     /db_xref="GeneID:2952938"
     CDS             complement(32524..32715)
                     /locus_tag="pYV0045"
                     /note="similar to Y. pestis YPCD1.24c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068454.1"
                     /db_xref="GI:51593887"
                     /db_xref="UniProtKB/TrEMBL:Q663M1"
                     /db_xref="GeneID:2952938"
                     /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRDEPEYR
                     VREGSTFMNRLFNIEVVLA"
     misc_feature    complement(32620..>32694)
                     /locus_tag="pYV0045"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     gene            32890..33189
                     /locus_tag="pYV0046"
                     /db_xref="GeneID:2952939"
     CDS             32890..33189
                     /locus_tag="pYV0046"
                     /note="similar to Y. pestis YPCD1.25"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase remnant"
                     /protein_id="YP_068455.1"
                     /db_xref="GI:51593888"
                     /db_xref="GOA:Q663M0"
                     /db_xref="InterPro:IPR001207"
                     /db_xref="UniProtKB/TrEMBL:Q663M0"
                     /db_xref="GeneID:2952939"
                     /translation="MVLQSWRKKWANLSCYFRYPTTIRKVIYMTNAIESVHRLFRKLT
                     KTKGIFPNENSLLKSLYLGLMNAQERWTMPIQSWNLALSQLAIYFEGRLDKVITL"
     misc_feature    <32893..33174
                     /locus_tag="pYV0046"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     misc_feature    <32893..33105
                     /locus_tag="pYV0046"
                     /note="Transposase, Mutator family; Region:
                     Transposase_mut; cl19537"
                     /db_xref="CDD:267890"
     gene            complement(33232..34884)
                     /locus_tag="pYV0047"
                     /db_xref="GeneID:2952940"
     CDS             complement(33232..34884)
                     /locus_tag="pYV0047"
                     /note="similar to Y. pestis YPCD1.26c"
                     /codon_start=1
                     /transl_table=11
                     /product="yopM; targeted effector protein"
                     /protein_id="YP_068456.1"
                     /db_xref="GI:51593889"
                     /db_xref="InterPro:IPR001611"
                     /db_xref="InterPro:IPR007088"
                     /db_xref="UniProtKB/TrEMBL:Q663L9"
                     /db_xref="GeneID:2952940"
                     /translation="MYGFVCSEKLDNKNIFRKAFNMFINPRNVSNTFLQEPLRHSSNL
                     TEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNL
                     GLSSLPELPPHLESLVASCNSLTELPELPQSLKSLQVENNNLKALPDLPPSLKKLHVR
                     ENDLTDLPELPQSLESLRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAA
                     IYADNNLLETLPDLPPSLKKLHVRENDLTDLPELPQSLESLRVDNNNLKALSDLPPSL
                     EYLTASSNKLEELPELQNLPFLAAIYADNNLLETLPDLPPHLEILVASYNSLTELPEL
                     PQSLKSLRVDNNNLKALSDLPPSLEYLTASSNKLEELPELQNLPFLAAIYADNNLLET
                     LPDLPPSLKKLHVRENDLTDLPELPQSLTFLDVSDNNISGLSELPPNLYYLDASSNEI
                     RSLCDLPPSLVDLNVKSNQLSELPALPPHLERLIASFNYLAEVPELPQNLKQLHVEQN
                     ALREFPDIPESLEELEMDSERVVDPYEFAHETTDKLEDDVFE"
     misc_feature    complement(34633..34767)
                     /locus_tag="pYV0047"
                     /note="Type III secretion system leucine rich repeat
                     protein; Region: TTSSLRR; pfam12468"
                     /db_xref="CDD:257070"
     misc_feature    complement(33649..34428)
                     /locus_tag="pYV0047"
                     /note="Leucine-rich repeats (LRRs), ribonuclease inhibitor
                     (RI)-like subfamily. LRRs are 20-29 residue sequence
                     motifs present in many proteins that participate in
                     protein-protein interactions and have different functions
                     and cellular locations. LRRs correspond...; Region:
                     LRR_RI; cd00116"
                     /db_xref="CDD:238064"
     misc_feature    complement(order(33655..33657,33661..33663,33670..33672,
                     33676..33678,33685..33687,33781..33783,33787..33789,
                     33796..33798,33802..33804,33811..33813,33841..33843,
                     33847..33849,33862..33864,33901..33903,33907..33909,
                     33916..33918,33922..33924,33931..33933,33964..33966,
                     33970..33972,33994..33996,34000..34002,34009..34011,
                     34087..34089,34093..34095,34102..34104,34108..34110,
                     34117..34119,34147..34149,34153..34155,34162..34164,
                     34168..34170,34177..34179,34210..34212,34216..34218,
                     34225..34227,34228..34230,34273..34275,34279..34281,
                     34288..34290,34294..34296,34303..34305,34333..34335,
                     34339..34341,34348..34350,34354..34356,34363..34365,
                     34408..34410,34414..34416,34423..34425))
                     /locus_tag="pYV0047"
                     /note="Leucine-rich repeats; other site"
                     /db_xref="CDD:238064"
     misc_feature    complement(order(33673..33675,33793..33795,33799..33801,
                     33850..33852,33973..33975,34096..34098,34219..34221,
                     34342..34347))
                     /locus_tag="pYV0047"
                     /note="Substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238064"
     misc_feature    complement(<33349..33900)
                     /locus_tag="pYV0047"
                     /note="Leucine-rich repeats (LRRs), ribonuclease inhibitor
                     (RI)-like subfamily. LRRs are 20-29 residue sequence
                     motifs present in many proteins that participate in
                     protein-protein interactions and have different functions
                     and cellular locations. LRRs correspond...; Region:
                     LRR_RI; cd00116"
                     /db_xref="CDD:238064"
     misc_feature    complement(order(33355..33357,33361..33363,33370..33372,
                     33376..33378,33385..33387,33421..33423,33430..33432,
                     33436..33438,33445..33447,33475..33477,33481..33483,
                     33490..33492,33496..33498,33505..33507,33595..33597,
                     33601..33603,33610..33612,33616..33618,33625..33627,
                     33655..33657,33661..33663,33670..33672,33676..33678,
                     33685..33687,33718..33720,33724..33726,33733..33735,
                     33736..33738,33781..33783,33787..33789,33796..33798,
                     33802..33804,33811..33813,33841..33843,33847..33849,
                     33856..33858,33862..33864,33871..33873))
                     /locus_tag="pYV0047"
                     /note="Leucine-rich repeats; other site"
                     /db_xref="CDD:238064"
     misc_feature    complement(order(33364..33366,33484..33486,33604..33606,
                     33727..33729,33850..33855))
                     /locus_tag="pYV0047"
                     /note="Substrate binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238064"
     gene            complement(35009..35104)
                     /locus_tag="pYV0048"
                     /db_xref="GeneID:2952941"
     CDS             complement(35009..35104)
                     /locus_tag="pYV0048"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068457.1"
                     /db_xref="GI:51593890"
                     /db_xref="UniProtKB/TrEMBL:Q663L8"
                     /db_xref="GeneID:2952941"
                     /translation="MAGIETTAPKYTDLKFNDIAGKVDSAAIQYF"
     gene            complement(35209..35424)
                     /locus_tag="pYV0049"
                     /db_xref="GeneID:2952942"
     CDS             complement(35209..35424)
                     /locus_tag="pYV0049"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068458.1"
                     /db_xref="GI:51593891"
                     /db_xref="UniProtKB/TrEMBL:Q663L7"
                     /db_xref="GeneID:2952942"
                     /translation="MNSLSFHDNSIFCNKPKYSDAEVAQTLDTAQKHTLTVSKGVLDT
                     AKQYTNTVSSNTLDSANTYTNNKADSH"
     gene            35445..35567
                     /locus_tag="pYV0050"
                     /db_xref="GeneID:2952943"
     CDS             35445..35567
                     /locus_tag="pYV0050"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068459.1"
                     /db_xref="GI:51593892"
                     /db_xref="UniProtKB/TrEMBL:Q663L6"
                     /db_xref="GeneID:2952943"
                     /translation="MAPGDFKWEHFAPDELCQCQRYAVRAWDFRLSLYHLPLVY"
     gene            35593..35916
                     /locus_tag="pYV0051"
                     /db_xref="GeneID:2952944"
     CDS             35593..35916
                     /locus_tag="pYV0051"
                     /note="similar to Y. pestis Y0056, similar to Y.
