GenomeNet

Database: RefSeq
Entry: NC_006154
LinkDB: NC_006154
Original site: NC_006154 
LOCUS       NC_006154              27702 bp    DNA     circular CON 30-JUL-2015
DEFINITION  Yersinia pseudotuberculosis IP32953 cryptic plasmid, complete
            sequence.
ACCESSION   NC_006154
VERSION     NC_006154.1  GI:51593942
DBLINK      BioProject: PRJNA224116
            BioSample: SAMEA3138251
            Assembly: GCF_000047365.1
KEYWORDS    RefSeq.
SOURCE      Yersinia pseudotuberculosis IP 32953
  ORGANISM  Yersinia pseudotuberculosis IP 32953
            Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacteriales;
            Enterobacteriaceae; Yersinia.
REFERENCE   1
  AUTHORS   Chain,P.S., Carniel,E., Larimer,F.W., Lamerdin,J., Stoutland,P.O.,
            Regala,W.M., Georgescu,A.M., Vergez,L.M., Land,M.L., Motin,V.L.,
            Brubaker,R.R., Fowler,J., Hinnebusch,J., Marceau,M., Medigue,C.,
            Simonet,M., Chenal-Francisque,V., Souza,B., Dacheux,D.,
            Elliott,J.M., Derbise,A., Hauser,L.J. and Garcia,E.
  TITLE     Insights into the evolution of Yersinia pestis through whole-genome
            comparison with Yersinia pseudotuberculosis
  JOURNAL   Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13826-13831 (2004)
   PUBMED   15358858
REFERENCE   2  (bases 1 to 27702)
  AUTHORS   Chain,P.S.G., Carniel,E., Garcia,E. and Larimer,F.W.
  TITLE     Direct Submission
  JOURNAL   Submitted (08-FEB-2004) Biology and Biotechnology Research Program,
            Lawrence Livermore National Laboratory, Livermore, CA 94550 USA,
            Yersinia Research Unit, Institute Pasteur, 75724 Paris Cedex 15,
            France, and the Genome Analysis Group, Oak Ridge National
            Laboratory, Oak Ridge, TN 37831 USA
COMMENT     REFSEQ INFORMATION: The reference sequence was derived from
            BX936400.
            Annotation was added by the NCBI Prokaryotic Genome Annotation
            Pipeline (released 2013). Information about the Pipeline can be
            found here: http://www.ncbi.nlm.nih.gov/genome/annotation_prok/
            
            ##Genome-Annotation-Data-START##
            Annotation Provider                    :: NCBI
            Annotation Date                        :: 07/30/2015 22:36:20
            Annotation Pipeline                    :: NCBI Prokaryotic Genome
                                                      Annotation Pipeline
            Annotation Method                      :: Best-placed reference
                                                      protein set; GeneMarkS+
            Annotation Software revision           :: 3.0
            Features Annotated                     :: Gene; CDS; rRNA; tRNA;
                                                      ncRNA; repeat_region
            Genes                                  :: 4,388
            CDS                                    :: 4,188
            Pseudo Genes                           :: 73
            CRISPR Arrays                          :: 2
            rRNAs                                  :: 8, 7, 7 (5S, 16S, 23S)
            complete rRNAs                         :: 8, 7, 7 (5S, 16S, 23S)
            tRNAs                                  :: 82
            ncRNA                                  :: 15
            Frameshifted Genes                     :: 40
            Frameshifted Genes On Monomer Runs     :: 8
            Frameshifted Genes Not On Monomer Runs :: 1
            ##Genome-Annotation-Data-END##
            COMPLETENESS: full length.
