GenomeNet

Database: RefSeq
Entry: NC_006154
LinkDB: NC_006154
Original site: NC_006154 
LOCUS       NC_006154              27702 bp    DNA     circular CON 27-AUG-2013
DEFINITION  Yersinia pseudotuberculosis IP 32953 plasmid pYptb32953, complete
            sequence.
ACCESSION   NC_006154
VERSION     NC_006154.1  GI:51593942
DBLINK      Project: 58157
            BioProject: PRJNA58157
KEYWORDS    RefSeq.
SOURCE      Yersinia pseudotuberculosis IP 32953
  ORGANISM  Yersinia pseudotuberculosis IP 32953
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Yersinia.
REFERENCE   1  (bases 1 to 27702)
  AUTHORS   Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O.,
            Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L.,
            Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C.,
            Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D.,
            Elliott,J.M., Derbise,A., Hauser,L.J. and Garcia,E.
  TITLE     Insights into the evolution of Yersinia pestis through whole-genome
            comparison with Yersinia pseudotuberculosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004)
   PUBMED   15358858
REFERENCE   2  (bases 1 to 27702)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (30-AUG-2004) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 27702)
  AUTHORS   Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2004) Biology and Biotechnology Research Program,
            Lawrence Livermore National Laboratory, Livermore, CA 94550 USA,
            Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15,
            France, and the Genome Analysis Group, Oak Ridge National
            Laboratory, Oak Ridge, TN 37831 USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. The reference sequence was derived from BX936400.
            RefSeq Category:
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..27702
                     /organism="Yersinia pseudotuberculosis IP 32953"
                     /mol_type="genomic DNA"
                     /strain="IP 32953"
                     /db_xref="taxon:273123"
                     /plasmid="pYptb32953"
     gene            202..1188
                     /gene="rep"
                     /locus_tag="pYptb0001"
                     /db_xref="GeneID:2953023"
     CDS             202..1188
                     /gene="rep"
                     /locus_tag="pYptb0001"
                     /function="IPR000525 Initiator RepB protein"
                     /note="similar to Q7X3W4 RepA. Erwinia sp. Ejp 556. Score
                     = 326 bits (835), Expect = 3e-88 Identities = 160/324
                     (49%)"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid replication protein"
                     /protein_id="YP_068509.1"
                     /db_xref="GI:51593943"
                     /db_xref="GeneID:2953023"
                     /translation="MESRSKLIVSQGNNLLEGAYNISRDEIRFLFLALTKIDSKIPQP
                     DGLYTLYPAEFEKMFGVNKAHIHQSLKNAASSLGKKPIYTYEYNEKKKRIDRVERFWF
                     SSIRYDESGVGADVTVRFSQDVALYLYELKKEFTQLKIDVIAKLTDSPFALRLYSWLI
                     KYKNLSRCINSEKVITTDAIDIEWMKERAGLAGKYKEYKFFKRDILEPAINVINAKTD
                     ISVLWEPIKHGRNIVSIKFSYVEEKNSLGCKPLRPRLPRRPKAIKGSAMEGEWASKCI
                     SIMSEFKKSLIAYDPNEKIAVSDLKKWVHWCEIIGDKYQMKVINAEIKERTK"
     misc_feature    214..918
                     /gene="rep"
                     /locus_tag="pYptb0001"
                     /note="Initiator Replication protein; Region: Rep_3;
                     pfam01051"
                     /db_xref="CDD:250324"
     gene            1316..1624
                     /locus_tag="pYptb0002"
                     /db_xref="GeneID:2952993"
     CDS             1316..1624
                     /locus_tag="pYptb0002"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068510.1"
                     /db_xref="GI:51593944"
                     /db_xref="GeneID:2952993"
                     /translation="MADLNFTHLHGLTQMKMLFPELTEKQFRLTYYWVVGGDIIDIAK
                     LSESSLDAVKKTLQRTRQNLGCDRLETVRLIFLARIETAKFIQTSIIIDMLNKSNLFN
                     "
     gene            1910..2137
                     /locus_tag="pYptb0003"
                     /db_xref="GeneID:2952994"
     CDS             1910..2137
                     /locus_tag="pYptb0003"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068511.1"
                     /db_xref="GI:51593945"
                     /db_xref="GeneID:2952994"
                     /translation="MTKKKNSVIDDDSYTSSGGVWYATSSSVKMSGKANFILAKLKLL
                     HPSKSKSMIIKDIVEKSLIEIDKEINKQGIK"
     gene            2572..3189
                     /gene="triA"
                     /locus_tag="pYptb0004"
                     /db_xref="GeneID:2953025"
     CDS             2572..3189
                     /gene="triA"
                     /locus_tag="pYptb0004"
                     /note="similar to CAD58562 TriA protein. Yersinia
                     enterocolitica. Score = 254 bits (649), Expect = 5e-67
                     Identities = 128/221 (57%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriA protein"
                     /protein_id="YP_068512.1"
                     /db_xref="GI:51593946"
                     /db_xref="GeneID:2953025"
                     /translation="MLSTAAFLSLALQCASTVHPDTAQDIARIESGFNPYAIGVVGQK
                     KGLFPTNKEDALKHVKRLRVEGKNFSVGLMQINQANFKQYGVDAAALFTPCVNLSVFE
                     KIITDCYQRGKTLKRALSCYYSGNFVVGQKKESEFGSTSYTERAGYTPAPRYVVPSTK
                     TDKANTSPDKAESPAPSTTPKTRRIVYPSQLVRGEFVDLTALNGE"
     misc_feature    <2623..>2865
                     /gene="triA"
                     /locus_tag="pYptb0004"
                     /note="Soluble lytic murein transglycosylase and related
                     regulatory proteins (some contain LysM/invasin domains)
                     [Cell envelope biogenesis, outer membrane]; Region: MltE;
                     COG0741"
                     /db_xref="CDD:223812"
     misc_feature    2647..3015
                     /gene="triA"
                     /locus_tag="pYptb0004"
                     /note="Lytic Transglycosylase (LT)  and Goose Egg White
                     Lysozyme (GEWL) domain. Members include the soluble and
                     insoluble membrane-bound LTs in bacteria, the LTs in
                     bacteriophage lambda, as well as, the eukaryotic
                     'goose-type' lysozymes (GEWL).  LTs...; Region: LT_GEWL;
                     cd00254"
                     /db_xref="CDD:238157"
     misc_feature    order(2659..2661,2800..2802,2881..2883,2935..2937)
                     /gene="triA"
                     /locus_tag="pYptb0004"
                     /note="N-acetyl-D-glucosamine binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:238157"
     misc_feature    2659..2661