                     intermedia transposase"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068460.1"
                     /db_xref="GI:51593893"
                     /db_xref="GOA:P37133"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/Swiss-Prot:P37133"
                     /db_xref="GeneID:2952944"
                     /translation="MKRYQFTDADSSWQLDEIYIRVNGKWFYLYRAINKHGTTLDFYF
                     SPKRNKNTAYPFIKRVLKTYSVERQPKILNTDKHSSYGYAITRLMKEGKDTRCCKAAA
                     SQIPE"
     misc_feature    35620..>35874
                     /locus_tag="pYV0051"
                     /note="DDE domain; Region: DDE_Tnp_IS240; pfam13610"
                     /db_xref="CDD:257924"
     gene            35951..36073
                     /locus_tag="pYV0052"
                     /db_xref="GeneID:2952945"
     CDS             35951..36073
                     /locus_tag="pYV0052"
                     /note="similar to N-term Y. pestis YPCD1.24c, possible
                     transposase remnant"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068461.1"
                     /db_xref="GI:51593894"
                     /db_xref="UniProtKB/TrEMBL:Q663L4"
                     /db_xref="GeneID:2952945"
                     /translation="MVNAAGDFKRPNRAWSTLQGFETLRRLNKGQFDIWLRRRL"
     gene            36160..36327
                     /locus_tag="pYV0053"
                     /db_xref="GeneID:2952946"
     CDS             36160..36327
                     /locus_tag="pYV0053"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068462.1"
                     /db_xref="GI:51593895"
                     /db_xref="UniProtKB/TrEMBL:Q663L3"
                     /db_xref="GeneID:2952946"
                     /translation="MSKITDSHYWDMCHSFLIAYYWNDTAFLTLSLYTSKMPITAADV
                     LNDRVLPFNNR"
     gene            complement(36551..37471)
                     /locus_tag="pYV0054"
                     /db_xref="GeneID:2952947"
     CDS             complement(36551..37471)
                     /locus_tag="pYV0054"
                     /note="similar to Y. pestis YPCD1.28c"
                     /codon_start=1
                     /transl_table=11
                     /product="yopD; Yop negative regulation/targeting
                     component"
                     /protein_id="YP_068463.1"
                     /db_xref="GI:51593896"
                     /db_xref="InterPro:IPR008898"
                     /db_xref="PDB:1KDL"
                     /db_xref="PDB:1OOS"
                     /db_xref="UniProtKB/Swiss-Prot:Q06131"
                     /db_xref="GeneID:2952947"
                     /translation="MTINIKTDSPIITTGSQLDAITTETVKQSGEIKKTEDTRHEAQA
                     IKSSEASLSRSQVPELIKPSQGINVALLSKSQGDLNGTLSILLLLLELARKAREMGLQ
                     QRDIENKATITAQKEQVAEMVSGAKLMIAMAVVSGIMAATSTVASAFSIAKEVKIVKQ
                     EQILNSNIAGREQLIDTKMQQMSNIGDKAVSREDIGRIWKPEQVADQNKLALLDKEFR
                     MTDSKANAFNAATQPLGQMANSAIQVHQGYSQAEVKEKEVNASIAANEKQKAEEAMNY
                     NDNFMKDVLRLIEQYVSSHTHAMKAAFGVV"
     misc_feature    complement(36554..37429)
                     /locus_tag="pYV0054"
                     /note="YopD protein; Region: YopD; pfam05844"
                     /db_xref="CDD:253418"
     gene            complement(37490..38695)
                     /locus_tag="pYV0055"
                     /db_xref="GeneID:2952948"
     CDS             complement(37490..38695)
                     /locus_tag="pYV0055"
                     /note="similar to Y. pestis YPCD1.29c"
                     /codon_start=1
                     /transl_table=11
                     /product="yopB; Yop targeting protein"
                     /protein_id="YP_068464.1"
                     /db_xref="GI:51593897"
                     /db_xref="GOA:Q06114"
                     /db_xref="InterPro:IPR006972"
                     /db_xref="InterPro:IPR009077"
                     /db_xref="UniProtKB/Swiss-Prot:Q06114"
                     /db_xref="GeneID:2952948"
                     /translation="MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGG
                     VSSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLAS
                     PDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKS
                     GIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLIS
                     QEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSA
                     KVAQISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKK
                     QADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLH
                     NLAGRPHTV"
     misc_feature    complement(37493..38692)
                     /locus_tag="pYV0055"
                     /note="Uncharacterized conserved protein [Function
                     unknown]; Region: COG5613"
                     /db_xref="CDD:227900"
     misc_feature    complement(37502..38380)
                     /locus_tag="pYV0055"
                     /note="Secretion system effector C (SseC) like family;
                     Region: SseC; pfam04888"
                     /db_xref="CDD:252857"
     gene            complement(38673..39179)
                     /locus_tag="pYV0056"
                     /db_xref="GeneID:2952949"
     CDS             complement(38673..39179)
                     /locus_tag="pYV0056"
                     /note="similar to Y. pestis YPCD1.30c"
                     /codon_start=1
                     /transl_table=11
                     /product="lcrH, sycD; low calcium response protein H"
                     /protein_id="YP_068465.1"
                     /db_xref="GI:51593898"
                     /db_xref="GOA:P23995"
                     /db_xref="InterPro:IPR005415"
                     /db_xref="InterPro:IPR011716"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="InterPro:IPR013026"
                     /db_xref="PDB:1OOL"
                     /db_xref="PDB:1OOS"
                     /db_xref="UniProtKB/Swiss-Prot:P23995"
                     /db_xref="GeneID:2952949"
                     /translation="MQQETTDTQEYQLAMESFLKGGGTIAMLNEISSDTLEQLYSLAF
                     NQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDLAIHSYSYGAIMDIK
                     EPRFPFHAAECLLQKGELAEAESGLFLAQELIADKPEFKELSTRVSSMLEAIKLKKEM
                     EHECVDNP"
     misc_feature    complement(38718..39119)
                     /locus_tag="pYV0056"
                     /note="type III secretion low calcium response chaperone
                     LcrH/SycD; Region: LcrH_SycD; TIGR02552"
                     /db_xref="CDD:233924"
     misc_feature    complement(38808..39071)
                     /locus_tag="pYV0056"
                     /note="Tetratricopeptide repeat domain; typically contains
                     34 amino acids
                     [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-
                     X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in
                     a variety of organisms including bacteria, cyanobacteria,
                     yeast, fungi; Region: TPR; cd00189"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(38829..38834,38841..38846,38853..38858,
                     38934..38939,38946..38951,38955..38960,39045..39050,
                     39057..39062,39066..39071))
                     /locus_tag="pYV0056"
                     /note="binding surface"
                     /db_xref="CDD:238112"
     misc_feature    complement(order(38811..38813,38847..38849,38892..38894,
                     38901..38903,38913..38915,38949..38951,38994..38996,
                     39003..39005,39015..39017,39051..39053))
                     /locus_tag="pYV0056"
                     /note="TPR motif; other site"
                     /db_xref="CDD:238112"
     gene            complement(39192..40172)
                     /locus_tag="pYV0057"
                     /db_xref="GeneID:2952950"
     CDS             complement(39192..40172)
                     /locus_tag="pYV0057"
                     /note="similar to Y. pestis YPCD1.31c"
                     /codon_start=1
                     /transl_table=11
                     /product="lcrV; V antigen, antihost protein/regulator"
                     /protein_id="YP_068466.1"
                     /db_xref="GI:51593899"
                     /db_xref="GOA:P23994"
                     /db_xref="InterPro:IPR005413"
                     /db_xref="UniProtKB/Swiss-Prot:P23994"
                     /db_xref="GeneID:2952950"
                     /translation="MIRAYEQNPQHFIEDLEKVRVEQLTGHGSSVLEELVQLVKDKNI
                     DISIKYDPRKDSEVFANRVITDDIELLKKILAYFLPEDAILKGGHYDNQLQNGIKRVK
                     EFLESSPNTQWELRAFMAVIHFSLTADRIDDDILKVIVDSMNHHGDARSKLREELAEL
                     TAELKIYSVIQAEINKHLSSGGTINIHDKSINLMDKNLYGYTDEEIFKASAEYKILEK
                     MPQTTIQEGETEKKIVSIKNFLESEKKRTGALGNLKDSYSYNKDNNELSHFATTCSDK
                     SRPLNDLVSQKTTQLSDITSRFNSAIEALNRFIQKYDSVMQRLLDDTSGK"
     misc_feature    complement(39204..40172)
                     /locus_tag="pYV0057"
                     /note="V antigen (LcrV) protein; Region: LcrV; pfam04792"