FEATURES             Location/Qualifiers
     source          1..27702
                     /organism="Yersinia pseudotuberculosis IP 32953"
                     /mol_type="genomic DNA"
                     /strain="IP 32953"
                     /db_xref="taxon:273123"
                     /plasmid="pYptb32953"
     gene            202..1188
                     /locus_tag="YPTB_RS21890"
                     /old_locus_tag="pYptb0001"
     CDS             202..1188
                     /locus_tag="YPTB_RS21890"
                     /old_locus_tag="pYptb0001"
                     /function="IPR000525 Initiator RepB protein"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191397.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="RepB family plasmid replication initiator
                     protein"
                     /protein_id="WP_011191397.1"
                     /db_xref="GI:499504757"
                     /translation="MESRSKLIVSQGNNLLEGAYNISRDEIRFLFLALTKIDSKIPQP
                     DGLYTLYPAEFEKMFGVNKAHIHQSLKNAASSLGKKPIYTYEYNEKKKRIDRVERFWF
                     SSIRYDESGVGADVTVRFSQDVALYLYELKKEFTQLKIDVIAKLTDSPFALRLYSWLI
                     KYKNLSRCINSEKVITTDAIDIEWMKERAGLAGKYKEYKFFKRDILEPAINVINAKTD
                     ISVLWEPIKHGRNIVSIKFSYVEEKNSLGCKPLRPRLPRRPKAIKGSAMEGEWASKCI
                     SIMSEFKKSLIAYDPNEKIAVSDLKKWVHWCEIIGDKYQMKVINAEIKERTK"
     gene            1316..1624
                     /locus_tag="YPTB_RS21895"
                     /old_locus_tag="pYptb0002"
     CDS             1316..1624
                     /locus_tag="YPTB_RS21895"
                     /old_locus_tag="pYptb0002"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191398.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191398.1"
                     /db_xref="GI:499504758"
                     /translation="MADLNFTHLHGLTQMKMLFPELTEKQFRLTYYWVVGGDIIDIAK
                     LSESSLDAVKKTLQRTRQNLGCDRLETVRLIFLARIETAKFIQTSIIIDMLNKSNLFN
                     "
     gene            1910..2137
                     /locus_tag="YPTB_RS21900"
                     /old_locus_tag="pYptb0003"
     CDS             1910..2137
                     /locus_tag="YPTB_RS21900"
                     /old_locus_tag="pYptb0003"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191399.1"
                     /db_xref="GI:499504759"
                     /translation="MTKKKNSVIDDDSYTSSGGVWYATSSSVKMSGKANFILAKLKLL
                     HPSKSKSMIIKDIVEKSLIEIDKEINKQGIK"
     gene            2572..3189
                     /locus_tag="YPTB_RS21905"
                     /old_locus_tag="pYptb0004"
     CDS             2572..3189
                     /locus_tag="YPTB_RS21905"
                     /old_locus_tag="pYptb0004"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191400.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TriA protein"
                     /protein_id="WP_011191400.1"
                     /db_xref="GI:499504760"
                     /translation="MLSTAAFLSLALQCASTVHPDTAQDIARIESGFNPYAIGVVGQK
                     KGLFPTNKEDALKHVKRLRVEGKNFSVGLMQINQANFKQYGVDAAALFTPCVNLSVFE
                     KIITDCYQRGKTLKRALSCYYSGNFVVGQKKESEFGSTSYTERAGYTPAPRYVVPSTK
                     TDKANTSPDKAESPAPSTTPKTRRIVYPSQLVRGEFVDLTALNGE"
     gene            3194..3487
                     /locus_tag="YPTB_RS21910"
                     /old_locus_tag="pYptb0005"
     CDS             3194..3487
                     /locus_tag="YPTB_RS21910"
                     /old_locus_tag="pYptb0005"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191401.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TriB protein"
                     /protein_id="WP_011191401.1"
                     /db_xref="GI:499504761"
                     /translation="MSLFQKIKSLFLHPILMPVLALASRPALADGFSKANDLMDKISA
                     GLTVLSVGTITVAVMWVGYKVLWNGQSLKDCGNIIIGAGLIIGGSEFARLFTD"