                     /gene="triA"
                     /locus_tag="pYptb0004"
                     /note="catalytic residue [active]"
                     /db_xref="CDD:238157"
     gene            3194..3487
                     /gene="triB"
                     /locus_tag="pYptb0005"
                     /db_xref="GeneID:2953026"
     CDS             3194..3487
                     /gene="triB"
                     /locus_tag="pYptb0005"
                     /note="similar to CAD58563 TriB protein. Yersinia
                     enterocolitica. Score = 97.4 bits (241), Expect = 3e-20
                     Identities = 49/94 (52%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriB protein"
                     /protein_id="YP_068513.1"
                     /db_xref="GI:51593947"
                     /db_xref="GeneID:2953026"
                     /translation="MSLFQKIKSLFLHPILMPVLALASRPALADGFSKANDLMDKISA
                     GLTVLSVGTITVAVMWVGYKVLWNGQSLKDCGNIIIGAGLIIGGSEFARLFTD"
     misc_feature    3200..>3418
                     /gene="triB"
                     /locus_tag="pYptb0005"
                     /note="TrbC/VIRB2 family; Region: TrbC; pfam04956"
                     /db_xref="CDD:252903"
     gene            3506..6253
                     /gene="triC"
                     /locus_tag="pYptb0006"
                     /db_xref="GeneID:2953027"
     CDS             3506..6253
                     /gene="triC"
                     /locus_tag="pYptb0006"
                     /function="IPR004346 IPR007792 Type IV secretory pathway"
                     /note="similar to CAD58564 TriC protein. Yersinia
                     enterocolitica. Score = 1244 bits (3218), Expect = 0.0
                     Identities = 594/915 (64%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriC protein"
                     /protein_id="YP_068514.1"
                     /db_xref="GI:51593948"
                     /db_xref="GeneID:2953027"
                     /translation="MTTIFKALTRPAMILGVPIIPLIIAMSGISLAAVYTTTKFFFLI
                     PVAWWYMRHLARKDAHIFSLMGLKIRTKGNGKTNQHFDSTAWLANDYGDVDITEFLNA
                     MRLNERVTLTDKIPYSSHVHEYIIKGKNSDLMASWEVGGSVFEFETDEQKNMKSAQLN
                     TLIKSFEGEPVTFYIHNSRENYHDSFQQNSGNAFADEVAKRYYEGMEGDAFYRNRLFL
                     TVCMMPPSTLGKAERKGMSAGQKQRSLDGAIKRMQEIRATLNTALTPLHATPLGTFEE
                     DGVVYSSQLSFYHFLLTGIWQKIRVTRTPFYEVLGTADLFFSGASGQRNTIRGTEFFR
                     TLEIKDYSPKSVTGLLDVLLHAPCNYVLTQSYTCMAKDEGQEAIKTVEKRLSSAEDDA
                     VSQQTDLLVARDLLQSGHIAFGLYHFSLLISAPTLEALVKDTNTLANGLTNAGIVSTL
                     ASLSLAAGYFAQMPGVYTLRPRLVPVSSQNFVEMASFHNFSEGKRDRVPWGEAVAVVK
                     TPSGGAHYLNIHNTLLGKDDFNEKNAGNASIVGTIGSGKTMLISWLANMMQKYRQQSS
                     FSPHAKKKRLCTVVLDKDRGTELNIRQLGGRYFRVKSGEPTGWNPFRLKPTKRNIDFI
                     KKLMKLLCTRNGNTLSTRQETRLSDAVDAVMLGLDHASRDHGITRVLENITEPATMEA
                     QENGLKIRLAQWAKGGEFGWVFDNEEDTFDISECDIFGIDGTEFLDDSDVCAPISFYL
                     LYRITSLLDGRRLVLFIDEVWKWLNDPAFKKLMFNLLKTIRKLNGLVIPATQSPSDLL
                     KSSISTAMVEQCGTQFFLPNPMAEYKDYVEGLKVPPAVFEVIKGLDPLSRQFVLIKSP
                     LRKGDTERFAVLVTLDLSGLGKYTKILSGSEDNLAIFDSIFTEGMAPEEWRDTFLAQA
                     I"
     misc_feature    3509..3727
                     /gene="triC"
                     /locus_tag="pYptb0006"
                     /note="Type IV secretory pathway, VirB3-like protein;
                     Region: VirB3; cl01501"
                     /db_xref="CDD:260966"
     misc_feature    3812..6244
                     /gene="triC"
                     /locus_tag="pYptb0006"
                     /note="type IV secretion/conjugal transfer ATPase, VirB4
                     family; Region: VirB4_CagE; TIGR00929"
                     /db_xref="CDD:233193"
     misc_feature    4316..4921
                     /gene="triC"
                     /locus_tag="pYptb0006"
                     /note="CagE, TrbE, VirB family, component of type IV
                     transporter system; Region: CagE_TrbE_VirB; pfam03135"
                     /db_xref="CDD:251751"
     misc_feature    <5369..5647
                     /gene="triC"
                     /locus_tag="pYptb0006"
                     /note="Rossmann-fold NAD(P)(+)-binding proteins; Region:
                     NADB_Rossmann; cl09931"
                     /db_xref="CDD:263925"
     gene            6318..7031
                     /gene="triD"
                     /locus_tag="pYptb0007"
                     /db_xref="GeneID:2953028"
     CDS             6318..7031
                     /gene="triD"
                     /locus_tag="pYptb0007"
                     /note="similar to CAD58565 TriD protein. Yersinia
                     enterocolitica. Score = 227 bits (578), Expect = 1e-58
                     Identities = 124/242 (51%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriD protein"
                     /protein_id="YP_068515.1"
                     /db_xref="GI:51593949"
                     /db_xref="GeneID:2953028"
                     /translation="MSLKTCVGLLLCLLGAAAPTFAAGIIVFDPTAKLENAEQWAKEL
                     RQWENTAKHYTSQIDAYKAQLATATGLRDIGSFVNQAKGLTADLKNLQKNGTSLNSLL
                     SSGGSMSGELEQLYSKYSMFDICNDNESAPFINTCKQTVVNKAIALEESEAVQQKITE
                     TLNDVSQLSLRLENATDSKESQDLANTLSLKTVQLNTLTTQWEMNAKQSEMRDKLLID
                     KQQKAFSKQQSEAPIPTFH"
     misc_feature    6387..6983
                     /gene="triD"
                     /locus_tag="pYptb0007"
                     /note="Type IV secretion system proteins; Region: T4SS;
                     pfam07996"
                     /db_xref="CDD:254572"
     gene            7097..7348
                     /locus_tag="pYptb0008"
                     /db_xref="GeneID:2952995"
     CDS             7097..7348
                     /locus_tag="pYptb0008"
                     /note="Antitoxin that counteracts the effect of the YoeB
                     toxin"
                     /codon_start=1
                     /transl_table=11
                     /product="antitoxin YefM"
                     /protein_id="YP_068516.1"
                     /db_xref="GI:51593950"
                     /db_xref="GeneID:2952995"
                     /translation="MRTVNYSEARQNLAATMVKTVEDRAPVLITRQNGSACVLMSLEE
                     YESLEETAYLMRSPANAMNLMSSIEELRGGKGTERKLAE"
     misc_feature    7097..7345
                     /locus_tag="pYptb0008"
                     /note="antitoxin YefM; Provisional; Region: PRK11409"
                     /db_xref="CDD:171099"
     gene            7345..7599
                     /locus_tag="pYptb0009"
                     /db_xref="GeneID:2952996"
     CDS             7345..7599
                     /locus_tag="pYptb0009"
                     /note="similar to P56605 Hypothetical protein yoeB.