                     /db_xref="CDD:113558"
     gene            complement(40174..40461)
                     /locus_tag="pYV0058"
                     /db_xref="GeneID:2952951"
     CDS             complement(40174..40461)
                     /locus_tag="pYV0058"
                     /note="similar to Y. pestis YPCD1.32c"
                     /codon_start=1
                     /transl_table=11
                     /product="lcrG; Yop regulator"
                     /protein_id="YP_068467.1"
                     /db_xref="GI:51593900"
                     /db_xref="InterPro:IPR009863"
                     /db_xref="UniProtKB/Swiss-Prot:P69958"
                     /db_xref="GeneID:2952951"
                     /translation="MKSSHFDEYDKTLKQAELAIADSDHRAKLLQEMCADIGLTPEAV
                     MKIFAGRSAEEIKPAERELLDEIKRQRERQPQHPYDGKRPRKPTMMRGQII"
     misc_feature    complement(40177..40446)
                     /locus_tag="pYV0058"
                     /note="type III secretion protein LcrG; Region: LcrG_PcrG;
                     TIGR02573"
                     /db_xref="CDD:131624"
     gene            complement(40503..40943)
                     /locus_tag="pYV0059"
                     /db_xref="GeneID:2952952"
     CDS             complement(40503..40943)
                     /locus_tag="pYV0059"
                     /note="similar to Y. pestis YPCD1.33c"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068468.1"
                     /db_xref="GI:51593901"
                     /db_xref="GOA:P69960"
                     /db_xref="UniProtKB/Swiss-Prot:P69960"
                     /db_xref="GeneID:2952952"
                     /translation="MMADPLIPWLTEHGLVCHPHTLSGTPISLGSAFQLAGLKLAWRV
                     EIEQRRVWIVLIQRVEQRRGLKNPFAALYMLANAARAVLGPDYYLYGNVDVLAGSSLS
                     TQRLAHFYRRWTGAKELSTGWFSLKVSQVITLSNMKKRQNNGFA"
     misc_feature    complement(40518..40940)
                     /locus_tag="pYV0059"
                     /note="Type III secretion system regulator (LcrR); Region:
                     LcrR; pfam09621"
                     /db_xref="CDD:118156"
     gene            complement(40940..43054)
                     /locus_tag="pYV0060"
                     /db_xref="GeneID:2952953"
     CDS             complement(40940..43054)
                     /locus_tag="pYV0060"
                     /note="similar to Y. pestis YPCD1.34c"
                     /codon_start=1
                     /transl_table=11
                     /product="lcrD, yscV; membrane-bound Yop protein"
                     /protein_id="YP_068469.1"
                     /db_xref="GI:51593902"
                     /db_xref="GOA:P69956"
                     /db_xref="InterPro:IPR001712"
                     /db_xref="InterPro:IPR006302"
                     /db_xref="UniProtKB/Swiss-Prot:P69956"
                     /db_xref="GeneID:2952953"
                     /translation="MNPHDLEWLNRIGERKDIMLAVLLLAVVFMMVLPLPPLVLDILI
                     AVNMTISVVLLMIAIYINSPLQFSAFPAVLLVTTLFRLALSVSTTRMILLQADAGQIV
                     YTFGNFVVGGNLIVGIVIFLIITIVQFLVITKGSERVAEVSARFSLDAMPGKQMSIDG
                     DMRAGVIDVNEARERRATIEKESQMFGSMDGAMKFVKGDAIAGLIIIFVNILGGVTIG
                     VTQKGLAAAEALQLYSILTVGDGMVSQVPALLIAITAGIIVTRVSSEDSSDLGSDIGK
                     QVVAQPKAMLIGGVLLLLFGLIPGFPTVTFLILALLVGCGGYMLSRKQSRNDEANQDL
                     QSILTSGSGAPAARTKAKTSGANKGRLGEQEAFAMTVPLLIDVDSSQQEALEAIALND
                     ELVRVRRALYLDLGVPFPGIHLRFNEGMGEGEYIISLQEVPVARGELKAGYLLVRESV
                     SQLELLGIPYEKGEHLLPDQEAFWVSVEYEERLEKSQLEFFSHSQVLTWHLSHVLREY
                     AEDFIGIQETRYLLEQMEGGYGELIKEVQRIVPLQRMTEILQRLVGEDISIRNMRSIL
                     EAMVEWGQKEKDVVQLTEYIRSSLKRYICYKYANGNNILPAYLFDQEVEEKIRSGVRQ
                     TSAGSYLALEPAVTESLLEQVRKTIGDLSQIQSKPVLIVSMDIRRYVRKLIESEYYGL
                     PVLSYQELTQQINIQPLGRICL"
     misc_feature    complement(40943..43030)
                     /locus_tag="pYV0060"
                     /note="Type III secretory pathway, component EscV
                     [Intracellular trafficking and secretion]; Region: EscV;
                     COG4789"
                     /db_xref="CDD:227127"
     gene            complement(43041..43385)
                     /locus_tag="pYV0061"
                     /db_xref="GeneID:2952954"
     CDS             complement(43041..43385)
                     /locus_tag="pYV0061"
                     /note="similar to Y. pestis YPCD1.35c"
                     /codon_start=1
                     /transl_table=11
                     /product="yscY; type III secretion protein"
                     /protein_id="YP_068470.1"
                     /db_xref="GI:51593903"
                     /db_xref="GOA:Q663K5"
                     /db_xref="InterPro:IPR011990"
                     /db_xref="UniProtKB/TrEMBL:Q663K5"
                     /db_xref="GeneID:2952954"
                     /translation="MNITLTKRQQEFLLLNGWLQLQCGHAERACILLDALLTLNPEHL
                     AGRRCRLVALLNNNQGERAEKEAQWLISHDPLQAGNWLCLSRAQQLNGDLDKARHAYQ
                     HYLELKDHNESP"
     misc_feature    complement(<43065..>43331)
                     /locus_tag="pYV0061"
                     /note="putative PEP-CTERM system TPR-repeat lipoprotein;
                     Region: PEP_TPR_lipo; TIGR02917"
                     /db_xref="CDD:234059"
     gene            complement(43382..43750)
                     /locus_tag="pYV0062"
                     /db_xref="GeneID:2952955"
     CDS             complement(43382..43750)
                     /locus_tag="pYV0062"
                     /note="similar to Y. pestis YPCD1.36c"
                     /codon_start=1
                     /transl_table=11
                     /product="yscX; type III secretion protein"
                     /protein_id="YP_068471.1"
                     /db_xref="GI:51593904"
                     /db_xref="InterPro:IPR012672"
                     /db_xref="UniProtKB/TrEMBL:Q663K4"
                     /db_xref="GeneID:2952955"
                     /translation="MSRIITAPHIGIEKLSAISLEELSCGLPERYALPPDGHPVEPHL
                     ERLYPTAQSKRSLWDFASPGYTFHGLHRAQDYRRELDTLQSLLTTSQSSELQAAAALL
                     KCQQDDDRLLQIILNLLHKV"
     misc_feature    complement(43385..43750)
                     /locus_tag="pYV0062"
                     /note="type III secretion protein, YscX family; Region:
                     type_III_YscX; TIGR02502"
                     /db_xref="CDD:131554"
     gene            complement(43747..44118)
                     /locus_tag="pYV0063"
                     /db_xref="GeneID:2952956"
     CDS             complement(43747..44118)
                     /locus_tag="pYV0063"
                     /note="similar to Y. pestis YPCD1.37c"
                     /codon_start=1
                     /transl_table=11
                     /product="sycN; type III secretion protein"
                     /protein_id="YP_068472.1"
                     /db_xref="GI:51593905"
                     /db_xref="GOA:P61381"
                     /db_xref="InterPro:IPR012673"
                     /db_xref="UniProtKB/Swiss-Prot:P61381"
                     /db_xref="GeneID:2952956"
                     /translation="MSWIEPIISHFCQDLGVPTSSPLSPLIQLEMAQSGTLQLEQHGA
                     TLTLWLARSLAWHRCEDAMVKALTLTAAQKSGALPLRAGWLGESQLVLFVSLDERSLT
                     LPLLHQAFEQLLRLQQEVLAP"
     misc_feature    complement(43753..44109)
                     /locus_tag="pYV0063"
                     /note="type III secretion chaperone SycN; Region:
                     type_III_SycN; TIGR02503"
                     /db_xref="CDD:131555"
     gene            complement(44105..44383)
                     /locus_tag="pYV0064"
                     /db_xref="GeneID:2952957"
     CDS             complement(44105..44383)
                     /locus_tag="pYV0064"
                     /note="similar to Y. pestis YPCD1.38c"
                     /codon_start=1
                     /transl_table=11
                     /product="tyeA; Yop secretion and targeting protein"
                     /protein_id="YP_068473.1"
                     /db_xref="GI:51593906"
                     /db_xref="InterPro:IPR013351"
                     /db_xref="UniProtKB/Swiss-Prot:P69969"
                     /db_xref="GeneID:2952957"
                     /translation="MAYDLSEFMGDIVALVDKRWAGIHDIEHLANAFSLPTPEIKVRF
                     YQDLKRMFRLFPLGVFSDEEQRQNLLQMCQNAIDMAIESEEEELSELD"
     misc_feature    complement(44141..44383)
                     /locus_tag="pYV0064"
                     /note="TyeA; Region: TyeA; pfam09059"
                     /db_xref="CDD:117624"
     gene            complement(44364..45245)
                     /locus_tag="pYV0065"
                     /db_xref="GeneID:2952958"
     CDS             complement(44364..45245)
                     /locus_tag="pYV0065"
                     /note="similar to Y. pestis YPCD1.39c"
                     /codon_start=1
                     /transl_table=11
                     /product="yopN, lcrE; membrane-bound Yop targeting