     gene            3506..6253
                     /locus_tag="YPTB_RS21915"
                     /old_locus_tag="pYptb0006"
     CDS             3506..6253
                     /locus_tag="YPTB_RS21915"
                     /old_locus_tag="pYptb0006"
                     /function="IPR004346 IPR007792 Type IV secretory pathway"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191402.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="ATPase"
                     /protein_id="WP_011191402.1"
                     /db_xref="GI:499504762"
                     /translation="MTTIFKALTRPAMILGVPIIPLIIAMSGISLAAVYTTTKFFFLI
                     PVAWWYMRHLARKDAHIFSLMGLKIRTKGNGKTNQHFDSTAWLANDYGDVDITEFLNA
                     MRLNERVTLTDKIPYSSHVHEYIIKGKNSDLMASWEVGGSVFEFETDEQKNMKSAQLN
                     TLIKSFEGEPVTFYIHNSRENYHDSFQQNSGNAFADEVAKRYYEGMEGDAFYRNRLFL
                     TVCMMPPSTLGKAERKGMSAGQKQRSLDGAIKRMQEIRATLNTALTPLHATPLGTFEE
                     DGVVYSSQLSFYHFLLTGIWQKIRVTRTPFYEVLGTADLFFSGASGQRNTIRGTEFFR
                     TLEIKDYSPKSVTGLLDVLLHAPCNYVLTQSYTCMAKDEGQEAIKTVEKRLSSAEDDA
                     VSQQTDLLVARDLLQSGHIAFGLYHFSLLISAPTLEALVKDTNTLANGLTNAGIVSTL
                     ASLSLAAGYFAQMPGVYTLRPRLVPVSSQNFVEMASFHNFSEGKRDRVPWGEAVAVVK
                     TPSGGAHYLNIHNTLLGKDDFNEKNAGNASIVGTIGSGKTMLISWLANMMQKYRQQSS
                     FSPHAKKKRLCTVVLDKDRGTELNIRQLGGRYFRVKSGEPTGWNPFRLKPTKRNIDFI
                     KKLMKLLCTRNGNTLSTRQETRLSDAVDAVMLGLDHASRDHGITRVLENITEPATMEA
                     QENGLKIRLAQWAKGGEFGWVFDNEEDTFDISECDIFGIDGTEFLDDSDVCAPISFYL
                     LYRITSLLDGRRLVLFIDEVWKWLNDPAFKKLMFNLLKTIRKLNGLVIPATQSPSDLL
                     KSSISTAMVEQCGTQFFLPNPMAEYKDYVEGLKVPPAVFEVIKGLDPLSRQFVLIKSP
                     LRKGDTERFAVLVTLDLSGLGKYTKILSGSEDNLAIFDSIFTEGMAPEEWRDTFLAQA
                     I"
     gene            6318..7031
                     /locus_tag="YPTB_RS21920"
                     /old_locus_tag="pYptb0007"
     CDS             6318..7031
                     /locus_tag="YPTB_RS21920"
                     /old_locus_tag="pYptb0007"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191403.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TriD protein"
                     /protein_id="WP_011191403.1"
                     /db_xref="GI:499504763"
                     /translation="MSLKTCVGLLLCLLGAAAPTFAAGIIVFDPTAKLENAEQWAKEL
                     RQWENTAKHYTSQIDAYKAQLATATGLRDIGSFVNQAKGLTADLKNLQKNGTSLNSLL
                     SSGGSMSGELEQLYSKYSMFDICNDNESAPFINTCKQTVVNKAIALEESEAVQQKITE
                     TLNDVSQLSLRLENATDSKESQDLANTLSLKTVQLNTLTTQWEMNAKQSEMRDKLLID
                     KQQKAFSKQQSEAPIPTFH"
     gene            7097..7348
                     /locus_tag="YPTB_RS21925"
                     /old_locus_tag="pYptb0008"
     CDS             7097..7348
                     /locus_tag="YPTB_RS21925"
                     /old_locus_tag="pYptb0008"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191404.1"
                     /note="Antitoxin that counteracts the effect of the YoeB
                     toxin; Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="prevent-host-death family protein"
                     /protein_id="WP_011191404.1"
                     /db_xref="GI:499504764"
                     /translation="MRTVNYSEARQNLAATMVKTVEDRAPVLITRQNGSACVLMSLEE
                     YESLEETAYLMRSPANAMNLMSSIEELRGGKGTERKLAE"
     gene            7345..7599
                     /locus_tag="YPTB_RS21930"
                     /old_locus_tag="pYptb0009"
     CDS             7345..7599
                     /locus_tag="YPTB_RS21930"
                     /old_locus_tag="pYptb0009"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191405.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="toxin YoeB"