                     Escherichia coli, and Shigella flexneri. Score = 154 bits
                     (389), Expect = 3e-37 Identities = 67/84 (79%"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068517.1"
                     /db_xref="GI:51593951"
                     /db_xref="GeneID:2952996"
                     /translation="MKIVFSSQSWEDYLYWQQTDKKILKRINELIKDIQRMPFEGKGK
                     PEPLKYNLSGFWSRRITEEHRLVYEVADDSVLIAACRYHY"
     misc_feature    7357..7596
                     /locus_tag="pYptb0009"
                     /note="Plasmid encoded toxin Txe; Region: Plasmid_Txe;
                     pfam06769"
                     /db_xref="CDD:115427"
     gene            7718..7963
                     /locus_tag="pYptb0010"
                     /db_xref="GeneID:2952997"
     CDS             7718..7963
                     /locus_tag="pYptb0010"
                     /note="similar to Q9RPN3 ORF4. Yersinia pestis. Score =
                     63.2 bits (152), Expect = 8e-10 Identities = 32/74 (43%"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068518.1"
                     /db_xref="GI:51593952"
                     /db_xref="GeneID:2952997"
                     /translation="MRNLIVLALVASASAALLAGCKEEAKTYAWYSEHPDETYKVYKK
                     CLETGEASLNCEGARRAAIGFGRGGDKDLEQKFNSLK"
     gene            7975..9015
                     /gene="triE"
                     /locus_tag="pYptb0011"
                     /db_xref="GeneID:2953029"
     CDS             7975..9015
                     /gene="triE"
                     /locus_tag="pYptb0011"
                     /function="IPR007688 TriE/TrbL/VirB6 plasmid conjugal
                     transfer protein"
                     /note="similar to CAD58566 TriE protein. Yersinia
                     enterocolitica. Score = 295 bits (756), Expect = 5e-79
                     Identities = 150/332 (45%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriE protein"
                     /protein_id="YP_068519.1"
                     /db_xref="GI:51593953"
                     /db_xref="GeneID:2953029"
                     /translation="MAGFFEKFNTTIMDKLTTMGDVYQAQYATGIMSLMVGAVTLYIL
                     YVGYSTLGGKLQTPVPDLVWNLARFAMLITFITNAGGYLTALTEGLNGLKAGFTGDTS
                     VWAALDTLWDSTQKLADKIYDKDKSTYVAVSGGLGAALVWGGAIFLMFTSAVVFLTAD
                     ITMLFMLMTAPIFLFCLMFGFLRPMFNSWLQLIFSSILTVLFASIVIRLAIDFQVEIA
                     GQVATQADDSNLMTMGAMGAVAGLLSGVLVTLAAGFASKLAGAGAEGAMQGLAMAGAM
                     KAAKPVGKAAAKGAGKVAGGIGNGLGGIGNKAASNLNSAPAVNPTAARAKAAVESMKA
                     FSASQSSKIVSK"
     misc_feature    8089..8748
                     /gene="triE"
                     /locus_tag="pYptb0011"
                     /note="TrbL/VirB6 plasmid conjugal transfer protein;
                     Region: TrbL; pfam04610"
                     /db_xref="CDD:252701"
     gene            9186..9869
                     /gene="triG"
                     /locus_tag="pYptb0012"
                     /db_xref="GeneID:2953030"
     CDS             9186..9869
                     /gene="triG"
                     /locus_tag="pYptb0012"
                     /note="similar to CAD58568 TriG protein. Yersinia
                     enterocolitica. Score = 286 bits (733), Expect = 1e-76
                     Identities = 138/227 (60%);
                     VirB8"
                     /codon_start=1
                     /transl_table=11
                     /product="TriG protein"
                     /protein_id="YP_068520.1"
                     /db_xref="GI:51593954"
                     /db_xref="GeneID:2953030"
                     /translation="MSKTKQLINASKTFEEKLLTRDARDKKVGFFIGGTGLLMGVFGI
                     VAVIMLLPLKETELELYTVDNTTGRVEKITHVKQQDISSHEALAKAFAANYVKLRESY
                     NYFSLQHDYDTVPLFGSDAVNADYLAFFNGKNSPDMVYQKAAYVVNIEIISNVISDAT
                     DPDKLAQIRFKKTLRRVADGNTKVEYWNSRVTFRYVPEKALTEAQREANPLGFTVTSY
                     QRDKEIRGE"
     misc_feature    9213..9854
                     /gene="triG"
                     /locus_tag="pYptb0012"
                     /note="VirB8 protein; Region: VirB8; pfam04335"
                     /db_xref="CDD:252532"
     gene            9869..10816
                     /gene="triH"
                     /locus_tag="pYptb0013"
                     /db_xref="GeneID:2953031"
     CDS             9869..10816
                     /gene="triH"
                     /locus_tag="pYptb0013"
                     /function="IPR004357 Type IV secretion system TriH/CagX
                     conjugation protein"
                     /note="similar to CAD58569 TriH protein. Yersinia
                     enterocolitica. Score = 357 bits (915), Expect = 2e-97
                     Identities = 175/292 (59%"
                     /codon_start=1
                     /transl_table=11
                     /product="TriH protein"
                     /protein_id="YP_068521.1"
                     /db_xref="GI:51593955"
                     /db_xref="GeneID:2953031"
                     /translation="MSTFNKWIHIFIGVVLCTFTFSCAIIIFSPHALAAATPQGSAFD
                     SRMQHVSYNAQNATVINARAGYVTTLVFSDDEAVISTEVGFVQGWSITKEANRVYIRP
                     APITQPSIDDEGKEIQEVFNPTADDWKTNLFVTTTRHFYSLELSVLDGEEMPKNLAFV
                     VTYRYPDEVKTKTEQAQTAREKEWQEQQSKARITQALKNGQAPRNWDYSMQVGKDSRM
                     ITPDFAYDDGRFTYLGFSPLKKFPTATLYINGVEQVPNTSVKPMGNYQVMVIQHINPT
                     MVLRYGDAVVGVINQGFGKVTVAAGNTVSPAVERVEVKS"
     misc_feature    <10256..>10561
                     /gene="triH"
                     /locus_tag="pYptb0013"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cl11423"
                     /db_xref="CDD:264360"
     misc_feature    10472..10744
                     /gene="triH"
                     /locus_tag="pYptb0013"
                     /note="VirB9/CagX/TrbG, a component of the type IV
                     secretion system; Region: VirB9_CagX_TrbG; cd06911"
                     /db_xref="CDD:132874"
     misc_feature    order(10484..10504,10526..10543,10700..10702,10715..10735)