                     protein"
                     /protein_id="YP_068474.1"
                     /db_xref="GI:51593907"
                     /db_xref="GOA:Q663K1"
                     /db_xref="UniProtKB/Swiss-Prot:Q663K1"
                     /db_xref="GeneID:2952958"
                     /translation="MTTLHNLSYGNTPLHNERPEIASSQIVNQTLGQFRGESVQIVSG
                     TLQSIADMAEEVTFVFSERKELSLDKRKLSDSQARVSDVEEQVNQYLSKVPELEQKQN
                     VSELLSLLSNSPNISLSQLKAYLEGKSEEPSEQFKMLCGLRDALKGRPELAHLSHLVE
                     QALVSMAEEQGETIVLGARITPEAYRESQSGVNPLQPLRDTYRDAVMGYQGIYAIWSD
                     LQKRFPNGDIDSVILFLQKALSADLQSQQSGSGREKLGIVINDLQKLKEFGSVSDQVK
                     GFWQFFSEGKTNGVRPF"
     misc_feature    complement(44406..45143)
                     /locus_tag="pYV0065"
                     /note="HrpJ-like domain; Region: HrpJ; cl15454"
                     /db_xref="CDD:265703"
     gene            45305..45409
                     /locus_tag="pYV0066"
                     /db_xref="GeneID:2952959"
     CDS             45305..45409
                     /locus_tag="pYV0066"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068475.1"
                     /db_xref="GI:51593908"
                     /db_xref="UniProtKB/TrEMBL:Q663K0"
                     /db_xref="GeneID:2952959"
                     /translation="MLIDAKISREILVLLGYFSKNSRLPLQFFSVFSH"
     gene            45443..46762
                     /locus_tag="pYV0067"
                     /db_xref="GeneID:2952960"
     CDS             45443..46762
                     /locus_tag="pYV0067"
                     /note="identical to Y. pestis YPCD1.40"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system ATPase"
                     /protein_id="YP_068476.1"
                     /db_xref="GI:51593909"
                     /db_xref="GOA:P40291"
                     /db_xref="HSSP:P03002"
                     /db_xref="InterPro:IPR000194"
                     /db_xref="InterPro:IPR003593"
                     /db_xref="InterPro:IPR004100"
                     /db_xref="InterPro:IPR005714"
                     /db_xref="InterPro:IPR013380"
                     /db_xref="UniProtKB/Swiss-Prot:P40291"
                     /db_xref="GeneID:2952960"
                     /translation="MLSLDQIPHHIRHGIVGSRLIQIRGRVTQVTGTLLKAVVPGVRI
                     GELCYLRNPDNSLSLQAEVIGFAQHQALLIPLGEMYGISSNTEVSPTGTMHQVGVGEH
                     LLGQVLDGLGQPFDGGHLPEPAAWYPVYQDAPAPMSRKLITTPLSLGIRVIDGLLTCG
                     EGQRMGIFAAAGGGKSTLLASLIRSAEVDVTVLALIGERGREVREFIESDLGEEGLRK
                     AVLVVATSDRPSMERAKAGFVATSIAEYFRDQGKRVLLLMDSVTRFARAQREIGLAAG
                     EPPTRRGYPPSVFAALPRLMERAGQSSKGSITALYTVLVEGDDMTEPVADETRSILDG
                     HIILSRKLAAANHYPAIDVLRSASRVMNQIVSKEHKTWAGDLRRLLAKYEEVELLLQI
                     GEYQKGQDKEADQAIERMGAIRGWLCQGTHELSHFNETLNLLETLTQ"
     misc_feature    45443..46759
                     /locus_tag="pYV0067"
                     /note="type III secretion system ATPase; Provisional;
                     Region: PRK06936"
                     /db_xref="CDD:180762"
     misc_feature    45521..45718
                     /locus_tag="pYV0067"
                     /note="ATP synthase alpha/beta family, beta-barrel domain;
                     Region: ATP-synt_ab_N; pfam02874"
                     /db_xref="CDD:251583"
     misc_feature    45725..46699
                     /locus_tag="pYV0067"
                     /note="Flagellum-specific ATPase/type III secretory
                     pathway virulence-related protein. This group of ATPases
                     are responsible for the export of flagellum and
                     virulence-related proteins. The bacterial flagellar motor
                     is similar to the F0F1-ATPase, in that they...; Region:
                     ATPase_flagellum-secretory_path_III; cd01136"
                     /db_xref="CDD:238556"
     misc_feature    45950..45970
                     /locus_tag="pYV0067"
                     /note="Walker A motif/ATP binding site; other site"
                     /db_xref="CDD:238556"
     misc_feature    46205..46219
                     /locus_tag="pYV0067"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238556"
     gene            46759..47223
                     /locus_tag="pYV0068"
                     /db_xref="GeneID:2952961"
     CDS             46759..47223
                     /locus_tag="pYV0068"
                     /note="identical to Y. pestis YPCD1.41"
                     /codon_start=1
                     /transl_table=11
                     /product="yscO; type III secretion protein"
                     /protein_id="YP_068477.1"
                     /db_xref="GI:51593910"
                     /db_xref="GOA:P40294"
                     /db_xref="InterPro:IPR009929"
                     /db_xref="UniProtKB/Swiss-Prot:P40294"
                     /db_xref="GeneID:2952961"
                     /translation="MIRRLHRVKVLRVERAEKAIKTQQACLQAAHRRHQEAVQTSQDY
                     HLWRIDEEQRLFDQRKNTTLNCKDLEKWQRQIASLREKEANYELECAKLLERLANERE
                     RLTLCQKMLQQARHKENKFLELVRREDEDELNQQHYQEEQEQEEFLQHHRNA"
     misc_feature    46759..47214
                     /locus_tag="pYV0068"
                     /note="Type III secretion protein YscO; Region: YscO;
                     pfam07321"
                     /db_xref="CDD:148750"
     gene            47223..48590
                     /locus_tag="pYV0069"
                     /db_xref="GeneID:2952962"
     CDS             47223..48590
                     /locus_tag="pYV0069"
                     /note="similar to Y. pestis YPCD1.42"
                     /codon_start=1
                     /transl_table=11
                     /product="yscP; type III secretion protein"
                     /protein_id="YP_068478.2"
                     /db_xref="GI:113911686"
                     /db_xref="GOA:Q663J7"
                     /db_xref="UniProtKB/Swiss-Prot:Q663J7"
                     /db_xref="GeneID:2952962"
                     /translation="MNKITTRSPLEPEYQPLGKPHHALQACVDFEQALLHNNKGNCHP
                     KEESLKPVRPHDLGKKEGQKGDGLRAHAPLAATSQPGRKEVGLKPQHNHQNNHDFNLS
                     PLAEGATNRAHLYQQDSRFDDRVESIINALMPLAPFLEGVTCETGTSSESPCEPSGHD
                     ELFVQQSPIDSAQPVQLNTKPTVQPLNPAADGAEVIVWSVGRETPASIAKNQRDSRQK
                     RLAEEPLALHQKALPEICPPAVSATPDDHLVARWCATPVTEVAEKSARFPYKATVQSE
                     QLDMTELADRSQHLTDGVDSSKDTIEPPRPEELLLPREETLPEMYSLSFTAPVVTPGD
                     HLLATMRATRLASVSEQLIQLAQRLAVELELRGGSSQVTQLHLNLPELGAIMVRIAEI
                     PGKLHVELIASREALRILAQGSYDLLERLQRIEPTQLDFQASDDSEQESRQKRHVYEE
                     WEAEE"
     misc_feature    48213..48587
                     /locus_tag="pYV0069"
                     /note="type III secretion system needle length
                     determinant; Region: type_III_yscP; TIGR02514"
                     /db_xref="CDD:233904"
     gene            48587..49510
                     /locus_tag="pYV0070"
                     /db_xref="GeneID:2952963"
     CDS             48587..49510
                     /locus_tag="pYV0070"
                     /note="identical to Y. pestis YPCD1.43"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein"
                     /protein_id="YP_068479.1"
                     /db_xref="GI:51593912"
                     /db_xref="GOA:P40296"
                     /db_xref="InterPro:IPR001172"
                     /db_xref="InterPro:IPR001543"
                     /db_xref="InterPro:IPR003283"
                     /db_xref="UniProtKB/Swiss-Prot:P40296"
                     /db_xref="GeneID:2952963"
                     /translation="MSLLTLPQAKLSELSLRQRLSHYQQNYLWEEGKLELTVSEPPSS
                     LNCILQLQWKGTHFTLYCFGNDLANWLTADLLGAPFFTLPKELQLALLERQTVFLPKL
                     VCNDIATASLSVTQPLLSLRLSRDNAHISFWLTSAEALFALLPARPNSERIPLPILIS
                     LRWHKVYLTLDEVDSLRLGDVLLAPEGSGPNSPVLAYVGENPWGYFQLQSNKLEFIGM
                     SHESDELNPEPLTDLNQLPVQVSFEVGRQILDWHTLTSLEPGSLIDLTTPVDGEVRLL
                     ANGRLLGHGRLVEIQGRLGVRIERLTEVTIS"
     misc_feature    48587..49507
                     /locus_tag="pYV0070"
                     /note="type III secretion system protein; Validated;
                     Region: PRK06933"
                     /db_xref="CDD:235891"
     misc_feature    48995..49489
                     /locus_tag="pYV0070"
                     /note="Flagellar motor switch/type III secretory pathway
                     protein [Cell motility and secretion / Intracellular
                     trafficking and secretion]; Region: FliN; COG1886"
                     /db_xref="CDD:224798"
     gene            49507..50160
                     /locus_tag="pYV0071"
                     /db_xref="GeneID:2952964"
     CDS             49507..50160
                     /locus_tag="pYV0071"
                     /note="part of a set of proteins involved in the infection
                     of eukaryotic cells; in plant pathogens involved in the