                     /protein_id="WP_011191405.1"
                     /db_xref="GI:499504765"
                     /translation="MKIVFSSQSWEDYLYWQQTDKKILKRINELIKDIQRMPFEGKGK
                     PEPLKYNLSGFWSRRITEEHRLVYEVADDSVLIAACRYHY"
     gene            7718..7963
                     /locus_tag="YPTB_RS21935"
                     /old_locus_tag="pYptb0010"
     CDS             7718..7963
                     /locus_tag="YPTB_RS21935"
                     /old_locus_tag="pYptb0010"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191406.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191406.1"
                     /db_xref="GI:499504766"
                     /translation="MRNLIVLALVASASAALLAGCKEEAKTYAWYSEHPDETYKVYKK
                     CLETGEASLNCEGARRAAIGFGRGGDKDLEQKFNSLK"
     gene            7975..9015
                     /locus_tag="YPTB_RS21940"
                     /old_locus_tag="pYptb0011"
     CDS             7975..9015
                     /locus_tag="YPTB_RS21940"
                     /old_locus_tag="pYptb0011"
                     /function="IPR007688 TriE/TrbL/VirB6 plasmid conjugal
                     transfer protein"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191407.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TriE protein"
                     /protein_id="WP_011191407.1"
                     /db_xref="GI:499504767"
                     /translation="MAGFFEKFNTTIMDKLTTMGDVYQAQYATGIMSLMVGAVTLYIL
                     YVGYSTLGGKLQTPVPDLVWNLARFAMLITFITNAGGYLTALTEGLNGLKAGFTGDTS
                     VWAALDTLWDSTQKLADKIYDKDKSTYVAVSGGLGAALVWGGAIFLMFTSAVVFLTAD
                     ITMLFMLMTAPIFLFCLMFGFLRPMFNSWLQLIFSSILTVLFASIVIRLAIDFQVEIA
                     GQVATQADDSNLMTMGAMGAVAGLLSGVLVTLAAGFASKLAGAGAEGAMQGLAMAGAM
                     KAAKPVGKAAAKGAGKVAGGIGNGLGGIGNKAASNLNSAPAVNPTAARAKAAVESMKA
                     FSASQSSKIVSK"
     gene            9186..9869
                     /locus_tag="YPTB_RS21945"
                     /old_locus_tag="pYptb0012"
     CDS             9186..9869
                     /locus_tag="YPTB_RS21945"
                     /old_locus_tag="pYptb0012"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191408.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="membrane protein"
                     /protein_id="WP_011191408.1"
                     /db_xref="GI:499504768"
                     /translation="MSKTKQLINASKTFEEKLLTRDARDKKVGFFIGGTGLLMGVFGI
                     VAVIMLLPLKETELELYTVDNTTGRVEKITHVKQQDISSHEALAKAFAANYVKLRESY
                     NYFSLQHDYDTVPLFGSDAVNADYLAFFNGKNSPDMVYQKAAYVVNIEIISNVISDAT
                     DPDKLAQIRFKKTLRRVADGNTKVEYWNSRVTFRYVPEKALTEAQREANPLGFTVTSY
                     QRDKEIRGE"
     gene            9911..10816
                     /locus_tag="YPTB_RS21950"
                     /old_locus_tag="pYptb0013"
     CDS             9911..10816
                     /locus_tag="YPTB_RS21950"
                     /old_locus_tag="pYptb0013"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191409.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type conjugative transfer protein VirB9"
                     /protein_id="WP_041175533.1"
                     /db_xref="GI:752489513"
                     /translation="MLCTFTFSCAIIIFSPHALAAATPQGSAFDSRMQHVSYNAQNAT
                     VINARAGYVTTLVFSDDEAVISTEVGFVQGWSITKEANRVYIRPAPITQPSIDDEGKE
                     IQEVFNPTADDWKTNLFVTTTRHFYSLELSVLDGEEMPKNLAFVVTYRYPDEVKTKTE
                     QAQTAREKEWQEQQSKARITQALKNGQAPRNWDYSMQVGKDSRMITPDFAYDDGRFTY
                     LGFSPLKKFPTATLYINGVEQVPNTSVKPMGNYQVMVIQHINPTMVLRYGDAVVGVIN
                     QGFGKVTVAAGNTVSPAVERVEVKS"
     gene            10813..12045
                     /locus_tag="YPTB_RS21955"
                     /old_locus_tag="pYptb0014"
     CDS             10813..12045
                     /locus_tag="YPTB_RS21955"