                     /gene="triH"
                     /locus_tag="pYptb0013"
                     /note="VirB7 interaction site; other site"
                     /db_xref="CDD:132874"
     gene            10813..12045
                     /gene="triI"
                     /locus_tag="pYptb0014"
                     /db_xref="GeneID:2953032"
     CDS             10813..12045
                     /gene="triI"
                     /locus_tag="pYptb0014"
                     /function="IPR005498 Bacterial conjugation TrbI-like
                     protein"
                     /note="similar to CAD58570 TriI protein. Yersinia
                     enterocolitica. Score = 387 bits (993), Expect = e-106
                     Identities = 206/415 (49%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriI protein"
                     /protein_id="YP_068522.1"
                     /db_xref="GI:51593956"
                     /db_xref="GeneID:2953032"
                     /translation="MTDKTSVVLDPHGEEEFAAPGAADNSDHEPTVAELEAAARAKVS
                     AKNEADAPASNSKVGTPEVNKLKPHRQNRLVFVMVAVLVVLIVMAWGGDWIYRNFLKS
                     APASPEAASLSSSSAPAQRRSGMGAEIKPFFVDESEAIVLPEIPAEGEQPSRLTPPSF
                     NKTRALVSRGTVTAPASGTALSRVSERTLSTGSGTPATASTTPAAGNVGVTSIPFDPD
                     LYIPEGRYIPCSLGTRFVSDVAGRISCNISEDIYSASGHTKLIEKGTTAKGVYKTGTL
                     KAGQSRMFIVWTELRTPDAKKIPLVDTQVVGQLGEAGIDGWIDTHFWERFGNTLLLST
                     VSDVAAVAATGGTDRNRNTDYTENTRAASVEMAKIALENNIGIPPTIYKNQGDIIGMI
                     VGEDIDFSNIYTLRMKQW"
     misc_feature    <11215..12036
                     /gene="triI"
                     /locus_tag="pYptb0014"
                     /note="Type IV secretory pathway, VirB10 components
                     [Intracellular trafficking and secretion]; Region: VirB10;
                     COG2948"
                     /db_xref="CDD:225499"
     misc_feature    11467..12009
                     /gene="triI"
                     /locus_tag="pYptb0014"
                     /note="Bacterial conjugation TrbI-like protein; Region:
                     TrbI; pfam03743"
                     /db_xref="CDD:252141"
     gene            12262..13275
                     /gene="triJ"
                     /locus_tag="pYptb0015"
                     /db_xref="GeneID:2953033"
     CDS             12262..13275
                     /gene="triJ"
                     /locus_tag="pYptb0015"
                     /function="IPR001482 Bacterial type II secretion system
                     protein E"
                     /note="similar to CAD58571 TriJ protein. Yersinia
                     enterocolitica. Score = 507 bits (1305), Expect = e-142
                     Identities = 241/335 (71%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriJ protein"
                     /protein_id="YP_068523.1"
                     /db_xref="GI:51593957"
                     /db_xref="GeneID:2953033"
                     /translation="MIKNKSLDTFKNKLFGDFLALDGLTEIAVNRPNQLFTKVNGVWQ
                     KHTHAISLDQCMQFSTALANYNKDHVEDIKPILSATLESGERCQIVMPPACQGDTVSI
                     TIRKPSKLQIPHQSYIDSGFYSRVMGSETADNHDTELLRLYSENIPLFMEKCVEYGKV
                     ILFVGKTSSGKTTYMKTLIGYIPLGLRIVTIEDNPEIEFRQHENYVHLFYPSEGGEDA
                     IVSPASLIRANFRMNPDRILLTEVRGPEAWDALKIIGSGHDGLITSMHAGTPTEAIDG
                     LVTRCYQNPECRQLPYSVLLRKVLDSVDVIASIDVNGNVRRMGDVYFKPVHRQKFLEE
                     FTK"
     misc_feature    12313..13230
                     /gene="triJ"
                     /locus_tag="pYptb0015"
                     /note="RecA-like NTPases. This family includes the NTP
                     binding domain of F1 and V1 H+ATPases, DnaB and related
                     helicases as well as bacterial RecA and related eukaryotic
                     and archaeal recombinases. This group also includes
                     bacterial conjugation proteins and...; Region:
                     RecA-like_NTPases; cl17233"
                     /db_xref="CDD:266574"
     misc_feature    order(12754..12759,12769..12777)
                     /gene="triJ"
                     /locus_tag="pYptb0015"
                     /note="Walker A motif; other site"
                     /db_xref="CDD:238540"
     misc_feature    order(12757..12759,12769..12777,12829..12831,12835..12840,
                     12979..12984)
                     /gene="triJ"
                     /locus_tag="pYptb0015"
                     /note="ATP binding site [chemical binding]; other site"
                     /db_xref="CDD:238540"
     misc_feature    12967..12981
                     /gene="triJ"
                     /locus_tag="pYptb0015"
                     /note="Walker B motif; other site"
                     /db_xref="CDD:238540"
     gene            13272..13694
                     /locus_tag="pYptb0016"
                     /db_xref="GeneID:2952998"
     CDS             13272..13694
                     /locus_tag="pYptb0016"
                     /note="similar to CAD58572 Hypothetical protein ORF29.
                     Yersinia enterocolitica. Score = 136 bits (343), Expect =
                     4e-32 Identities = 66/134 (49%)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068524.1"
                     /db_xref="GI:51593958"
                     /db_xref="GeneID:2952998"
                     /translation="MKHLIRPCWVAVGLMLAGCSSPPEPMAVKWDATPTTVNSTLPQW
                     QENHVVVHSPDVVGSWSKRITDFQGDNGSYGPDFYYAVVHSTRIVVASNSSSAWFNTA
                     AWLQLHGATAPIEFNRKLDCLTCNTVDVYLSRSDFASK"
     misc_feature    13299..13616
                     /locus_tag="pYptb0016"
                     /note="Cag pathogenicity island protein Cag12; Region:
                     Cag12; pfam13117"
                     /db_xref="CDD:257508"
     gene            14071..14376
                     /locus_tag="pYptb0017"
                     /db_xref="GeneID:2952999"
     CDS             14071..14376
                     /locus_tag="pYptb0017"
                     /note="similar to Q9F518 YggA protein. Escherichia coli.