                     hypersensitivity response"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein"
                     /protein_id="YP_068480.1"
                     /db_xref="GI:51593913"
                     /db_xref="GOA:P69981"
                     /db_xref="InterPro:IPR005773"
                     /db_xref="InterPro:IPR005838"
                     /db_xref="UniProtKB/Swiss-Prot:P69981"
                     /db_xref="GeneID:2952964"
                     /translation="MIQLPDEINLIIVLSLLTLLPLISVMATSFVKFAVVFSLLRNAL
                     GVQQIPPNMAMYGLAIILSLYVMAPVGFATQDYLQANEVSLTNIESVEKFFDEGLAPY
                     RMFLKQHIQAQEYSFFVDSTKQLWPKQYADRLESDSLFILLPAFTVSELTRAFEIGFL
                     IYLPFIVIDLVISNILLAMGMMMVSPMTISLPFKLLLFVLLDGWTRLTHGLVISYGG"
     misc_feature    49516..50157
                     /locus_tag="pYV0071"
                     /note="Type III secretory pathway, component EscR
                     [Intracellular trafficking and secretion]; Region: EscR;
                     COG4790"
                     /db_xref="CDD:227128"
     gene            50162..50428
                     /locus_tag="pYV0072"
                     /db_xref="GeneID:2952965"
     CDS             50162..50428
                     /locus_tag="pYV0072"
                     /note="identical to Y. pestis YPCD1.45"
                     /codon_start=1
                     /transl_table=11
                     /product="yscS; type III secretion protein"
                     /protein_id="YP_068481.1"
                     /db_xref="GI:51593914"
                     /db_xref="GOA:P69983"
                     /db_xref="InterPro:IPR002191"
                     /db_xref="InterPro:IPR006306"
                     /db_xref="UniProtKB/Swiss-Prot:P69983"
                     /db_xref="GeneID:2952965"
                     /translation="MSQGDIIHFTSQALWLVLVLSMPPVLVAAVVGTLVSLVQALTQI
                     QEQTLGFVIKLIAVVVTLFATASWLGNELHSFAEMTMMKIQGIR"
     misc_feature    50162..50425
                     /locus_tag="pYV0072"
                     /note="Type III secretory pathway, component EscS
                     [Intracellular trafficking and secretion]; Region: EscS;
                     COG4794"
                     /db_xref="CDD:227131"
     gene            50425..51210
                     /locus_tag="pYV0073"
                     /db_xref="GeneID:2952966"
     CDS             50425..51210
                     /locus_tag="pYV0073"
                     /note="identical to Y. pestis YPCD1.46"
                     /codon_start=1
                     /transl_table=11
                     /product="yscT; type III secretion protein"
                     /protein_id="YP_068482.1"
                     /db_xref="GI:51593915"
                     /db_xref="GOA:P69985"
                     /db_xref="InterPro:IPR002010"
                     /db_xref="InterPro:IPR006304"
                     /db_xref="UniProtKB/Swiss-Prot:P69985"
                     /db_xref="GeneID:2952966"
                     /translation="MIADLIQRPLLTYTLLLPRFMACFVILPVLSKQLLGGVLLRNGI
                     VCSLALYVYPAVANQPYIEVDAFTLMLLIGKEIILGLLIGFVATIPFWALESAGFIVD
                     NQRGAAMASLLNPGLDSQTSPTGLLLTQTLITIFFSGGAFLSLLSALFHSYVNWPVAS
                     FFPAVSEQWVDFFYNQFSQILLIAAVLAAPLLIAMFLAEFGLALISRFAPSLNVFVLA
                     MPIKSAIASLLLVIYCMQMMSHASKAMLLVMDPISLLIPVLEK"
     misc_feature    50425..51207
                     /locus_tag="pYV0073"
                     /note="Type III secretory pathway, component EscT
                     [Intracellular trafficking and secretion]; Region: EscT;
                     COG4791"
                     /db_xref="CDD:227129"
     gene            51210..52274
                     /locus_tag="pYV0074"
                     /db_xref="GeneID:2952967"
     CDS             51210..52274
                     /locus_tag="pYV0074"
                     /note="identical to Y. pestis YPCD1.47"
                     /codon_start=1
                     /transl_table=11
                     /product="yscU; type III secretion protein"
                     /protein_id="YP_068483.1"
                     /db_xref="GI:51593916"
                     /db_xref="GOA:P69987"
                     /db_xref="InterPro:IPR006135"
                     /db_xref="InterPro:IPR006307"
                     /db_xref="UniProtKB/Swiss-Prot:P69987"
                     /db_xref="GeneID:2952967"
                     /translation="MSGEKTEQPTPKKIRDARKKGQVAKSKEVVSTALIVALSAMLMG
                     LSDYYFEHFSKLMLIPAEQSYLPFSQALSYVVDNVLLEFFYLCFPLLTVAALMAIASH
                     VVQYGFLISGEAIKPDIKKINPIEGAKRIFSIKSLVEFLKSILKVVLLSILIWIIIKG
                     NLVTLLQLPTCGIECITPLLGQILRQLMVICTVGFVVISIADYAFEYYQYIKELKMSK
                     DEIKREYKEMEGSPEIKSKRRQFHQEIQSRNMRENVKRSSVVVANPTHIAIGILYKRG
                     ETPLPLVTFKYTDAQVQTVRKIAEEEGVPILQRIPLARALYWDALVDHYIPAEQIEAT
                     AEVLRWLERQNIEKQHSEML"
     misc_feature    51210..52256
                     /locus_tag="pYV0074"
                     /note="Type III secretory pathway, component EscU
                     [Intracellular trafficking and secretion]; Region: EscU;
                     COG4792"
                     /db_xref="CDD:227130"
     gene            52850..53245
                     /locus_tag="pYV0075"
                     /db_xref="GeneID:2952968"
     CDS             52850..53245
                     /locus_tag="pYV0075"
                     /note="similar to Y. pestis YPCD1.48"
                     /codon_start=1
                     /transl_table=11
                     /product="virG; Yop targeting lipoprotein"
                     /protein_id="YP_068484.1"
                     /db_xref="GI:51593917"
                     /db_xref="InterPro:IPR013400"
                     /db_xref="UniProtKB/TrEMBL:Q663J1"
                     /db_xref="GeneID:2952968"
                     /translation="MSRIIALIISFLLVGCATPPMPAQRIVGEVRMSRPLSRIAHIDV
                     SMFGLYEGKVREVQRTHFETGNLPLFFSIKLNPAQRGEGELYLRSTLSFPERGVQAVA
                     QQKLTGKNKVVLQMIPKTCYPNCQLPNTR"
     misc_feature    52865..53224
                     /locus_tag="pYV0075"
                     /note="type III secretion system chaperone YscW; Region:
                     YscW; TIGR02567"
                     /db_xref="CDD:131618"
     gene            53369..54184
                     /locus_tag="pYV0076"
                     /db_xref="GeneID:2952969"
     CDS             53369..54184
                     /locus_tag="pYV0076"
                     /note="identical to Y. pestis YPCD1.49"
                     /codon_start=1
                     /transl_table=11
                     /product="lcrF, virF; thermoregulatory protein"
                     /protein_id="YP_068485.1"
                     /db_xref="GI:51593918"
                     /db_xref="GOA:Q663J0"
                     /db_xref="InterPro:IPR000005"
                     /db_xref="InterPro:IPR003313"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="InterPro:IPR012287"
                     /db_xref="UniProtKB/TrEMBL:Q663J0"
                     /db_xref="GeneID:2952969"
                     /translation="MASLEIIKLEWVTPIFKVVEHSQDGLYILLQGQISWQSSGQTYD
                     LDEGNMLFLRRGSYAVRCGTKEPCQLLWIPLPGSFLSTFLHRFGSLLSEIGRDNSTPK
                     PLLIFNISPILSQSIQNLCAILERSDFPSVLTQLRIEELLLLLAFSSQGTLFLSALRH
                     LGNRPEERLQKFMEENYLQGWKLSKFAREFGMGLTTFKELFGTVYGISPRAWISERRI
                     LYAHQLLLNGKMSIVDIAMEAGFSSQSYFTQSYRRRFGCTPSQARLTKIATTG"
     misc_feature    53429..53761
                     /locus_tag="pYV0076"
                     /note="AraC-like ligand binding domain; Region:
                     AraC_binding; pfam02311"
                     /db_xref="CDD:145456"
     misc_feature    53804..54157
                     /locus_tag="pYV0076"
                     /note="AraC-type DNA-binding domain-containing proteins
                     [Transcription]; Region: AraC; COG2207"
                     /db_xref="CDD:225117"
     misc_feature    53885..54007
                     /locus_tag="pYV0076"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     misc_feature    54053..54160
                     /locus_tag="pYV0076"
                     /note="Bacterial regulatory helix-turn-helix proteins,
                     AraC family; Region: HTH_AraC; pfam00165"
                     /db_xref="CDD:249644"
     gene            54263..54361
                     /locus_tag="pYV0077"
                     /db_xref="GeneID:2952970"
     CDS             54263..54361
                     /locus_tag="pYV0077"
                     /note="similar to Y. pestis YPCD1.50"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068486.1"
                     /db_xref="GI:51593919"
                     /db_xref="UniProtKB/TrEMBL:Q663I9"
                     /db_xref="GeneID:2952970"
                     /translation="MSQISTKHRTVLFRRWMAIICCLIINMAYLVY"
     gene            54587..55000
                     /locus_tag="pYV0078"
                     /db_xref="GeneID:2952971"
     CDS             54587..55000
                     /locus_tag="pYV0078"