                     /old_locus_tag="pYptb0014"
                     /function="IPR005498 Bacterial conjugation TrbI-like
                     protein"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_005967114.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="TriI protein"
                     /protein_id="WP_011191410.1"
                     /db_xref="GI:499504770"
                     /translation="MTDKTSVVLDPHGEEEFAAPGAADNSDHEPTVAELEAAARAKVS
                     AKNEADAPASNSKVGTPEVNKLKPHRQNRLVFVMVAVLVVLIVMAWGGDWIYRNFLKS
                     APASPEAASLSSSSAPAQRRSGMGAEIKPFFVDESEAIVLPEIPAEGEQPSRLTPPSF
                     NKTRALVSRGTVTAPASGTALSRVSERTLSTGSGTPATASTTPAAGNVGVTSIPFDPD
                     LYIPEGRYIPCSLGTRFVSDVAGRISCNISEDIYSASGHTKLIEKGTTAKGVYKTGTL
                     KAGQSRMFIVWTELRTPDAKKIPLVDTQVVGQLGEAGIDGWIDTHFWERFGNTLLLST
                     VSDVAAVAATGGTDRNRNTDYTENTRAASVEMAKIALENNIGIPPTIYKNQGDIIGMI
                     VGEDIDFSNIYTLRMKQW"
     gene            12050..12265
                     /locus_tag="YPTB_RS21960"
     CDS             12050..12265
                     /locus_tag="YPTB_RS21960"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175531.1"
                     /db_xref="GI:752489511"
                     /translation="MDVIPLLFVGLVGLVGLAVVIVSCLIFGSIFKIELFVSYKMEFL
                     VCLIFLLAGAISIILSNYVISALRNLS"
     gene            12265..13275
                     /locus_tag="YPTB_RS21965"
                     /old_locus_tag="pYptb0015"
     CDS             12265..13275
                     /locus_tag="YPTB_RS21965"
                     /old_locus_tag="pYptb0015"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191411.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="P-type DNA transfer ATPase VirB11"
                     /protein_id="WP_041175535.1"
                     /db_xref="GI:752489515"
                     /translation="MKNKSLDTFKNKLFGDFLALDGLTEIAVNRPNQLFTKVNGVWQK
                     HTHAISLDQCMQFSTALANYNKDHVEDIKPILSATLESGERCQIVMPPACQGDTVSIT
                     IRKPSKLQIPHQSYIDSGFYSRVMGSETADNHDTELLRLYSENIPLFMEKCVEYGKVI
                     LFVGKTSSGKTTYMKTLIGYIPLGLRIVTIEDNPEIEFRQHENYVHLFYPSEGGEDAI
                     VSPASLIRANFRMNPDRILLTEVRGPEAWDALKIIGSGHDGLITSMHAGTPTEAIDGL
                     VTRCYQNPECRQLPYSVLLRKVLDSVDVIASIDVNGNVRRMGDVYFKPVHRQKFLEEF
                     TK"
     gene            13272..13694
                     /locus_tag="YPTB_RS21970"
                     /old_locus_tag="pYptb0016"
     CDS             13272..13694
                     /locus_tag="YPTB_RS21970"
                     /old_locus_tag="pYptb0016"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_000592251.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191412.1"
                     /db_xref="GI:499504772"
                     /translation="MKHLIRPCWVAVGLMLAGCSSPPEPMAVKWDATPTTVNSTLPQW
                     QENHVVVHSPDVVGSWSKRITDFQGDNGSYGPDFYYAVVHSTRIVVASNSSSAWFNTA
                     AWLQLHGATAPIEFNRKLDCLTCNTVDVYLSRSDFASK"
     gene            14071..14376
                     /locus_tag="YPTB_RS21975"
                     /old_locus_tag="pYptb0017"
     CDS             14071..14376
                     /locus_tag="YPTB_RS21975"
                     /old_locus_tag="pYptb0017"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191413.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191413.1"
                     /db_xref="GI:499504773"
                     /translation="MKKILSGAALLCLTFIIPAPVFAADVCEVVTCMYGKMTGGDGGE
                     DCRAAERDFFSLNAFKKKGRFDPTKTADMRRSLLTGCSGADPKDIADIISKFGQIRG"
     gene            14519..15769
                     /locus_tag="YPTB_RS22205"
                     /old_locus_tag="pYptb0018"
     CDS             14519..15769
                     /locus_tag="YPTB_RS22205"