                     Score = 81.3 bits (199), Expect = 3e-15 Identities = 39/85
                     (45%)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068525.1"
                     /db_xref="GI:51593959"
                     /db_xref="GeneID:2952999"
                     /translation="MKKILSGAALLCLTFIIPAPVFAADVCEVVTCMYGKMTGGDGGE
                     DCRAAERDFFSLNAFKKKGRFDPTKTADMRRSLLTGCSGADPKDIADIISKFGQIRG"
     gene            14519..15769
                     /locus_tag="pYptb0018"
                     /db_xref="GeneID:2953000"
     CDS             14519..15769
                     /locus_tag="pYptb0018"
                     /note="similar to Q8ZGB6 Putative exported protein
                     (Putative outer membrane protein). Yersinia pestis. Score
                     = 250 bits (639), Expect = 2e-65 Identities = 158/406
                     (38%)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068526.1"
                     /db_xref="GI:51593960"
                     /db_xref="GeneID:2953000"
                     /translation="MSVNMAFVLKMSLFCIPLVGNAADINVGDNSSTGNGGNNIVVGN
                     GSNIDGGGGNSIFGSGGSISGGGGGGMVVGSGSIDSGGGGNLVLGSGSIIDGGGGLVI
                     GSGSVTNGGQSLGGGNASNGGVTIGGGTADGGVAIGASSVTTGNGVSFGGSAGSNEFS
                     VGYRAITKVSEGVNGTDAVNVNQLNSAKNSLTNLVNSTAETTLNSANTYTDSQVSNLN
                     TVINNTAEMTLNTANNYTDSQVSNLNTVINNTAETTLNTANNYTDSQVSNVTNDLITV
                     INDSSQTTLNNANNYTDSRVSNITNVAIEEANSYTDYKFEGFIDESRSYTDKRVNDLS
                     NKVDRNYKRANAGIAGAMAQAAIPQQFGYKYNFGMALGNYRDGTAIAAGGSFQVKKNV
                     VSKTAVSWDAEGGVGVSAGVSVGW"
     misc_feature    15542..15766
                     /locus_tag="pYptb0018"
                     /note="YadA-like C-terminal region; Region: YadA_anchor;
                     pfam03895"
                     /db_xref="CDD:252233"
     gene            15826..16092
                     /locus_tag="pYptb0019"
                     /db_xref="GeneID:2953001"
     CDS             15826..16092
                     /locus_tag="pYptb0019"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068527.1"
                     /db_xref="GI:51593961"
                     /db_xref="GeneID:2953001"
                     /translation="MYTVSIDDFEQILKDDELPINEMVLMSAILSEVKEFSKTFIPNC
                     NDLVDKASEHSITYNRLTEGDKLFLNGIMSMPLFICYGSNCLLN"
     gene            16111..16524
                     /locus_tag="pYptb0020"
                     /db_xref="GeneID:2953002"
     CDS             16111..16524
                     /locus_tag="pYptb0020"
                     /note="similar to CAD58574 DNA binding protein. Yersinia
                     enterocolitica. Score = 97.4 bits (241), Expect = 3e-20
                     Identities = 55/135 (40%);
                     IPR001801 Histone-like nucleoid-structuring protein H-NS"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="YP_068528.1"
                     /db_xref="GI:51593962"
                     /db_xref="GeneID:2953002"
                     /translation="MSDNYAEVKRILANIRTIRTFVREVDYLFLVEAHEKLGVALEER
                     KAEFECEQEELNKKEAKKKELLAFIASEGFTLEELNGNGITKRKKPPVHRKPKYTFEE
                     NGEMKVWSGVGRKPKPIEVALNEGKTLSDFLICSV"
     misc_feature    16126..16512
                     /locus_tag="pYptb0020"
                     /note="Domain in histone-like proteins of HNS family;
                     Region: HNS; cl19571"
                     /db_xref="CDD:267924"
     misc_feature    16144..16512
                     /locus_tag="pYptb0020"
                     /note="DNA binding protein, nucleoid-associated;
                     Provisional; Region: PRK10328"
                     /db_xref="CDD:182380"
     gene            16529..16801
                     /locus_tag="pYptb0021"
                     /db_xref="GeneID:2953003"
     CDS             16529..16801
                     /locus_tag="pYptb0021"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068529.1"
                     /db_xref="GI:51593963"
                     /db_xref="GeneID:2953003"
                     /translation="MGTRIENPNRRGACFIAENILKRLDKDAVRRCGSYDRLYAVFLK
                     ENIYEFADTLESKEREKFLFVAREIHCLDEVPSINEVMKKISLEQF"
     gene            16823..16996
                     /locus_tag="pYptb0022"
                     /db_xref="GeneID:2953004"
     CDS             16823..16996
                     /locus_tag="pYptb0022"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068530.1"
                     /db_xref="GI:51593964"
                     /db_xref="GeneID:2953004"
                     /translation="MTGLTVELLHRYYRGPLCTNAHEKKPVKRGGQQATPANGSAPDG
                     GASRQGFDCVVRV"
     misc_feature    16829..>16987
                     /locus_tag="pYptb0022"
                     /note="EthD domain; Region: EthD; cl17553"
                     /db_xref="CDD:266745"
     gene            17081..17212
                     /locus_tag="pYptb0023"
                     /db_xref="GeneID:2953005"
     CDS             17081..17212
                     /locus_tag="pYptb0023"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068531.1"
                     /db_xref="GI:51593965"
                     /db_xref="GeneID:2953005"
                     /translation="MASKLGNSIPKGLLIYVAREPPTILFIEPPLGGDIKISRQGGA"
     gene            17219..17344
                     /locus_tag="pYptb0024"
                     /db_xref="GeneID:2953006"
     CDS             17219..17344
                     /locus_tag="pYptb0024"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068532.1"
                     /db_xref="GI:51593966"
                     /db_xref="GeneID:2953006"
                     /translation="MPPQRAKSPPQWAVNLGGYIPGQFVQQREYFLRNEEKTNGA"
     gene            17341..17463
                     /locus_tag="pYptb0025"
                     /db_xref="GeneID:2953007"
     CDS             17341..17463
                     /locus_tag="pYptb0025"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068533.1"
                     /db_xref="GI:51593967"
                     /db_xref="GeneID:2953007"
                     /translation="MTTFVMSSDFRHFRRREKIEVKITSLGGWSSVARTNCPFF"
     gene            17550..17672
                     /locus_tag="pYptb0027"
                     /db_xref="GeneID:2953009"