                     /note="identical to Y. pestis YPCD1.51"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068487.1"
                     /db_xref="GI:51593920"
                     /db_xref="GOA:Q663I8"
                     /db_xref="InterPro:IPR010261"
                     /db_xref="InterPro:IPR013353"
                     /db_xref="UniProtKB/TrEMBL:Q663I8"
                     /db_xref="GeneID:2952971"
                     /translation="MQNLLKNLAASLGRKPFVADKQGVYRLTIDKHLVMLAPHGSELV
                     LRTPIDAPMLREGNNVNVTLLRSLMQQALAWAKRYPQTLVLDDCGQLVLEARLRLQEL
                     DTHGLQEVINKQLALLEHLIPQLTPFSVASRVGWN"
     misc_feature    54590..54997
                     /locus_tag="pYV0078"
                     /note="type III secretion system chaperone, YscB family;
                     Region: type_III_yscB; TIGR02513"
                     /db_xref="CDD:131565"
     gene            55006..56829
                     /locus_tag="pYV0079"
                     /db_xref="GeneID:2952972"
     CDS             55006..56829
                     /locus_tag="pYV0079"
                     /note="similar to Y. pestis YPCD1.52"
                     /codon_start=1
                     /transl_table=11
                     /product="yscC; type III secretion protein"
                     /protein_id="YP_068488.1"
                     /db_xref="GI:51593921"
                     /db_xref="GOA:Q663I7"
                     /db_xref="InterPro:IPR003522"
                     /db_xref="InterPro:IPR004845"
                     /db_xref="InterPro:IPR004846"
                     /db_xref="InterPro:IPR005644"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/TrEMBL:Q663I7"
                     /db_xref="GeneID:2952972"
                     /translation="MAFPLHSFFKRVLTGTLLLLSNYSWAQELDWLPIPYVYVAKGES
                     LRDLLIDFSANYDATVVVSDKINDKVSGQFEHDNPQDFLQHIASLYNLVWYYDGNVLY
                     IFKNSEVASRLIRLQESEAAELKLALQRSGIWEPRFGWRPDASNRLVYVSGPPRYLEL
                     VEQTAAALEQQTQIRSEKTGALAIEIFPLKYASASDRTIHYRDDEVAAPGVATILQRV
                     LSDATIQQVTVDNQRIPQAATRASAQAKVEADPSLNAIIVRDSPERMPMYQRLIHALD
                     KPSARIEVALSIVDINADQLTELGVDWRVGIRTGNNHQVVIKTTGDQSNIASNGALGS
                     LIDARGLDYLLARVNLLENEGSAQVVSRPTLLTQENAQAVIDHHETYYVKVTGKEVAE
                     LKGITYGTMLRMTPRVLTQGDKSEISLNLHIEDGNQKPNSSGIDGIPTISRTVVDTVA
                     RVGHGQSLIIGGIYRDELSVALSKVPLLGDIPYLGALFRRKSELTRRTVRLFIIEPRI
                     IDEGIAHHLALGNGRDLRTGILAVDEISNQSTTLNKLLGVSQCQPLNKAQEVQKWLSQ
                     NNKSSYLTQCKMDKSLGWRVVEGACTPAESWCVSAPKRGVL"
     misc_feature    55108..56538
                     /locus_tag="pYV0079"
                     /note="type III secretion outer membrane pore, YscC/HrcC
                     family; Region: type_III_yscC; TIGR02516"
                     /db_xref="CDD:233906"
     misc_feature    55336..55518
                     /locus_tag="pYV0079"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    55555..55842
                     /locus_tag="pYV0079"
                     /note="Bacterial type II/III secretion system short
                     domain; Region: Secretin_N; pfam03958"
                     /db_xref="CDD:252276"
     misc_feature    56053..56535
                     /locus_tag="pYV0079"
                     /note="Bacterial type II and III secretion system protein;
                     Region: Secretin; pfam00263"
                     /db_xref="CDD:249725"
     gene            56826..58085
                     /locus_tag="pYV0080"
                     /db_xref="GeneID:2952973"
     CDS             56826..58085
                     /locus_tag="pYV0080"
                     /note="similar to Y. pestis YPCD1.53"
                     /codon_start=1
                     /transl_table=11
                     /product="yscD; type III secretion protein"
                     /protein_id="YP_068489.1"
                     /db_xref="GI:51593922"
                     /db_xref="InterPro:IPR008984"
                     /db_xref="InterPro:IPR012843"
                     /db_xref="UniProtKB/TrEMBL:Q663I6"
                     /db_xref="GeneID:2952973"
                     /translation="MSWVCRFYQGKHRGVEVELPHGRCVFGSDPLQSDIVLSDSEIAP
                     VHLVLMVDEEGIRLTDSAEPLLQEGLPVPLGTLLRAGSCLEVGFLLWTFVAVGQPLPE
                     TLQVPTQRKEPTDRLPRSRLGIGLGVLSLLLLLTFLGLLGHGLWREYNQDGQLVEQEV
                     RRLLATAAYKDVVLTSPKKEGEPWLLTGYIQDNHARLSLQNFLESHGIPFRLELRSME
                     ELRQGAEFILQRLGYHGIEVSLAPQAGWLQLNGEVSEEIQKQKIDSLLQAEVPGLLGV
                     ESKVRIAGNQRKRLDALLEQFGLDSDFTVNVKGELIELRGQVNDEKLNSFNQLQQTFR
                     QEFGNRPKLELVNVGGQPQHDELNFEVQAISLGKVPYVVLDNHQRYPEGAILNNGVRI
                     LAIRRDAVIVSKGKREFVIQLNGGKPR"
     misc_feature    56832..58064
                     /locus_tag="pYV0080"
                     /note="type III secretion apparatus protein, YscD/HrpQ
                     family; Region: type_III_yscD; TIGR02500"
                     /db_xref="CDD:233898"
     misc_feature    56883..>56990
                     /locus_tag="pYV0080"
                     /note="Forkhead associated domain (FHA); found in
                     eukaryotic and prokaryotic proteins. Putative nuclear
                     signalling domain. FHA domains may bind phosphothreonine,
                     phosphoserine and sometimes phosphotyrosine. In
                     eukaryotes, many FHA domain-containing proteins...;
                     Region: FHA; cd00060"
                     /db_xref="CDD:238017"
     misc_feature    order(56907..56909,56946..56948,56952..56957)
                     /locus_tag="pYV0080"
                     /note="phosphopeptide binding site; other site"
                     /db_xref="CDD:238017"
     gene            58082..58282
                     /locus_tag="pYV0081"
                     /db_xref="GeneID:2952974"
     CDS             58082..58282
                     /locus_tag="pYV0081"
                     /note="similar to Y. pestis YPCD1.54"
                     /codon_start=1
                     /transl_table=11
                     /product="yscE; type III secretion protein"
                     /protein_id="YP_068490.1"
                     /db_xref="GI:51593923"
                     /db_xref="InterPro:IPR012671"
                     /db_xref="UniProtKB/TrEMBL:Q663I5"
                     /db_xref="GeneID:2952974"
                     /translation="MTQLEEQLHNVETVRSITMQLEMALTKLKKDMMRGGDAKQYQVW
                     QRESKALESAIAIIHYVAGDLK"
     misc_feature    58082..58279
                     /locus_tag="pYV0081"
                     /note="Protein of unknown function (DUF1895); Region:
                     DUF1895; pfam08988"
                     /db_xref="CDD:149906"
     gene            58283..58546
                     /locus_tag="pYV0082"
                     /db_xref="GeneID:2952975"
     CDS             58283..58546
                     /locus_tag="pYV0082"
                     /note="identical to Y. pestis YPCD1.55"
                     /codon_start=1
                     /transl_table=11
                     /product="yscF; type III secretion protein"
                     /protein_id="YP_068491.1"
                     /db_xref="GI:51593924"
                     /db_xref="GOA:Q663I4"
                     /db_xref="InterPro:IPR011841"
                     /db_xref="UniProtKB/TrEMBL:Q663I4"
                     /db_xref="GeneID:2952975"
                     /translation="MSNFSGFTKGTDIADLDAVAQTLKKPADDANKAVNDSIAALKDK
                     PDNPALLADLQHSINKWSVIYNINSTIVRSMKDLMQGILQKFP"
     misc_feature    58322..58540
                     /locus_tag="pYV0082"
                     /note="type III secretion apparatus needle protein;
                     Region: III_needle; TIGR02105"
                     /db_xref="CDD:131160"
     gene            58548..58895
                     /locus_tag="pYV0083"
                     /db_xref="GeneID:2952976"
     CDS             58548..58895
                     /locus_tag="pYV0083"
                     /note="similar to Y. pestis YPCD1.56"
                     /codon_start=1
                     /transl_table=11
                     /product="yscG; type III secretion protein"
                     /protein_id="YP_068492.1"
                     /db_xref="GI:51593925"
                     /db_xref="InterPro:IPR013348"
                     /db_xref="UniProtKB/TrEMBL:Q663I3"
                     /db_xref="GeneID:2952976"
                     /translation="MKYKLNVLLAEIALIGTGNHCHEEANCIAEWLHLKGEEEAVQLI
                     RLSSLMNRGDYASALQQGNKLAYPDLEPWLALCEYRLGLGSALESRLNRLARSQDPRI
                     QTFVNGMREQLKT"
     misc_feature    58548..58892
                     /locus_tag="pYV0083"
                     /note="Bacterial type II secretion system chaperone
                     protein (type_III_yscG); Region: Type_III_YscG; pfam09477"
                     /db_xref="CDD:150222"
     gene            58892..59389
                     /locus_tag="pYV0084"
                     /db_xref="GeneID:2952977"
     CDS             58892..59389
                     /locus_tag="pYV0084"