                     /old_locus_tag="pYptb0018"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_012105384.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191414.1"
                     /db_xref="GI:499504774"
                     /translation="MSVNMAFVLKMSLFCIPLVGNAADINVGDNSSTGNGGNNIVVGN
                     GSNIDGGGGNSIFGSGGSISGGGGGGMVVGSGSIDSGGGGNLVLGSGSIIDGGGGLVI
                     GSGSVTNGGQSLGGGNASNGGVTIGGGTADGGVAIGASSVTTGNGVSFGGSAGSNEFS
                     VGYRAITKVSEGVNGTDAVNVNQLNSAKNSLTNLVNSTAETTLNSANTYTDSQVSNLN
                     TVINNTAEMTLNTANNYTDSQVSNLNTVINNTAETTLNTANNYTDSQVSNVTNDLITV
                     INDSSQTTLNNANNYTDSRVSNITNVAIEEANSYTDYKFEGFIDESRSYTDKRVNDLS
                     NKVDRNYKRANAGIAGAMAQAAIPQQFGYKYNFGMALGNYRDGTAIAAGGSFQVKKNV
                     VSKTAVSWDAEGGVGVSAGVSVGW"
     gene            15826..16092
                     /locus_tag="YPTB_RS21985"
                     /old_locus_tag="pYptb0019"
     CDS             15826..16092
                     /locus_tag="YPTB_RS21985"
                     /old_locus_tag="pYptb0019"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191415.1"
                     /db_xref="GI:499504775"
                     /translation="MYTVSIDDFEQILKDDELPINEMVLMSAILSEVKEFSKTFIPNC
                     NDLVDKASEHSITYNRLTEGDKLFLNGIMSMPLFICYGSNCLLN"
     gene            16111..16524
                     /locus_tag="YPTB_RS21990"
                     /old_locus_tag="pYptb0020"
     CDS             16111..16524
                     /locus_tag="YPTB_RS21990"
                     /old_locus_tag="pYptb0020"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191416.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA-binding protein"
                     /protein_id="WP_011191416.1"
                     /db_xref="GI:499504776"
                     /translation="MSDNYAEVKRILANIRTIRTFVREVDYLFLVEAHEKLGVALEER
                     KAEFECEQEELNKKEAKKKELLAFIASEGFTLEELNGNGITKRKKPPVHRKPKYTFEE
                     NGEMKVWSGVGRKPKPIEVALNEGKTLSDFLICSV"
     gene            16529..16801
                     /locus_tag="YPTB_RS21995"
                     /old_locus_tag="pYptb0021"
     CDS             16529..16801
                     /locus_tag="YPTB_RS21995"
                     /old_locus_tag="pYptb0021"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191417.1"
                     /db_xref="GI:499504777"
                     /translation="MGTRIENPNRRGACFIAENILKRLDKDAVRRCGSYDRLYAVFLK
                     ENIYEFADTLESKEREKFLFVAREIHCLDEVPSINEVMKKISLEQF"
     repeat_region   16870..17000
     repeat_region   17576..18202
     gene            17683..18336
                     /locus_tag="YPTB_RS22000"
     CDS             17683..18336
                     /locus_tag="YPTB_RS22000"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_041175532.1"
                     /db_xref="GI:752489512"
                     /translation="MGPKKPNRVNNMSNQIMQKLSVISDNAIAFFAYLQAHQLLLALL
                     AGLTLPFIFFLTKDEHEKAPTWQKCVIVFSFICLLFGTLSPLSFGVIYYIYERAGFNV
                     SPVLWGVLIAFTTVGIVFHYVARRMLAPELDKLKHKLIKKSSLERNVRTDVRNVKALL
                     PTTEHYNPADYIDPKKKIKGSTPTPPFLFGFTHLQKSLPPKTSIRASPARIAIPLIG"
     repeat_region   18345..18971
     gene            18485..20266
                     /locus_tag="YPTB_RS22005"
                     /old_locus_tag="pYptb0029"
     CDS             18485..20266
                     /locus_tag="YPTB_RS22005"
                     /old_locus_tag="pYptb0029"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191424.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="molybdopterin-guanine dinucleotide biosynthesis
                     protein MobB"
                     /protein_id="WP_011191424.1"
                     /db_xref="GI:499504784"
                     /translation="MSNQIMQKLSVISDNAIAFFAYLQAHQLLLALLAGLTLPFIFFL