     CDS             17550..17672
                     /locus_tag="pYptb0027"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068535.1"
                     /db_xref="GI:51593969"
                     /db_xref="GeneID:2953009"
                     /translation="MPLIGVTASYRNLSAKRSRYLESNPLESRPLASAPICDRG"
     gene            17716..18336
                     /locus_tag="pYptb0028"
                     /pseudo
                     /db_xref="GeneID:2953010"
     misc_feature    17716..18336
                     /locus_tag="pYptb0028"
                     /note="N-terminal fragment of TriK gene"
                     /pseudo
                     /db_xref="PSEUDO:CAF25470.1"
     gene            18485..20266
                     /gene="triK"
                     /locus_tag="pYptb0029"
                     /db_xref="GeneID:2953034"
     CDS             18485..20266
                     /gene="triK"
                     /locus_tag="pYptb0029"
                     /note="similar to CAD58575 TriK protein. Yersinia
                     enterocolitica. Score = 870 bits (2248), Expect = 0.0
                     Identities = 430/590 (72%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriK protein"
                     /protein_id="YP_068536.1"
                     /db_xref="GI:51593970"
                     /db_xref="GeneID:2953034"
                     /translation="MSNQIMQKLSVISDNAIAFFAYLQAHQLLLALLAGLTLPFIFFL
                     TKDEHEKAPTWQKCVIVFSFICLLFGTLSPLSFGVIYYIYERAGFNVSPVLWGVLIAF
                     TTVGIVFHYVARRMLAPELDKLKHKLIKKSSLERNVRTDVRNVKALLPKTEHYNPADY
                     IDLNKGIFVGLDEHHQPMYIPVSDWQKQHAAIIGTTGAGKGVATGLLLTQSIMAGEGV
                     FVLDPKDDEWAPHLFRKACEDAGKPFALINLNKPEYQLNLIANINADQLEELFIAGFS
                     LAEKGEAADFYRIDDRRAARAAAQIINDNPTATVRDLFNSEYVQSIGEDIKGFFGKIE
                     ELALLNSINAVDGFDLKKIFDEGGCCYVIGSLRNSKVIMTQRMILVRLLQLAETRDRI
                     NSTPRPIAIFLDEFKYHISRPALEGLGAARDKGVHVSMAFQAIDDLRDCPADLNGDAV
                     VGAVVENAKFKLVYKLQNPETAEWVAKMSGTILVDDESRKAKTSKVLTETIDDERTIR
                     QAERYFIDSNMLLNLPPFVSYIFTATDLPRASLISPIKVKKQALVIHSAPLEKQKEVH
                     KDLDFVETPPIPPTKKKVEAEEESPLF"
     misc_feature    <18992..19915
                     /gene="triK"
                     /locus_tag="pYptb0029"
                     /note="Domain of unknown function DUF87; Region: DUF87;
                     cl19135"
                     /db_xref="CDD:267488"
     misc_feature    19049..19927
                     /gene="triK"
                     /locus_tag="pYptb0029"
                     /note="AAA-like domain; Region: AAA_10; pfam12846"
                     /db_xref="CDD:257344"
     gene            20274..21014
                     /gene="triL"
                     /locus_tag="pYptb0030"
                     /db_xref="GeneID:2953035"
     CDS             20274..21014
                     /gene="triL"
                     /locus_tag="pYptb0030"
                     /note="similar to CAD58576 TriL protein. Yersinia
                     enterocolitica. Score = 327 bits (837), Expect = 1e-88
                     Identities = 158/234 (67%)"
                     /codon_start=1
                     /transl_table=11
                     /product="TriL protein"
                     /protein_id="YP_068537.1"
                     /db_xref="GI:51593971"
                     /db_xref="GeneID:2953035"
                     /translation="MTNLIIDPVLRKNRKKEKILTLLMFLKEETYSDRLTLMFLFNFK
                     EQRVLYRLLNKVTEMGLIQKYVFESRGGNISLWGITNDGLSVVFKPEDNVFPPRFEPT
                     KLKGWMLDHHLDNQTVRLALERQGATEWINGDRNNFLNKFSVKHRPDGLITLPNGQRV
                     AIETERSLKTKARYQQIMTSHLLARTDELWFTVFYVLPDVQKKISLMKIFESIKFVII
                     NSKPIEIEARHRNVFQFFTLDELKELSF"
     misc_feature    <20712..>20846
                     /gene="triL"
                     /locus_tag="pYptb0030"
                     /note="NAD-specific glutamate dehydrogenase [Amino acid
                     transport and metabolism]; Region: COG2902"
                     /db_xref="CDD:225455"
     gene            21070..23232
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /db_xref="GeneID:2953024"
     CDS             21070..23232
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /EC_number="5.99.1.2"
                     /function="IPR005738 Bacterial DNA topoisomerase III"
                     /note="similar to CAD58573 Topoisomerase. Yersinia
                     enterocolitica. Score = 848 bits (2191), Expect = 0.0
                     Identities = 443/740 (59%)"
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase III family protein"
                     /protein_id="YP_068538.1"
                     /db_xref="GI:51593972"
                     /db_xref="GeneID:2953024"
                     /translation="MRVFIAEKPALAKVIADALGAGVRKDGYIQCGSDVVTWCVGHIL
                     ELSPPEAHNPAYAKWNAADLPLKLRPAKYQPKTTTAAQFKVVQQLVGQATEIVHAGDP
                     DDEGQLLVDEVLTYCDNTSPVKRVLINDLNTAAAKKALANLRDNREFLGLSQKALARS
                     IGDQLYGFNMTRAYTLAAQQKGVQGVLSVGRVQTPILGLIVNRFNTFQNHSAAFFYNL
                     SANIDVIGHRIVPRYQVPEGAPVDDKGRLIDETVANDVATACKGQPATVTASQTEEKS
                     TPAPLPFSLLDLQAHMSKKHGLSAQQTQDVTQSLRENHKAITYNRSDCNYLTSEQFGD
                     ACATLAAIASALPVLAVSLSEANPAQKGRAFDDKKVSAHTAIIPTTTAPNPASMTVNE
                     RQVYHAIAAQYLAQFLPEKRYLAASATFAVNGHIFIAKATQTTQDGWTTLLSGTEDNE
                     GESNDEFETSPFAALSALSNSDEGVCESVTVSKEKTKPLPLYTEATLLKDLQRVAKYV
                     KDPKIRQLLKDRDAGKTGEHGGIGTPATRASMLETLQKRGFYTVEKKKLIPTELGLSF
                     IASLPEIATAPDMTALWHEQQQMIEQGSFTVDEFLDALEDFIAGQMNNVDLSGMADGV
                     PQTQSSQRPRLTAVCPKCNGAVVISAKVYACSGCELKVWGEVASKKLTLPQVETLFSK
                     GKTAVLKGFKSKAGKPFDAKLVLDTATGKVSFEFENKK"
     misc_feature    21070..23079
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="DNA topoisomerase III; Provisional; Region:
                     PRK07726"
                     /db_xref="CDD:236078"
     misc_feature    21070..21462
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="TOPRIM_TopoIA_TopoIII: The topoisomerase-primase
                     (TORPIM) domain found in members of the type IA family of
                     DNA topoisomerases (Topo IA) similar to topoisomerase III.