                     /note="similar to Y. pestis YPCD1.57"
                     /codon_start=1
                     /transl_table=11
                     /product="yscH, yopR, lcrP; type III secretion protein"
                     /protein_id="YP_068493.1"
                     /db_xref="GI:51593926"
                     /db_xref="GOA:Q663I2"
                     /db_xref="UniProtKB/Swiss-Prot:Q663I2"
                     /db_xref="GeneID:2952977"
                     /translation="MTVTLNRGSITSLMSSSQAVSTLQPVASELKTQLENKLKSESAE
                     KTREVLWQQYYASNPPDHAVLEVLAMPVREALLARFGQHQGSVVPAIDLPELRSVLQQ
                     FDSFGKRWEAILLQVLEGIKPNESQVGLPYLSELINKELMILLPSNSIVDSLLHNSHQ
                     IDMDT"
     misc_feature    58991..59380
                     /locus_tag="pYV0084"
                     /note="type III secretion effector, YopR family; Region:
                     type_III_yopR; TIGR02509"
                     /db_xref="CDD:131561"
     gene            59390..59737
                     /locus_tag="pYV0085"
                     /db_xref="GeneID:2952978"
     CDS             59390..59737
                     /locus_tag="pYV0085"
                     /note="identical to Y. pestis YPCD1.58"
                     /codon_start=1
                     /transl_table=11
                     /product="yscI, lcrO; type III secretion protein"
                     /protein_id="YP_068494.1"
                     /db_xref="GI:51593927"
                     /db_xref="GOA:P69971"
                     /db_xref="InterPro:IPR012670"
                     /db_xref="UniProtKB/Swiss-Prot:P69971"
                     /db_xref="GeneID:2952978"
                     /translation="MPNIEIAQADEVIITTLEELGPAEPTTDQIMRFDAAMSEDTQGL
                     GHSLLKEVSDIQKSFKTVKSDLHTKLAVSVDNPNDLMLMQWSLIRITIQEELIAKTAG
                     RMSQNVETLSKGG"
     misc_feature    59477..59728
                     /locus_tag="pYV0085"
                     /note="Type III secretion needle MxiH like; Region: MxiH;
                     pfam09392"
                     /db_xref="CDD:255337"
     gene            59744..60478
                     /locus_tag="pYV0086"
                     /db_xref="GeneID:2952979"
     CDS             59744..60478
                     /locus_tag="pYV0086"
                     /note="similar to Y. pestis YPCD1.59"
                     /codon_start=1
                     /transl_table=11
                     /product="yscJ, ylpB; type III secretion lipoprotein"
                     /protein_id="YP_068495.1"
                     /db_xref="GI:51593928"
                     /db_xref="GOA:P69973"
                     /db_xref="InterPro:IPR001869"
                     /db_xref="InterPro:IPR003282"
                     /db_xref="InterPro:IPR006182"
                     /db_xref="UniProtKB/Swiss-Prot:P69973"
                     /db_xref="GeneID:2952979"
                     /translation="MKVKTSLSTLILILFLTGCKVDLYTGISQKEGNEMLALLRQEGL
                     SADKEPDKDGKIKLLVEESDVAQAIDILKRKGYPHESFSTLQDVFPKDGLISSPIEEL
                     ARLNYAKAQEISRTLSEIDGVLVARVHVVLPEEQNNKGKKGVAASASVFIKHAADIQF
                     DTYIPQIKQLVNNSIEGLAYDRISVILVPSVDVRQSSHLPRNTSILSIQVSEESKGHL
                     IGLLSLLILLLPVTNLAQYFWLQRKK"
     misc_feature    59744..60475
                     /locus_tag="pYV0086"
                     /note="Type III secretory pathway, lipoprotein EscJ
                     [Intracellular trafficking and secretion]; Region: EscJ;
                     COG4669"
                     /db_xref="CDD:227015"
     gene            60457..61107
                     /locus_tag="pYV0087"
                     /db_xref="GeneID:2952980"
     CDS             60457..61107
                     /locus_tag="pYV0087"
                     /note="identical to Y. pestis YPCD1.60"
                     /codon_start=1
                     /transl_table=11
                     /product="yscK; type III secretion protein"
                     /protein_id="YP_068496.1"
                     /db_xref="GI:51593929"
                     /db_xref="GOA:P69975"
                     /db_xref="UniProtKB/Swiss-Prot:P69975"
                     /db_xref="GeneID:2952980"
                     /translation="MVTTQEVMMENYITSFQLRFCPAAYLHLEQLPSLWRSILPYLPQ
                     WRDSAHLNAALLDEFSLDTDYEEPHGLGALPLQPQSQLELLLCRLGLVLHGEAIRRCV
                     LASPLQQLLTLVNQETLRQIIVQHELLIGPWPTHWQRPLPTEIESRTMIQSGLAFWLA
                     AMEPQPQAWCKRLSLRLPLATPSEPWLVAESQRPLAQTLCHKLVKQVTPTCSHLFK"
     misc_feature    60487..61104
                     /locus_tag="pYV0087"
                     /note="YOP proteins translocation protein K (YscK);
                     Region: YscK; pfam06578"
                     /db_xref="CDD:115248"
     gene            61086..61718
                     /locus_tag="pYV0088"
                     /db_xref="GeneID:2952981"
     CDS             61086..61718
                     /locus_tag="pYV0088"
                     /note="similar to Y. pestis YPCD1.61"
                     /codon_start=1
                     /transl_table=11
                     /product="type III secretion system protein"
                     /protein_id="YP_068497.1"
                     /db_xref="GI:51593930"
                     /db_xref="GOA:P69977"
                     /db_xref="UniProtKB/Swiss-Prot:P69977"
                     /db_xref="GeneID:2952981"
                     /translation="MQPFVQIIPSNLSLACGLRILRAEDYQSSLTTEELISAAKQDAE
                     KILADAQEVYEQQKQLGWQAGMDEARTLQATLIHETQLQCQQFYRHVEQQMSEVVLLA
                     VRKILNDYDQVAMTLQVVREALALVSNQKQVVVRVNPDQAGAIREQIAKVHKDFPEIS
                     YLEVTADARLDQGGCILETEVGIIDASIDGQIEALSRAISTTLGQMKVTE"
     misc_feature    61086..61697
                     /locus_tag="pYV0088"
                     /note="type III secretion system protein; Reviewed;
                     Region: PRK06937"
                     /db_xref="CDD:180763"
     misc_feature    61338..61670
                     /locus_tag="pYV0088"
                     /note="Flagellar assembly protein FliH; Region: FliH;
                     cl19405"
                     /db_xref="CDD:267758"
     gene            61943..62290
                     /locus_tag="pYV0089"
                     /db_xref="GeneID:2952982"
     CDS             61943..62290
                     /locus_tag="pYV0089"
                     /note="identical to Y. pestis YPCD1.62"
                     /codon_start=1
                     /transl_table=11
                     /product="yscM, lcrQ; type III secretion regulatory"
                     /protein_id="YP_068498.1"
                     /db_xref="GI:51593931"
                     /db_xref="GOA:P69979"
                     /db_xref="HSSP:P08538"
                     /db_xref="UniProtKB/Swiss-Prot:P69979"
                     /db_xref="GeneID:2952982"
                     /translation="MKINTLQSLINQQITQVGHGGQAGRLTETNPLTENSHQISTAEK
                     AFANEVLEHVKNTALSRHDIACLLPRVSNLELKQGKAGEVIVTGLRTEQLSLSDAKLL
                     LEAAMRQDTAADG"
     misc_feature    61943..62269
                     /locus_tag="pYV0089"
                     /note="YopH, N-terminal; Region: YopH_N; pfam09013"
                     /db_xref="CDD:255144"
     gene            62838..63104
                     /locus_tag="pYV0090"
                     /db_xref="GeneID:2952983"
     CDS             62838..63104
                     /locus_tag="pYV0090"
                     /note="identical to Y. pestis YPCD1.63"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068499.1"
                     /db_xref="GI:51593932"
                     /db_xref="GOA:P69962"
                     /db_xref="InterPro:IPR002514"
                     /db_xref="InterPro:IPR009057"
                     /db_xref="UniProtKB/Swiss-Prot:P69962"
                     /db_xref="GeneID:2952983"
                     /translation="MKKARFTETQILRVLKEVEGGRHVKDVCRENGGSEASYYNWKSK
                     YGGMESSDIKRMKEREEENRRLKQMYASLSLDHEILKDVVAKKL"
     misc_feature    62841..63050
                     /locus_tag="pYV0090"
                     /note="Transposase; Region: HTH_Tnp_1; pfam01527"
                     /db_xref="CDD:250686"
     gene            63140..63562
                     /locus_tag="pYV0091"
                     /db_xref="GeneID:2952984"
     CDS             63140..63562
                     /locus_tag="pYV0091"
                     /note="similar to Y. pestis YPCD1.64"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068500.1"
                     /db_xref="GI:51593933"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/Swiss-Prot:Q00932"
                     /db_xref="GeneID:2952984"
                     /translation="MTEYQASERRGCRIMGISRSLLHYCPNTARDIPVVEVLQKLAHQ
                     YPAYGFGLMFNKLRQSGLPWNVKRVYRVYRLLKLNFRRKGKKRLPNRHPQPLAIPLKM
                     NHCWSVDFMSDALPDGRRFRLFNVVEILTGKHWQLKLT"
     gene            63559..63960
                     /locus_tag="pYV0092"
                     /db_xref="GeneID:2952985"
     CDS             63559..63960
                     /locus_tag="pYV0092"