                     TKDEHEKAPTWQKCVIVFSFICLLFGTLSPLSFGVIYYIYERAGFNVSPVLWGVLIAF
                     TTVGIVFHYVARRMLAPELDKLKHKLIKKSSLERNVRTDVRNVKALLPKTEHYNPADY
                     IDLNKGIFVGLDEHHQPMYIPVSDWQKQHAAIIGTTGAGKGVATGLLLTQSIMAGEGV
                     FVLDPKDDEWAPHLFRKACEDAGKPFALINLNKPEYQLNLIANINADQLEELFIAGFS
                     LAEKGEAADFYRIDDRRAARAAAQIINDNPTATVRDLFNSEYVQSIGEDIKGFFGKIE
                     ELALLNSINAVDGFDLKKIFDEGGCCYVIGSLRNSKVIMTQRMILVRLLQLAETRDRI
                     NSTPRPIAIFLDEFKYHISRPALEGLGAARDKGVHVSMAFQAIDDLRDCPADLNGDAV
                     VGAVVENAKFKLVYKLQNPETAEWVAKMSGTILVDDESRKAKTSKVLTETIDDERTIR
                     QAERYFIDSNMLLNLPPFVSYIFTATDLPRASLISPIKVKKQALVIHSAPLEKQKEVH
                     KDLDFVETPPIPPTKKKVEAEEESPLF"
     gene            20286..21014
                     /locus_tag="YPTB_RS22010"
                     /old_locus_tag="pYptb0030"
     CDS             20286..21014
                     /locus_tag="YPTB_RS22010"
                     /old_locus_tag="pYptb0030"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191425.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_042593115.1"
                     /db_xref="GI:756143870"
                     /translation="MIDPVLRKNRKKEKILTLLMFLKEETYSDRLTLMFLFNFKEQRV
                     LYRLLNKVTEMGLIQKYVFESRGGNISLWGITNDGLSVVFKPEDNVFPPRFEPTKLKG
                     WMLDHHLDNQTVRLALERQGATEWINGDRNNFLNKFSVKHRPDGLITLPNGQRVAIET
                     ERSLKTKARYQQIMTSHLLARTDELWFTVFYVLPDVQKKISLMKIFESIKFVIINSKP
                     IEIEARHRNVFQFFTLDELKELSF"
     gene            21070..23232
                     /locus_tag="YPTB_RS22015"
                     /old_locus_tag="pYptb0031"
     CDS             21070..23232
                     /locus_tag="YPTB_RS22015"
                     /old_locus_tag="pYptb0031"
                     /EC_number="5.99.1.2"
                     /function="IPR005738 Bacterial DNA topoisomerase III"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191426.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA topoisomerase III"
                     /protein_id="WP_011191426.1"
                     /db_xref="GI:499504786"
                     /translation="MRVFIAEKPALAKVIADALGAGVRKDGYIQCGSDVVTWCVGHIL
                     ELSPPEAHNPAYAKWNAADLPLKLRPAKYQPKTTTAAQFKVVQQLVGQATEIVHAGDP
                     DDEGQLLVDEVLTYCDNTSPVKRVLINDLNTAAAKKALANLRDNREFLGLSQKALARS
                     IGDQLYGFNMTRAYTLAAQQKGVQGVLSVGRVQTPILGLIVNRFNTFQNHSAAFFYNL
                     SANIDVIGHRIVPRYQVPEGAPVDDKGRLIDETVANDVATACKGQPATVTASQTEEKS
                     TPAPLPFSLLDLQAHMSKKHGLSAQQTQDVTQSLRENHKAITYNRSDCNYLTSEQFGD
                     ACATLAAIASALPVLAVSLSEANPAQKGRAFDDKKVSAHTAIIPTTTAPNPASMTVNE
                     RQVYHAIAAQYLAQFLPEKRYLAASATFAVNGHIFIAKATQTTQDGWTTLLSGTEDNE
                     GESNDEFETSPFAALSALSNSDEGVCESVTVSKEKTKPLPLYTEATLLKDLQRVAKYV
                     KDPKIRQLLKDRDAGKTGEHGGIGTPATRASMLETLQKRGFYTVEKKKLIPTELGLSF
                     IASLPEIATAPDMTALWHEQQQMIEQGSFTVDEFLDALEDFIAGQMNNVDLSGMADGV
                     PQTQSSQRPRLTAVCPKCNGAVVISAKVYACSGCELKVWGEVASKKLTLPQVETLFSK
                     GKTAVLKGFKSKAGKPFDAKLVLDTATGKVSFEFENKK"
     repeat_region   23252..23382
     gene            23751..23999
                     /locus_tag="YPTB_RS22020"
                     /old_locus_tag="pYptb0034"
     CDS             23751..23999
                     /locus_tag="YPTB_RS22020"
                     /old_locus_tag="pYptb0034"
                     /inference="COORDINATES: ab initio prediction:GeneMarkS+"
                     /note="Derived by automated computational analysis using
                     gene prediction method: GeneMarkS+."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191429.1"
                     /db_xref="GI:499504789"
                     /translation="MGIITVRSTDEIDAVIERVKLLMDTKTASSTLTKAVLDYEPNQL