                     Type IA DNA topoisomerases remove (relax) negative
                     supercoils in the DNA by: cleaving...; Region:
                     TOPRIM_TopoIA_TopoIII; cd03362"
                     /db_xref="CDD:173782"
     misc_feature    order(21088..21093,21100..21102,21370..21372,21376..21378,
                     21382..21384)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="active site"
                     /db_xref="CDD:173782"
     misc_feature    order(21109..21111,21373..21375,21379..21381,21400..21405,
                     21409..21414)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="putative interdomain interaction site [polypeptide
                     binding]; other site"
                     /db_xref="CDD:173782"
     misc_feature    order(21370..21372,21376..21378)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="putative metal-binding site [ion binding]; other
                     site"
                     /db_xref="CDD:173782"
     misc_feature    21379..21381
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="putative nucleotide binding site [chemical
                     binding]; other site"
                     /db_xref="CDD:173782"
     misc_feature    21520..22893
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="DNA Topoisomerase, subtype IA; DNA-binding,
                     ATP-binding and catalytic domain of bacterial DNA
                     topoisomerases I and III, and eukaryotic DNA topoisomerase
                     III and eubacterial and archael reverse gyrases.
                     Topoisomerases clevage single or double stranded DNA...;
                     Region: TOP1Ac; cd00186"
                     /db_xref="CDD:238110"
     misc_feature    order(21520..21600,21628..21690)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="domain I; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(21544..21549,21556..21558,21568..21570,21580..21582,
                     21991..21993,22003..22005,22030..22032,22672..22677,
                     22684..22689,22693..22695,22705..22710)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="DNA binding groove [nucleotide binding]"
                     /db_xref="CDD:238110"
     misc_feature    order(21661..21663,21673..21675,22780..22782)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="phosphate binding site [ion binding]; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(21703..21723,21856..21903,22294..22338,22342..22398,
                     22498..22530)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="domain II; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(21904..21924,21928..22014,22018..22098,22183..22209,
                     22231..22293)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="domain III; other site"
                     /db_xref="CDD:238110"
     misc_feature    order(21937..21939,21949..21957,22186..22188,22249..22251,
                     22258..22260,22270..22272,22666..22668,22672..22674,
                     22738..22740)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="nucleotide binding site [chemical binding]; other
                     site"
                     /db_xref="CDD:238110"
     misc_feature    order(22024..22026,22030..22032,22186..22188)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="catalytic site [active]"
                     /db_xref="CDD:238110"
     misc_feature    order(22531..22566,22615..22629,22657..22728,22738..22782,
                     22792..22893)
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="domain IV; other site"
                     /db_xref="CDD:238110"
     misc_feature    23038..23223
                     /gene="topB"
                     /locus_tag="pYptb0031"
                     /note="C-terminal repeat of topoisomerase; Region:
                     Toprim_Crpt; pfam13342"
                     /db_xref="CDD:257671"
     gene            23291..23443
                     /locus_tag="pYptb0032"
                     /db_xref="GeneID:2953011"
     CDS             23291..23443
                     /locus_tag="pYptb0032"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068539.1"
                     /db_xref="GI:51593973"
                     /db_xref="GeneID:2953011"
                     /translation="MHRHQGRSRSRGWLVGLPASLAFSHVHLCITYIGFASRNFLVIE
                     LKIKYC"
     gene            23475..23636
                     /locus_tag="pYptb0033"
                     /db_xref="GeneID:2953012"
     CDS             23475..23636
                     /locus_tag="pYptb0033"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068540.1"
                     /db_xref="GI:51593974"
                     /db_xref="GeneID:2953012"
                     /translation="MEMPANYSINFGQKKLVGNRFFSLPFPQIPPIPPLPFNKYFPHS
                     FPFKFASKK"
     gene            23751..23999
                     /locus_tag="pYptb0034"
                     /db_xref="GeneID:2953013"
     CDS             23751..23999
                     /locus_tag="pYptb0034"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068541.1"
                     /db_xref="GI:51593975"
                     /db_xref="GeneID:2953013"
                     /translation="MGIITVRSTDEIDAVIERVKLLMDTKTASSTLTKAVLDYEPNQL
                     ELKRLRSELAKAEYQVEKYRDGMQKFKAAADHIINLEL"
     gene            complement(24036..25016)
                     /gene="ArdC"
                     /locus_tag="pYptb0035"
                     /db_xref="GeneID:2953021"
     CDS             complement(24036..25016)
                     /gene="ArdC"
                     /locus_tag="pYptb0035"
                     /note="similar to CAD58578 Antirestriction protein.