                     /note="similar to Y. pestis YPCD1.65"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068501.1"
                     /db_xref="GI:51593934"
                     /db_xref="GOA:Q663H4"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663H4"
                     /db_xref="GeneID:2952985"
                     /translation="MNIPVHRVVRILERLSTERGYPAFIRSDNGPEFIAAALVEWAEH
                     HGVILDMYLFRSLSEVRTLTEDWRTNARIAHWVICHPLSMQDKNWMEILTGGGTKNRR
                     DYIHTGKISIPSSAIRPISARPSTPRMPLSH"
     misc_feature    <63571..>63711
                     /locus_tag="pYV0092"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     gene            63966..64145
                     /locus_tag="pYV0093"
                     /db_xref="GeneID:2952986"
     CDS             63966..64145
                     /locus_tag="pYV0093"
                     /note="similar to Y. pestis YPCD1.66"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068502.1"
                     /db_xref="GI:51593935"
                     /db_xref="UniProtKB/TrEMBL:Q663H3"
                     /db_xref="GeneID:2952986"
                     /translation="MIRQAIKKRKVFPTDDSVREVIYLAIRDASKKWSMPIQNWRLAM
                     SRFIIEFGDRLNDHL"
     misc_feature    <63969..64121
                     /locus_tag="pYV0093"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: COG3328"
                     /db_xref="CDD:225865"
     gene            complement(64366..65772)
                     /locus_tag="pYV0094"
                     /db_xref="GeneID:2952987"
     CDS             complement(64366..65772)
                     /locus_tag="pYV0094"
                     /note="similar to Y. pestis YPCD1.67c"
                     /codon_start=1
                     /transl_table=11
                     /product="yopH; protein-tyrosine phosphatase Yop effector"
                     /protein_id="YP_068503.1"
                     /db_xref="GI:51593936"
                     /db_xref="GOA:P08538"
                     /db_xref="InterPro:IPR000242"
                     /db_xref="InterPro:IPR000387"
                     /db_xref="InterPro:IPR003546"
                     /db_xref="InterPro:IPR003595"
                     /db_xref="PDB:1K46"
                     /db_xref="PDB:1M0V"
                     /db_xref="UniProtKB/Swiss-Prot:P08538"
                     /db_xref="GeneID:2952987"
                     /translation="MNLSLSDLHRQVSRLVQQESGDCTGKLRGNVAANKETTFQGLTI
                     ASGARESEKVFAQTVLSHVANVVLTQEDTAKLLQSTVKHNLNNYDLRSVGNGNSVLVS
                     LRSDQMTLQDAKVLLEAALRQESGARGHVSSHSHSALHAPGTPVREGLRSHLDPRTPP
                     LPPRERPHTSGHHGAGEARATAPSTVSPYGPEARAELSSRLTTLRNTLAPATNDPRYL
                     QACGGEKLNRFRDIQCCRQTAVRADLNANYIQVGNTRTIACQYPLQSQLESHFRMLAE
                     NRTPVLAVLASSSEIANQRFGMPDYFRQSGTYGSITVESKMTQQVGLGDGIMADMYTL
                     TIREAGQKTISVPVVHVGNWPDQTAVSSEVTKALASLVDQTAETKRNMYESKGSSAVG
                     DDSKLRPVIHCRAGVGRTAQLIGAMCMNDSRNSQLSVEDMVSQMRVQRNGIMVQKDEQ
                     LDVLIKLAEGQGRPLLNS"
     misc_feature    complement(65404..65766)
                     /locus_tag="pYV0094"
                     /note="YopH, N-terminal; Region: YopH_N; pfam09013"
                     /db_xref="CDD:255144"
     misc_feature    complement(64396..65100)
                     /locus_tag="pYV0094"
                     /note="Protein tyrosine phosphatases (PTP) catalyze the
                     dephosphorylation of phosphotyrosine peptides; they
                     regulate phosphotyrosine levels in signal transduction
                     pathways. The depth of the active site cleft renders the
                     enzyme specific for phosphorylated Tyr; Region: PTPc;
                     cd00047"
                     /db_xref="CDD:238006"
     misc_feature    complement(64402..65100)
                     /locus_tag="pYV0094"
                     /note="Protein-tyrosine phosphatase; Region:
                     Y_phosphatase; pfam00102"
                     /db_xref="CDD:249588"
     misc_feature    complement(order(64543..64548,64555..64557,64564..64569,
                     64705..64707))
                     /locus_tag="pYV0094"
                     /note="active site"
                     /db_xref="CDD:238006"
     gene            66153..66689
                     /locus_tag="pYV0095"
                     /db_xref="GeneID:2952988"
     CDS             66153..66689
                     /locus_tag="pYV0095"
                     /note="similar to Y. pestis YPCD1.69"
                     /codon_start=1
                     /transl_table=11
                     /product="transposase"
                     /protein_id="YP_068504.1"
                     /db_xref="GI:51593937"
                     /db_xref="GOA:Q663H1"
                     /db_xref="InterPro:IPR001584"
                     /db_xref="InterPro:IPR012337"
                     /db_xref="UniProtKB/TrEMBL:Q663H1"
                     /db_xref="GeneID:2952988"
                     /translation="MTTRHRHARPEVTALDQCWSMDFVADNLFNGHRVRALTIVDNFS
                     RECLALEVGQGLRGDDVVAVMDRLKHSLGRIPQRLQTDNGSEFISKSMDRWAYENRVT
                     MDFSRPGKPTDNAFIESFNGSLRDECLNVHGFLSLEDAQEKIEQWRQEYNHFRPHSSL
                     NNLTPAEFARSHQKGPDL"
     misc_feature    <66162..66662
                     /locus_tag="pYV0095"
                     /note="Transposase and inactivated derivatives [DNA
                     replication, recombination, and repair]; Region: Tra5;
                     COG2801"
                     /db_xref="CDD:225361"
     misc_feature    66207..66536
                     /locus_tag="pYV0095"
                     /note="Integrase core domain; Region: rve; pfam00665"
                     /db_xref="CDD:250040"
     misc_feature    66447..66647
                     /locus_tag="pYV0095"
                     /note="Integrase core domain; Region: rve_3; pfam13683"
                     /db_xref="CDD:257986"
     gene            complement(66691..66819)
                     /locus_tag="pYV0096"
                     /db_xref="GeneID:2952989"
     CDS             complement(66691..66819)
                     /locus_tag="pYV0096"
                     /note="similar to Y. pestis YPCD1.70c"
                     /codon_start=1
                     /transl_table=11
                     /product="IS630 family transposase"
                     /protein_id="YP_068505.1"
                     /db_xref="GI:51593938"
                     /db_xref="UniProtKB/TrEMBL:Q663H0"
                     /db_xref="GeneID:2952989"
                     /translation="MPIIAPIPRNKRHQMEKIVHKTADKNHSRHLIADPSPISVPG"
     gene            complement(66902..66994)
                     /locus_tag="pYV0097"
                     /db_xref="GeneID:2952990"
     CDS             complement(66902..66994)
                     /locus_tag="pYV0097"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068506.1"
                     /db_xref="GI:51593939"
                     /db_xref="UniProtKB/TrEMBL:Q663G9"
                     /db_xref="GeneID:2952990"
                     /translation="MQNAQIRLLDIIAYERVVFSEIQLLNNCAK"
     gene            complement(67275..68141)
                     /locus_tag="pYV0098"
                     /db_xref="GeneID:2952991"
     CDS             complement(67275..68141)
                     /locus_tag="pYV0098"
                     /note="similar to Y. pestis YPCD1.71c"
                     /codon_start=1
                     /transl_table=11
                     /product="yopP, yopJ; targeted effector protein"
                     /protein_id="YP_068507.1"
                     /db_xref="GI:51593940"
                     /db_xref="GOA:P31498"
                     /db_xref="InterPro:IPR005083"
                     /db_xref="UniProtKB/Swiss-Prot:P31498"
                     /db_xref="GeneID:2952991"
                     /translation="MIGPISQINISGGLSEKETSSLISNEELKNIITQLETDISDGSW
                     FHKNYSRMDVEVMPALVIQANNKYPEMNLNLVTSPLDLSIEIKNVIENGVRSSRFIIN
                     MGEGGIHFSVIDYKHINGKTSLILFEPANFNSMGPAMLAIRTKTAIERYQLPDCHFSM
                     VEMDIQRSSSECGIFSFALAKKLYIERDSLLKIHEDNIKGILSDGENPLPHDKLDPYL
                     PVTFYKHTQGKKRLNEYLNTNPQGVGTVVNKKNETIVNRFDNNKSIVDGKELSVSVHK
                     KRIAEYKTLLKV"
     misc_feature    complement(67281..68141)
                     /locus_tag="pYV0098"
                     /note="effector protein YopJ; Provisional; Region:
                     PRK15371"
                     /db_xref="CDD:185269"
     gene            complement(68142..68276)
                     /locus_tag="pYV0099"
                     /db_xref="GeneID:2952992"
     CDS             complement(68142..68276)
                     /locus_tag="pYV0099"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068508.1"
                     /db_xref="GI:51593941"
                     /db_xref="UniProtKB/TrEMBL:Q663G7"
                     /db_xref="GeneID:2952992"
                     /translation="MGIFVRVLPVCSGFTHQRLNVLLQCTVYLEYKIHTAVNSLNKDK
                     "
CONTIG      join(BX936399.2:1..68525)
//
DBGET integrated database retrieval system