                     ELKRLRSELAKAEYQVEKYRDGMQKFKAAADHIINLEL"
     gene            complement(24036..25016)
                     /locus_tag="YPTB_RS22025"
                     /old_locus_tag="pYptb0035"
     CDS             complement(24036..25016)
                     /locus_tag="YPTB_RS22025"
                     /old_locus_tag="pYptb0035"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191430.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="DNA primase"
                     /protein_id="WP_011191430.1"
                     /db_xref="GI:499504790"
                     /translation="MTMTLNSQLTSPNTVPATSVSPLDESGSSNTKWSKGKKAPTQDL
                     YQTVTDSIIEALEAGVKPWVCPWQRVNGMSGIPANYTTGATYSGINIMLLWASASKQG
                     FTDGRWLTYKQAEAKGAQVRKGEKGTTAIFYKTLEKEDEQGETTKIPMLKTFTVFNVQ
                     QIDGLPLETAEQETSPIAEPTTFESLPRVEALIQQCGATIIERGQAAYFRPSTDEIVL
                     PERHLFDDAANFYATALHELTHWTGGKTRLNRDMRGVFGNASYAFEELIAELGSAFLM
                     ADFGVVGDVQHESYIASWLNALKNDKRFIFKAASSASKAHQFLIASNSAE"
     gene            25339..25575
                     /locus_tag="YPTB_RS22030"
                     /old_locus_tag="pYptb0036"
     CDS             25339..25575
                     /locus_tag="YPTB_RS22030"
                     /old_locus_tag="pYptb0036"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011147146.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191431.1"
                     /db_xref="GI:499504791"
                     /translation="MSAATIYTDSHNGKQYRVMNSNSARVQQYPAGVLIYFDGSSSAK
                     PQVTNFKTRANLNSWLRMMGFKNNTGVSINISSR"
     gene            25627..26253
                     /locus_tag="YPTB_RS22035"
                     /old_locus_tag="pYptb0037"
     CDS             25627..26253
                     /locus_tag="YPTB_RS22035"
                     /old_locus_tag="pYptb0037"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191432.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="peptide transporter"
                     /protein_id="WP_011191432.1"
                     /db_xref="GI:499504792"
                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLGGADVLLVDSDPQGSA
                     RDWAAVREDQPVTVVGIDRPTIERDLKNIAQKDYVVIDGAPQAADLAVSAIKAADFIL
                     IPVQPSPYDIWATADLVDLVKQRIELTDGKLQAAFVVSRAIKGTRIGQDVTEALKGYG
                     LPVLESRITQRVVYPGTAAAGKTVFDDLDKTASLEIQALCDEITLKLI"
     gene            26274..26489
                     /locus_tag="YPTB_RS22040"
                     /old_locus_tag="pYptb0038"
     CDS             26274..26489
                     /locus_tag="YPTB_RS22040"
                     /old_locus_tag="pYptb0038"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_011191433.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191433.1"
                     /db_xref="GI:499504793"
                     /translation="MSKNTNTLSAGRPSARTDRTTTLASLADTVSMKRVNFDISAENH
                     AKLKIYAAQQGKSIKEILSEFVEQLPI"
     gene            26513..26806
                     /locus_tag="YPTB_RS22045"
                     /old_locus_tag="pYptb0039"
     CDS             26513..26806
                     /locus_tag="YPTB_RS22045"
                     /old_locus_tag="pYptb0039"
                     /inference="EXISTENCE: similar to AA
                     sequence:RefSeq:WP_008250811.1"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Protein Homology."
                     /codon_start=1
                     /transl_table=11
                     /product="hypothetical protein"
                     /protein_id="WP_011191434.1"
                     /db_xref="GI:499504794"
                     /translation="MVNLSTEQLRFYNLVSTYPRISGLWNWEEKALHLDALNKELSVM
                     SGGEFVLTRFFSCLWYGHGQTKLPPFDIVSEISRLDDRERNLIAEWVANPFWP"
CONTIG      join(BX936400.1:1..27702)
//
DBGET integrated database retrieval system