                     Yersinia enterocolitica. Score = 457 bits (1176), Expect =
                     e-128 Identities = 227/323 (70%)"
                     /codon_start=1
                     /transl_table=11
                     /product="antirestriction protein"
                     /protein_id="YP_068542.1"
                     /db_xref="GI:51593976"
                     /db_xref="GeneID:2953021"
                     /translation="MTMTLNSQLTSPNTVPATSVSPLDESGSSNTKWSKGKKAPTQDL
                     YQTVTDSIIEALEAGVKPWVCPWQRVNGMSGIPANYTTGATYSGINIMLLWASASKQG
                     FTDGRWLTYKQAEAKGAQVRKGEKGTTAIFYKTLEKEDEQGETTKIPMLKTFTVFNVQ
                     QIDGLPLETAEQETSPIAEPTTFESLPRVEALIQQCGATIIERGQAAYFRPSTDEIVL
                     PERHLFDDAANFYATALHELTHWTGGKTRLNRDMRGVFGNASYAFEELIAELGSAFLM
                     ADFGVVGDVQHESYIASWLNALKNDKRFIFKAASSASKAHQFLIASNSAE"
     misc_feature    complement(24039..24902)
                     /gene="ArdC"
                     /locus_tag="pYptb0035"
                     /note="Antirestriction protein [DNA replication,
                     recombination, and repair]; Region: COG4227"
                     /db_xref="CDD:226680"
     misc_feature    complement(24546..24893)
                     /gene="ArdC"
                     /locus_tag="pYptb0035"
                     /note="Domain of unknown function (DUF1738); Region:
                     DUF1738; pfam08401"
                     /db_xref="CDD:254778"
     misc_feature    complement(24216..>24344)
                     /gene="ArdC"
                     /locus_tag="pYptb0035"
                     /note="Metallopeptidase toxin 3; Region: Tox-MPTase3;
                     pfam15639"
                     /db_xref="CDD:259769"
     gene            25339..25575
                     /locus_tag="pYptb0036"
                     /db_xref="GeneID:2953014"
     CDS             25339..25575
                     /locus_tag="pYptb0036"
                     /note="similar to CAE15300 Hypothetical gene. Photorhabdus
                     luminescens subsp. laumondii TTO1. Score = 68.9 bits
                     (167), Expect = 1e-11 Identities = 36/65 (55%)none"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068543.1"
                     /db_xref="GI:51593977"
                     /db_xref="GeneID:2953014"
                     /translation="MSAATIYTDSHNGKQYRVMNSNSARVQQYPAGVLIYFDGSSSAK
                     PQVTNFKTRANLNSWLRMMGFKNNTGVSINISSR"
     gene            25627..26253
                     /gene="parA"
                     /locus_tag="pYptb0037"
                     /db_xref="GeneID:2953022"
     CDS             25627..26253
                     /gene="parA"
                     /locus_tag="pYptb0037"
                     /note="similar to AB070224 parA partitioning protein
                     [Serratiamarcescens] Expect = 9e-90 Identities = 172/209
                     (82%);
                     IPR000707 ATPase, ParA type"
                     /codon_start=1
                     /transl_table=11
                     /product="plasmid partitioning protein"
                     /protein_id="YP_068544.1"
                     /db_xref="GI:51593978"
                     /db_xref="GeneID:2953022"
                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLGGADVLLVDSDPQGSA
                     RDWAAVREDQPVTVVGIDRPTIERDLKNIAQKDYVVIDGAPQAADLAVSAIKAADFIL
                     IPVQPSPYDIWATADLVDLVKQRIELTDGKLQAAFVVSRAIKGTRIGQDVTEALKGYG
                     LPVLESRITQRVVYPGTAAAGKTVFDDLDKTASLEIQALCDEITLKLI"
     misc_feature    25630..26232
                     /gene="parA"
                     /locus_tag="pYptb0037"
                     /note="ParA-like protein; Provisional; Region: PHA02518"
                     /db_xref="CDD:222854"
     misc_feature    25633..26046
                     /gene="parA"
                     /locus_tag="pYptb0037"
                     /note="ParA and ParB of Caulobacter crescentus belong to a
                     conserved family of bacterial proteins implicated in
                     chromosome segregation. ParB binds to DNA sequences
                     adjacent to the origin of replication and localizes to
                     opposite cell poles shortly following the...; Region:
                     ParA; cd02042"
                     /db_xref="CDD:238997"
     misc_feature    25654..25674
                     /gene="parA"
                     /locus_tag="pYptb0037"
                     /note="P-loop; other site"
                     /db_xref="CDD:238997"
     misc_feature    order(25672..25674,25870..25872)
                     /gene="parA"
                     /locus_tag="pYptb0037"
                     /note="Magnesium ion binding site [ion binding]; other
                     site"
                     /db_xref="CDD:238997"
     gene            26274..26489
                     /locus_tag="pYptb0038"
                     /db_xref="GeneID:2953015"
     CDS             26274..26489
                     /locus_tag="pYptb0038"
                     /note="similar to hypothetical proteins from several
                     shuttle vectors, e.g. AF118810 Shuttle vector
                     pME6010;Expect = 6e-19 Identities = 48/70 (68%)"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068545.1"
                     /db_xref="GI:51593979"
                     /db_xref="GeneID:2953015"
                     /translation="MSKNTNTLSAGRPSARTDRTTTLASLADTVSMKRVNFDISAENH
                     AKLKIYAAQQGKSIKEILSEFVEQLPI"
     misc_feature    <26370..26474
                     /locus_tag="pYptb0038"
                     /note="ParG; Region: ParG; pfam09274"
                     /db_xref="CDD:117819"
     gene            26513..26806
                     /locus_tag="pYptb0039"
                     /db_xref="GeneID:2953016"
     CDS             26513..26806
                     /locus_tag="pYptb0039"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068546.1"
                     /db_xref="GI:51593980"
                     /db_xref="GeneID:2953016"
                     /translation="MVNLSTEQLRFYNLVSTYPRISGLWNWEEKALHLDALNKELSVM
                     SGGEFVLTRFFSCLWYGHGQTKLPPFDIVSEISRLDDRERNLIAEWVANPFWP"
     gene            26953..27099
                     /locus_tag="pYptb0040"
                     /db_xref="GeneID:2953017"
     CDS             26953..27099
                     /locus_tag="pYptb0040"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068547.1"
                     /db_xref="GI:51593981"
                     /db_xref="GeneID:2953017"
                     /translation="MSNASLYCRGSRISVTLEFSTVTQQPEFPALRKLYMRIYEPLWG
                     RSAV"
     gene            27120..27221
                     /locus_tag="pYptb0041"
                     /db_xref="GeneID:2953018"
     CDS             27120..27221
                     /locus_tag="pYptb0041"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068548.1"
                     /db_xref="GI:51593982"
                     /db_xref="GeneID:2953018"
                     /translation="MISWISRLIGAEYLLFKAFVTPIPDHDQVFKLY"
     gene            27236..27382
                     /locus_tag="pYptb0042"
                     /db_xref="GeneID:2953019"
     CDS             27236..27382
                     /locus_tag="pYptb0042"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068549.1"
                     /db_xref="GI:51593983"
                     /db_xref="GeneID:2953019"
                     /translation="MKIKTRQRRVSCFCFFVSLFLCFLFKGILITIKSYIYNKIGDSF
                     SGYK"
     gene            27458..27580
                     /locus_tag="pYptb0043"
                     /db_xref="GeneID:2953020"
     CDS             27458..27580
                     /locus_tag="pYptb0043"
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="YP_068550.1"
                     /db_xref="GI:51593984"
                     /db_xref="GeneID:2953020"
                     /translation="MWITLLYLTFLQKILICKWIFCTNSMKILKNIEFSRKECG"
CONTIG      join(BX936400.1:1..27702)
//
DBGET integrated database retrieval system